WO2024030843A1 - Protease-cleavable moieties and methods of use thereof - Google Patents
Protease-cleavable moieties and methods of use thereof Download PDFInfo
- Publication number
- WO2024030843A1 WO2024030843A1 PCT/US2023/071298 US2023071298W WO2024030843A1 WO 2024030843 A1 WO2024030843 A1 WO 2024030843A1 US 2023071298 W US2023071298 W US 2023071298W WO 2024030843 A1 WO2024030843 A1 WO 2024030843A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- isolated polypeptide
- seq
- amino acid
- polypeptide
- activatable
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 104
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 498
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 448
- 229920001184 polypeptide Polymers 0.000 claims abstract description 436
- 108091005804 Peptidases Proteins 0.000 claims abstract description 150
- 239000004365 Protease Substances 0.000 claims abstract description 147
- 102100037942 Suppressor of tumorigenicity 14 protein Human genes 0.000 claims abstract description 88
- 101000661807 Homo sapiens Suppressor of tumorigenicity 14 protein Proteins 0.000 claims abstract description 80
- 239000000758 substrate Substances 0.000 claims abstract description 70
- 230000001225 therapeutic effect Effects 0.000 claims abstract description 35
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims abstract 5
- 230000027455 binding Effects 0.000 claims description 159
- 239000003795 chemical substances by application Substances 0.000 claims description 141
- 210000004027 cell Anatomy 0.000 claims description 101
- 150000001413 amino acids Chemical group 0.000 claims description 90
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 83
- 238000003776 cleavage reaction Methods 0.000 claims description 80
- 239000012634 fragment Substances 0.000 claims description 80
- 230000007017 scission Effects 0.000 claims description 80
- 206010028980 Neoplasm Diseases 0.000 claims description 77
- 239000000203 mixture Substances 0.000 claims description 73
- 239000000427 antigen Substances 0.000 claims description 70
- 230000001268 conjugating effect Effects 0.000 claims description 68
- 201000010099 disease Diseases 0.000 claims description 66
- 102000036639 antigens Human genes 0.000 claims description 61
- 108091007433 antigens Proteins 0.000 claims description 61
- 150000007523 nucleic acids Chemical class 0.000 claims description 50
- 239000013598 vector Substances 0.000 claims description 50
- 102000039446 nucleic acids Human genes 0.000 claims description 48
- 108020004707 nucleic acids Proteins 0.000 claims description 48
- 201000011510 cancer Diseases 0.000 claims description 38
- 241000282414 Homo sapiens Species 0.000 claims description 37
- 238000001727 in vivo Methods 0.000 claims description 32
- 230000000873 masking effect Effects 0.000 claims description 29
- 239000003814 drug Substances 0.000 claims description 27
- 210000001185 bone marrow Anatomy 0.000 claims description 23
- 208000023275 Autoimmune disease Diseases 0.000 claims description 22
- 230000035772 mutation Effects 0.000 claims description 20
- 238000011065 in-situ storage Methods 0.000 claims description 19
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 18
- 208000035475 disorder Diseases 0.000 claims description 17
- 238000010494 dissociation reaction Methods 0.000 claims description 17
- 230000005593 dissociations Effects 0.000 claims description 17
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 15
- 108090000695 Cytokines Proteins 0.000 claims description 13
- 102000004127 Cytokines Human genes 0.000 claims description 13
- 102000012479 Serine Proteases Human genes 0.000 claims description 13
- 108010022999 Serine Proteases Proteins 0.000 claims description 13
- 208000024172 Cardiovascular disease Diseases 0.000 claims description 12
- 208000027866 inflammatory disease Diseases 0.000 claims description 12
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 12
- 208000015181 infectious disease Diseases 0.000 claims description 11
- 229920002521 macromolecule Polymers 0.000 claims description 11
- 208000024891 symptom Diseases 0.000 claims description 10
- 239000003053 toxin Substances 0.000 claims description 10
- 231100000765 toxin Toxicity 0.000 claims description 10
- 229940124597 therapeutic agent Drugs 0.000 claims description 9
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 claims description 8
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 claims description 8
- 206010039509 Scab Diseases 0.000 claims description 7
- 108010044540 auristatin Proteins 0.000 claims description 7
- 238000002560 therapeutic procedure Methods 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 6
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 claims description 6
- 229960005501 duocarmycin Drugs 0.000 claims description 6
- 229930184221 duocarmycin Natural products 0.000 claims description 6
- 230000036541 health Effects 0.000 claims description 6
- 238000004519 manufacturing process Methods 0.000 claims description 6
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims description 5
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 claims description 5
- 229930195731 calicheamicin Natural products 0.000 claims description 5
- 229930188854 dolastatin Natural products 0.000 claims description 5
- 229940122255 Microtubule inhibitor Drugs 0.000 claims description 4
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 claims description 4
- 231100000782 microtubule inhibitor Toxicity 0.000 claims description 4
- 230000000069 prophylactic effect Effects 0.000 abstract description 4
- 125000003275 alpha amino acid group Chemical group 0.000 description 251
- 102000035195 Peptidases Human genes 0.000 description 145
- 125000005647 linker group Chemical group 0.000 description 133
- 235000019419 proteases Nutrition 0.000 description 110
- 235000001014 amino acid Nutrition 0.000 description 103
- 229940024606 amino acid Drugs 0.000 description 97
- 210000001519 tissue Anatomy 0.000 description 83
- 108090000623 proteins and genes Proteins 0.000 description 80
- 102000004169 proteins and genes Human genes 0.000 description 78
- 235000018102 proteins Nutrition 0.000 description 73
- -1 e.g. Proteins 0.000 description 47
- 230000021615 conjugation Effects 0.000 description 43
- 230000000694 effects Effects 0.000 description 43
- 229940027941 immunoglobulin g Drugs 0.000 description 42
- 238000006467 substitution reaction Methods 0.000 description 36
- 108010088842 Fibrinolysin Proteins 0.000 description 34
- 229940012957 plasmin Drugs 0.000 description 34
- 239000000523 sample Substances 0.000 description 28
- 238000006722 reduction reaction Methods 0.000 description 27
- 230000009467 reduction Effects 0.000 description 26
- 108060003951 Immunoglobulin Proteins 0.000 description 25
- 102000018358 immunoglobulin Human genes 0.000 description 25
- 230000002829 reductive effect Effects 0.000 description 25
- 102000004190 Enzymes Human genes 0.000 description 23
- 108090000790 Enzymes Proteins 0.000 description 23
- 230000004913 activation Effects 0.000 description 23
- 238000003556 assay Methods 0.000 description 23
- 229940088598 enzyme Drugs 0.000 description 23
- 238000000338 in vitro Methods 0.000 description 22
- 239000008194 pharmaceutical composition Substances 0.000 description 21
- 210000001744 T-lymphocyte Anatomy 0.000 description 20
- 239000003638 chemical reducing agent Substances 0.000 description 20
- 150000001875 compounds Chemical class 0.000 description 19
- 230000003993 interaction Effects 0.000 description 19
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 18
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 18
- 239000000562 conjugate Substances 0.000 description 18
- 239000012642 immune effector Substances 0.000 description 18
- 229940121354 immunomodulator Drugs 0.000 description 18
- 230000008685 targeting Effects 0.000 description 17
- 238000011282 treatment Methods 0.000 description 17
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 14
- 239000000463 material Substances 0.000 description 14
- 102000040430 polynucleotide Human genes 0.000 description 14
- 108091033319 polynucleotide Proteins 0.000 description 14
- 239000002157 polynucleotide Substances 0.000 description 14
- 102000005962 receptors Human genes 0.000 description 14
- 108020003175 receptors Proteins 0.000 description 14
- 235000004400 serine Nutrition 0.000 description 14
- 125000006850 spacer group Chemical group 0.000 description 14
- 125000003396 thiol group Chemical group [H]S* 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 13
- 230000004048 modification Effects 0.000 description 13
- 238000012986 modification Methods 0.000 description 13
- 230000000295 complement effect Effects 0.000 description 12
- 235000018417 cysteine Nutrition 0.000 description 12
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 12
- 238000001514 detection method Methods 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- 102000001301 EGF receptor Human genes 0.000 description 11
- 108060006698 EGF receptor Proteins 0.000 description 11
- 125000000539 amino acid group Chemical group 0.000 description 11
- 239000003153 chemical reaction reagent Substances 0.000 description 11
- 238000005859 coupling reaction Methods 0.000 description 11
- 210000002966 serum Anatomy 0.000 description 11
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 10
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 10
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 10
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 10
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 10
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 10
- 235000004279 alanine Nutrition 0.000 description 10
- 235000009582 asparagine Nutrition 0.000 description 10
- 229960001230 asparagine Drugs 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 10
- 230000008878 coupling Effects 0.000 description 10
- 238000010168 coupling process Methods 0.000 description 10
- 235000005772 leucine Nutrition 0.000 description 10
- 229920001223 polyethylene glycol Polymers 0.000 description 10
- 239000004471 Glycine Substances 0.000 description 9
- 102000008100 Human Serum Albumin Human genes 0.000 description 9
- 108091006905 Human Serum Albumin Proteins 0.000 description 9
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 9
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 9
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 9
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 9
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 9
- 239000004472 Lysine Substances 0.000 description 9
- 108010091175 Matriptase Proteins 0.000 description 9
- 239000002202 Polyethylene glycol Substances 0.000 description 9
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 9
- 210000004899 c-terminal region Anatomy 0.000 description 9
- 238000003384 imaging method Methods 0.000 description 9
- 235000014705 isoleucine Nutrition 0.000 description 9
- 229960000310 isoleucine Drugs 0.000 description 9
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 9
- 235000018977 lysine Nutrition 0.000 description 9
- 235000008729 phenylalanine Nutrition 0.000 description 9
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 108700012359 toxins Proteins 0.000 description 9
- 239000004474 valine Substances 0.000 description 9
- 235000014393 valine Nutrition 0.000 description 9
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 8
- 239000004475 Arginine Substances 0.000 description 8
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 8
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 8
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 8
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 8
- 239000004473 Threonine Substances 0.000 description 8
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 8
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 8
- 239000012472 biological sample Substances 0.000 description 8
- 238000005251 capillar electrophoresis Methods 0.000 description 8
- 229940079593 drug Drugs 0.000 description 8
- 150000002148 esters Chemical class 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 8
- 235000004554 glutamine Nutrition 0.000 description 8
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 230000002452 interceptive effect Effects 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 210000002381 plasma Anatomy 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 235000008521 threonine Nutrition 0.000 description 8
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 229920001213 Polysorbate 20 Polymers 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 230000024203 complement activation Effects 0.000 description 7
- 125000000524 functional group Chemical group 0.000 description 7
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 7
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 235000002374 tyrosine Nutrition 0.000 description 7
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 7
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 6
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 6
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 6
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 6
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 229940009098 aspartate Drugs 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 229930195712 glutamate Natural products 0.000 description 6
- 229940049906 glutamate Drugs 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 235000006109 methionine Nutrition 0.000 description 6
- 229930182817 methionine Natural products 0.000 description 6
- 210000000822 natural killer cell Anatomy 0.000 description 6
- 230000036961 partial effect Effects 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 235000013930 proline Nutrition 0.000 description 6
- 125000004434 sulfur atom Chemical group 0.000 description 6
- 150000003573 thiols Chemical class 0.000 description 6
- 102000009027 Albumins Human genes 0.000 description 5
- 108010088751 Albumins Proteins 0.000 description 5
- 239000004971 Cross linker Substances 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 5
- 230000001594 aberrant effect Effects 0.000 description 5
- 229940127089 cytotoxic agent Drugs 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 239000012636 effector Substances 0.000 description 5
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 5
- 239000007850 fluorescent dye Substances 0.000 description 5
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 5
- 235000014304 histidine Nutrition 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 239000012216 imaging agent Substances 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 210000000265 leukocyte Anatomy 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 5
- 210000005087 mononuclear cell Anatomy 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 230000002797 proteolythic effect Effects 0.000 description 5
- 229920002477 rna polymer Polymers 0.000 description 5
- RPENMORRBUTCPR-UHFFFAOYSA-M sodium;1-hydroxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].ON1C(=O)CC(S([O-])(=O)=O)C1=O RPENMORRBUTCPR-UHFFFAOYSA-M 0.000 description 5
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 238000007805 zymography Methods 0.000 description 5
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 4
- BLUGYPPOFIHFJS-UUFHNPECSA-N (2s)-n-[(2s)-1-[[(3r,4s,5s)-3-methoxy-1-[(2s)-2-[(1r,2r)-1-methoxy-2-methyl-3-oxo-3-[[(1s)-2-phenyl-1-(1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin-1-yl]-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]-3-methyl-2-(methylamino)butanamid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C=1SC=CN=1)CC1=CC=CC=C1 BLUGYPPOFIHFJS-UUFHNPECSA-N 0.000 description 4
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 4
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 241000283707 Capra Species 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 4
- 102000053602 DNA Human genes 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 102100037362 Fibronectin Human genes 0.000 description 4
- 108010067306 Fibronectins Proteins 0.000 description 4
- 108010024636 Glutathione Proteins 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 108010090804 Streptavidin Proteins 0.000 description 4
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 4
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 4
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 4
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 4
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 150000001299 aldehydes Chemical class 0.000 description 4
- 150000001408 amides Chemical class 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 230000000844 anti-bacterial effect Effects 0.000 description 4
- 239000002246 antineoplastic agent Substances 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 235000020958 biotin Nutrition 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 4
- 229960005395 cetuximab Drugs 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 229960002173 citrulline Drugs 0.000 description 4
- 239000002254 cytotoxic agent Substances 0.000 description 4
- 231100000599 cytotoxic agent Toxicity 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 239000005038 ethylene vinyl acetate Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 229960003180 glutathione Drugs 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 201000005202 lung cancer Diseases 0.000 description 4
- 208000020816 lung neoplasm Diseases 0.000 description 4
- VPKDCDLSJZCGKE-UHFFFAOYSA-N methanediimine Chemical compound N=C=N VPKDCDLSJZCGKE-UHFFFAOYSA-N 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 108010093470 monomethyl auristatin E Proteins 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 239000013610 patient sample Substances 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 4
- 238000003752 polymerase chain reaction Methods 0.000 description 4
- 239000012723 sample buffer Substances 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 229960000187 tissue plasminogen activator Drugs 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 229910052720 vanadium Inorganic materials 0.000 description 4
- LGNCNVVZCUVPOT-FUVGGWJZSA-N (2s)-2-[[(2r,3r)-3-[(2s)-1-[(3r,4s,5s)-4-[[(2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methoxy-5-methylheptanoyl]pyrrolidin-2-yl]-3-methoxy-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 LGNCNVVZCUVPOT-FUVGGWJZSA-N 0.000 description 3
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 3
- WOWDZACBATWTAU-FEFUEGSOSA-N (2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-n-[(3r,4s,5s)-1-[(2s)-2-[(1r,2r)-3-[[(1s,2r)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-n,3-dimethylbutanamide Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)C1=CC=CC=C1 WOWDZACBATWTAU-FEFUEGSOSA-N 0.000 description 3
- 239000012099 Alexa Fluor family Substances 0.000 description 3
- 102000030431 Asparaginyl endopeptidase Human genes 0.000 description 3
- 108090001008 Avidin Proteins 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 102000008186 Collagen Human genes 0.000 description 3
- 108010035532 Collagen Proteins 0.000 description 3
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010070675 Glutathione transferase Proteins 0.000 description 3
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 101000598058 Homo sapiens Transmembrane protease serine 11D Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 102100037025 Transmembrane protease serine 11D Human genes 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 229940121375 antifungal agent Drugs 0.000 description 3
- 229940034982 antineoplastic agent Drugs 0.000 description 3
- 108010055066 asparaginylendopeptidase Proteins 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 229920001436 collagen Polymers 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 108091008034 costimulatory receptors Proteins 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 239000000032 diagnostic agent Substances 0.000 description 3
- 229940039227 diagnostic agent Drugs 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 3
- 230000002538 fungal effect Effects 0.000 description 3
- 208000014829 head and neck neoplasm Diseases 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 229940099472 immunoglobulin a Drugs 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 238000011503 in vivo imaging Methods 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000002601 intratumoral effect Effects 0.000 description 3
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 108010059074 monomethylauristatin F Proteins 0.000 description 3
- 150000002894 organic compounds Chemical class 0.000 description 3
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 229920000747 poly(lactic acid) Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 150000003141 primary amines Chemical class 0.000 description 3
- 229940002612 prodrug Drugs 0.000 description 3
- 239000000651 prodrug Substances 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000013595 supernatant sample Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 2
- MPXTYZZFIJTPPA-UHFFFAOYSA-N 3beta,16beta,17alpha-trihydroxycholest-5-en-22-one 16-O-(2-O-(4-methoxybenzoyl)-beta-D-xylopyranosyl)-(1-3)-(2-O-acetyl-alpha-arabinopyranoside) Natural products C1=CC(OC)=CC=C1C(=O)OC1C(OC2C(C(OC3C(C4(C)CCC5C6(C)CCC(O)CC6=CCC5C4C3)(O)C(C)C(=O)CCC(C)C)OCC2O)OC(C)=O)OCC(O)C1O MPXTYZZFIJTPPA-UHFFFAOYSA-N 0.000 description 2
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 2
- 108091022885 ADAM Proteins 0.000 description 2
- 108091022879 ADAMTS Proteins 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 102100028728 Bone morphogenetic protein 1 Human genes 0.000 description 2
- 108090000654 Bone morphogenetic protein 1 Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 102100033620 Calponin-1 Human genes 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 102100024940 Cathepsin K Human genes 0.000 description 2
- 102100026540 Cathepsin L2 Human genes 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- 241000700199 Cavia porcellus Species 0.000 description 2
- 108010058432 Chaperonin 60 Proteins 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 108010041504 Costimulatory and Inhibitory T-Cell Receptors Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 150000008574 D-amino acids Chemical class 0.000 description 2
- 102100031111 Disintegrin and metalloproteinase domain-containing protein 17 Human genes 0.000 description 2
- JXOFEBNJOOEXJY-QNCIAAGJSA-N Dolastatin 16 Chemical compound C([C@@H](C)[C@H]1C(=O)N2CCC[C@H]2C(=O)N[C@@H]([C@H](C(=O)O[C@@H](C)C(=O)N2CCC[C@H]2C(=O)O[C@@H](C(=O)N(C)[C@H](C(C)C)C(=O)N2CCC[C@H]2C(=O)N1)C(C)C)C)C(C)C)C1=CC=CC=C1 JXOFEBNJOOEXJY-QNCIAAGJSA-N 0.000 description 2
- JXOFEBNJOOEXJY-UHFFFAOYSA-N Dolastatin 16 Natural products N1C(=O)C2CCCN2C(=O)C(C(C)C)N(C)C(=O)C(C(C)C)OC(=O)C2CCCN2C(=O)C(C)OC(=O)C(C)C(C(C)C)NC(=O)C2CCCN2C(=O)C1C(C)CC1=CC=CC=C1 JXOFEBNJOOEXJY-UHFFFAOYSA-N 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 101710089384 Extracellular protease Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 101000945318 Homo sapiens Calponin-1 Proteins 0.000 description 2
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 2
- 101001091385 Homo sapiens Kallikrein-6 Proteins 0.000 description 2
- 101000652736 Homo sapiens Transgelin Proteins 0.000 description 2
- 101000637855 Homo sapiens Transmembrane protease serine 11E Proteins 0.000 description 2
- 101000798702 Homo sapiens Transmembrane protease serine 4 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108090000144 Human Proteins Proteins 0.000 description 2
- 102000003839 Human Proteins Human genes 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- UQSXHKLRYXJYBZ-UHFFFAOYSA-N Iron oxide Chemical compound [Fe]=O UQSXHKLRYXJYBZ-UHFFFAOYSA-N 0.000 description 2
- 102100034866 Kallikrein-6 Human genes 0.000 description 2
- 102000005741 Metalloproteases Human genes 0.000 description 2
- 108010006035 Metalloproteases Proteins 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 229930193140 Neomycin Natural products 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 229920002732 Polyanhydride Polymers 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- 229920001710 Polyorthoester Polymers 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 2
- 102100038358 Prostate-specific antigen Human genes 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 108010039491 Ricin Proteins 0.000 description 2
- 102100031056 Serine protease 57 Human genes 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 101710084578 Short neurotoxin 1 Proteins 0.000 description 2
- BTCJGYMVVGSTDN-UHFFFAOYSA-N Spongistatin 7 Natural products C1C(=O)C(C)C(C2C)OCC2=CC(O2)CC(C)(O)CC2(O2)CC(O)CC2CC(=O)OC(C(C(CC(=C)CC(O)C=CC=C)O2)O)C(C)C2C(O)C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC22CC(OC)CC1O2 BTCJGYMVVGSTDN-UHFFFAOYSA-N 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 101710182532 Toxin a Proteins 0.000 description 2
- 102000004338 Transferrin Human genes 0.000 description 2
- 108090000901 Transferrin Proteins 0.000 description 2
- 108010033576 Transferrin Receptors Proteins 0.000 description 2
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 2
- 102100032001 Transmembrane protease serine 11E Human genes 0.000 description 2
- 102100032471 Transmembrane protease serine 4 Human genes 0.000 description 2
- 102100032452 Transmembrane protease serine 6 Human genes 0.000 description 2
- 206010052779 Transplant rejections Diseases 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000000118 anti-neoplastic effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000000611 antibody drug conjugate Substances 0.000 description 2
- 229940049595 antibody-drug conjugate Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 229920000249 biocompatible polymer Polymers 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000005907 cancer growth Effects 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 208000037976 chronic inflammation Diseases 0.000 description 2
- 230000006020 chronic inflammation Effects 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 108010082025 cyan fluorescent protein Proteins 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 2
- 108010045604 dolastatin 16 Proteins 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 230000008482 dysregulation Effects 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- SIDSGVZYNDYICD-UHFFFAOYSA-N halistatin 1 Natural products O1C2CC(C(O)CC(O)CO)OC2C(C)CC1(OC1C2)CC(C)C1OC2(OC1CC2OC3CC4C(=C)C(C)CC(O4)CCC4C(=C)CC(O4)CC4)CC1OC2C(C)C3OC(=O)CC(O1)CCC2C1C(O1)C3OC5CC14OC5C3(O)O2 SIDSGVZYNDYICD-UHFFFAOYSA-N 0.000 description 2
- 230000003862 health status Effects 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 108091008042 inhibitory receptors Proteins 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 238000009533 lab test Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000009630 liquid culture Methods 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 229960004927 neomycin Drugs 0.000 description 2
- 239000002858 neurotransmitter agent Substances 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 239000013631 noncovalent dimer Substances 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000008177 pharmaceutical agent Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 239000004633 polyglycolic acid Substances 0.000 description 2
- 239000004626 polylactic acid Substances 0.000 description 2
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical group C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 108010054624 red fluorescent protein Proteins 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 238000007910 systemic administration Methods 0.000 description 2
- 229910052713 technetium Inorganic materials 0.000 description 2
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 2
- 231100001274 therapeutic index Toxicity 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 239000012581 transferrin Substances 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- 229960001322 trypsin Drugs 0.000 description 2
- DZGWFCGJZKJUFP-UHFFFAOYSA-N tyramine Chemical compound NCCC1=CC=C(O)C=C1 DZGWFCGJZKJUFP-UHFFFAOYSA-N 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- AADVCYNFEREWOS-UHFFFAOYSA-N (+)-DDM Natural products C=CC=CC(C)C(OC(N)=O)C(C)C(O)C(C)CC(C)=CC(C)C(O)C(C)C=CC(O)CC1OC(=O)C(C)C(O)C1C AADVCYNFEREWOS-UHFFFAOYSA-N 0.000 description 1
- KQODQNJLJQHFQV-UHFFFAOYSA-N (-)-hemiasterlin Natural products C1=CC=C2C(C(C)(C)C(C(=O)NC(C(=O)N(C)C(C=C(C)C(O)=O)C(C)C)C(C)(C)C)NC)=CN(C)C2=C1 KQODQNJLJQHFQV-UHFFFAOYSA-N 0.000 description 1
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- HQXKELRFXWJXNP-UHFFFAOYSA-N (1R)-N,N'-dicarbamimidoyl-O4-[3-formyl-O2-(O4-alpha-D-mannopyranosyl-2-methylamino-2-deoxy-alpha-L-glucopyranosyl)-5-deoxy-alpha-L-lyxofuranosyl]-streptamine Natural products OCC1OC(OC2C(C(C)OC2OC2C(C(O)C(N=C(N)N)C(O)C2O)N=C(N)N)(O)C=O)C(NC)C(O)C1OC1OC(CO)C(O)C(O)C1O HQXKELRFXWJXNP-UHFFFAOYSA-N 0.000 description 1
- WCZBBVLCJJAASE-UHFFFAOYSA-N (2,3-dihydroxy-4-methoxyphenyl)-(3,4,5-trimethoxyphenyl)methanone Chemical compound OC1=C(O)C(OC)=CC=C1C(=O)C1=CC(OC)=C(OC)C(OC)=C1 WCZBBVLCJJAASE-UHFFFAOYSA-N 0.000 description 1
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- JSHOVKSMJRQOGY-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(pyridin-2-yldisulfanyl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCSSC1=CC=CC=N1 JSHOVKSMJRQOGY-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- QYEAAMBIUQLHFQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(pyridin-2-yldisulfanyl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCSSC1=CC=CC=N1 QYEAAMBIUQLHFQ-UHFFFAOYSA-N 0.000 description 1
- AGGWFDNPHKLBBV-YUMQZZPRSA-N (2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]-5-(carbamoylamino)pentanoic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=O AGGWFDNPHKLBBV-YUMQZZPRSA-N 0.000 description 1
- KUHSEZKIEJYEHN-BXRBKJIMSA-N (2s)-2-amino-3-hydroxypropanoic acid;(2s)-2-aminopropanoic acid Chemical compound C[C@H](N)C(O)=O.OC[C@H](N)C(O)=O KUHSEZKIEJYEHN-BXRBKJIMSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- XSAKVDNHFRWJKS-IIZANFQQSA-N (2s)-n-benzyl-1-[(2s)-1-[(2s)-2-[[(2s)-2-[[(2s)-2-(dimethylamino)-3-methylbutanoyl]amino]-3-methylbutanoyl]-methylamino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]pyrrolidine-2-carboxamide Chemical class CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC=2C=CC=CC=2)CCC1 XSAKVDNHFRWJKS-IIZANFQQSA-N 0.000 description 1
- IEUUDEWWMRQUDS-UHFFFAOYSA-N (6-azaniumylidene-1,6-dimethoxyhexylidene)azanium;dichloride Chemical compound Cl.Cl.COC(=N)CCCCC(=N)OC IEUUDEWWMRQUDS-UHFFFAOYSA-N 0.000 description 1
- KQODQNJLJQHFQV-MKWZWQCGSA-N (e,4s)-4-[[(2s)-3,3-dimethyl-2-[[(2s)-3-methyl-2-(methylamino)-3-(1-methylindol-3-yl)butanoyl]amino]butanoyl]-methylamino]-2,5-dimethylhex-2-enoic acid Chemical compound C1=CC=C2C(C(C)(C)[C@@H](C(=O)N[C@H](C(=O)N(C)[C@H](\C=C(/C)C(O)=O)C(C)C)C(C)(C)C)NC)=CN(C)C2=C1 KQODQNJLJQHFQV-MKWZWQCGSA-N 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- FUHCFUVCWLZEDQ-UHFFFAOYSA-N 1-(2,5-dioxopyrrolidin-1-yl)oxy-1-oxo-4-(pyridin-2-yldisulfanyl)butane-2-sulfonic acid Chemical compound O=C1CCC(=O)N1OC(=O)C(S(=O)(=O)O)CCSSC1=CC=CC=N1 FUHCFUVCWLZEDQ-UHFFFAOYSA-N 0.000 description 1
- LJWIIRATRWPHBA-UHFFFAOYSA-N 1-[(2,3,6-trichlorophenyl)methoxy]propan-2-ol Chemical compound CC(O)COCC1=C(Cl)C=CC(Cl)=C1Cl LJWIIRATRWPHBA-UHFFFAOYSA-N 0.000 description 1
- CULQNACJHGHAER-UHFFFAOYSA-N 1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 CULQNACJHGHAER-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- YBBNVCVOACOHIG-UHFFFAOYSA-N 2,2-diamino-1,4-bis(4-azidophenyl)-3-butylbutane-1,4-dione Chemical compound C=1C=C(N=[N+]=[N-])C=CC=1C(=O)C(N)(N)C(CCCC)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 YBBNVCVOACOHIG-UHFFFAOYSA-N 0.000 description 1
- ASNTZYQMIUCEBV-UHFFFAOYSA-N 2,5-dioxo-1-[6-[3-(pyridin-2-yldisulfanyl)propanoylamino]hexanoyloxy]pyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCNC(=O)CCSSC1=CC=CC=N1 ASNTZYQMIUCEBV-UHFFFAOYSA-N 0.000 description 1
- GVJXGCIPWAVXJP-UHFFFAOYSA-N 2,5-dioxo-1-oxoniopyrrolidine-3-sulfonate Chemical compound ON1C(=O)CC(S(O)(=O)=O)C1=O GVJXGCIPWAVXJP-UHFFFAOYSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- ZVEUWSJUXREOBK-DKWTVANSSA-N 2-aminoacetic acid;(2s)-2-amino-3-hydroxypropanoic acid Chemical group NCC(O)=O.OC[C@H](N)C(O)=O ZVEUWSJUXREOBK-DKWTVANSSA-N 0.000 description 1
- XBBVURRQGJPTHH-UHFFFAOYSA-N 2-hydroxyacetic acid;2-hydroxypropanoic acid Chemical compound OCC(O)=O.CC(O)C(O)=O XBBVURRQGJPTHH-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- LKDMKWNDBAVNQZ-UHFFFAOYSA-N 4-[[1-[[1-[2-[[1-(4-nitroanilino)-1-oxo-3-phenylpropan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-oxobutanoic acid Chemical compound OC(=O)CCC(=O)NC(C)C(=O)NC(C)C(=O)N1CCCC1C(=O)NC(C(=O)NC=1C=CC(=CC=1)[N+]([O-])=O)CC1=CC=CC=C1 LKDMKWNDBAVNQZ-UHFFFAOYSA-N 0.000 description 1
- CQXXYOLFJXSRMT-UHFFFAOYSA-N 5-diazocyclohexa-1,3-diene Chemical class [N-]=[N+]=C1CC=CC=C1 CQXXYOLFJXSRMT-UHFFFAOYSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 1
- 102100027400 A disintegrin and metalloproteinase with thrombospondin motifs 4 Human genes 0.000 description 1
- 102100026007 ADAM DEC1 Human genes 0.000 description 1
- 108091007504 ADAM10 Proteins 0.000 description 1
- 108091007507 ADAM12 Proteins 0.000 description 1
- 108091007505 ADAM17 Proteins 0.000 description 1
- 102000029750 ADAMTS Human genes 0.000 description 1
- 108091005660 ADAMTS1 Proteins 0.000 description 1
- 102000051388 ADAMTS1 Human genes 0.000 description 1
- 108091005664 ADAMTS4 Proteins 0.000 description 1
- 108091005663 ADAMTS5 Proteins 0.000 description 1
- 102000051389 ADAMTS5 Human genes 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 108010011170 Ala-Trp-Arg-His-Pro-Gln-Phe-Gly-Gly Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 101800002638 Alpha-amanitin Proteins 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 102100037293 Atrial natriuretic peptide-converting enzyme Human genes 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 102100021257 Beta-secretase 1 Human genes 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 1
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102000000584 Calmodulin Human genes 0.000 description 1
- 108010041952 Calmodulin Proteins 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 101000898643 Candida albicans Vacuolar aspartic protease Proteins 0.000 description 1
- 101000898783 Candida tropicalis Candidapepsin Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 108090000397 Caspase 3 Proteins 0.000 description 1
- 102000004018 Caspase 6 Human genes 0.000 description 1
- 108090000425 Caspase 6 Proteins 0.000 description 1
- 108090000567 Caspase 7 Proteins 0.000 description 1
- 102100035904 Caspase-1 Human genes 0.000 description 1
- 108090000426 Caspase-1 Proteins 0.000 description 1
- 102000004068 Caspase-10 Human genes 0.000 description 1
- 108090000572 Caspase-10 Proteins 0.000 description 1
- 102000004958 Caspase-14 Human genes 0.000 description 1
- 108090001132 Caspase-14 Proteins 0.000 description 1
- 102000004046 Caspase-2 Human genes 0.000 description 1
- 108090000552 Caspase-2 Proteins 0.000 description 1
- 102100029855 Caspase-3 Human genes 0.000 description 1
- 102100025597 Caspase-4 Human genes 0.000 description 1
- 101710090338 Caspase-4 Proteins 0.000 description 1
- 102100038916 Caspase-5 Human genes 0.000 description 1
- 101710090333 Caspase-5 Proteins 0.000 description 1
- 102100038902 Caspase-7 Human genes 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 102100026550 Caspase-9 Human genes 0.000 description 1
- 108090000566 Caspase-9 Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 108010059081 Cathepsin A Proteins 0.000 description 1
- 102000005572 Cathepsin A Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 102000003902 Cathepsin C Human genes 0.000 description 1
- 108090000267 Cathepsin C Proteins 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- 102000004178 Cathepsin E Human genes 0.000 description 1
- 108090000611 Cathepsin E Proteins 0.000 description 1
- 102000004173 Cathepsin G Human genes 0.000 description 1
- 108090000617 Cathepsin G Proteins 0.000 description 1
- 108090000625 Cathepsin K Proteins 0.000 description 1
- 108090000624 Cathepsin L Proteins 0.000 description 1
- 102000004172 Cathepsin L Human genes 0.000 description 1
- 101710169274 Cathepsin L2 Proteins 0.000 description 1
- 108090000613 Cathepsin S Proteins 0.000 description 1
- 102100035654 Cathepsin S Human genes 0.000 description 1
- 108010061117 Cathepsin Z Proteins 0.000 description 1
- 102000011937 Cathepsin Z Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 229920002101 Chitin Polymers 0.000 description 1
- 102100024539 Chymase Human genes 0.000 description 1
- 108090000227 Chymases Proteins 0.000 description 1
- 108091062157 Cis-regulatory element Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102100027995 Collagenase 3 Human genes 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108010060123 Conjugate Vaccines Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102000000529 Costimulatory and Inhibitory T-Cell Receptors Human genes 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 101000898784 Cryphonectria parasitica Endothiapepsin Proteins 0.000 description 1
- 102000005927 Cysteine Proteases Human genes 0.000 description 1
- 108010005843 Cysteine Proteases Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 239000012623 DNA damaging agent Substances 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- AADVCYNFEREWOS-OBRABYBLSA-N Discodermolide Chemical compound C=C\C=C/[C@H](C)[C@H](OC(N)=O)[C@@H](C)[C@H](O)[C@@H](C)C\C(C)=C/[C@H](C)[C@@H](O)[C@@H](C)\C=C/[C@@H](O)C[C@@H]1OC(=O)[C@H](C)[C@@H](O)[C@H]1C AADVCYNFEREWOS-OBRABYBLSA-N 0.000 description 1
- 102100039673 Disintegrin and metalloproteinase domain-containing protein 10 Human genes 0.000 description 1
- 102100031112 Disintegrin and metalloproteinase domain-containing protein 12 Human genes 0.000 description 1
- 102100031113 Disintegrin and metalloproteinase domain-containing protein 15 Human genes 0.000 description 1
- 102100024364 Disintegrin and metalloproteinase domain-containing protein 8 Human genes 0.000 description 1
- 102100024361 Disintegrin and metalloproteinase domain-containing protein 9 Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 1
- 102000010911 Enzyme Precursors Human genes 0.000 description 1
- 108010062466 Enzyme Precursors Proteins 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 150000000918 Europium Chemical class 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- 101710088083 Glomulin Proteins 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 102000004989 Hepsin Human genes 0.000 description 1
- 108090001101 Hepsin Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 1
- 101000719904 Homo sapiens ADAM DEC1 Proteins 0.000 description 1
- 101000952934 Homo sapiens Atrial natriuretic peptide-converting enzyme Proteins 0.000 description 1
- 101000894895 Homo sapiens Beta-secretase 1 Proteins 0.000 description 1
- 101000761509 Homo sapiens Cathepsin K Proteins 0.000 description 1
- 101000983577 Homo sapiens Cathepsin L2 Proteins 0.000 description 1
- 101000910979 Homo sapiens Cathepsin Z Proteins 0.000 description 1
- 101000577887 Homo sapiens Collagenase 3 Proteins 0.000 description 1
- 101000777455 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 15 Proteins 0.000 description 1
- 101000777461 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 17 Proteins 0.000 description 1
- 101000832767 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 8 Proteins 0.000 description 1
- 101000832769 Homo sapiens Disintegrin and metalloproteinase domain-containing protein 9 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001013150 Homo sapiens Interstitial collagenase Proteins 0.000 description 1
- 101000605522 Homo sapiens Kallikrein-1 Proteins 0.000 description 1
- 101001008919 Homo sapiens Kallikrein-10 Proteins 0.000 description 1
- 101001008922 Homo sapiens Kallikrein-11 Proteins 0.000 description 1
- 101000605514 Homo sapiens Kallikrein-13 Proteins 0.000 description 1
- 101000605520 Homo sapiens Kallikrein-14 Proteins 0.000 description 1
- 101001091379 Homo sapiens Kallikrein-5 Proteins 0.000 description 1
- 101001091388 Homo sapiens Kallikrein-7 Proteins 0.000 description 1
- 101001091371 Homo sapiens Kallikrein-8 Proteins 0.000 description 1
- 101000577881 Homo sapiens Macrophage metalloelastase Proteins 0.000 description 1
- 101000990912 Homo sapiens Matrilysin Proteins 0.000 description 1
- 101001011906 Homo sapiens Matrix metalloproteinase-14 Proteins 0.000 description 1
- 101001011884 Homo sapiens Matrix metalloproteinase-15 Proteins 0.000 description 1
- 101001011886 Homo sapiens Matrix metalloproteinase-16 Proteins 0.000 description 1
- 101001011887 Homo sapiens Matrix metalloproteinase-17 Proteins 0.000 description 1
- 101001011896 Homo sapiens Matrix metalloproteinase-19 Proteins 0.000 description 1
- 101001013139 Homo sapiens Matrix metalloproteinase-20 Proteins 0.000 description 1
- 101000627858 Homo sapiens Matrix metalloproteinase-24 Proteins 0.000 description 1
- 101000627852 Homo sapiens Matrix metalloproteinase-25 Proteins 0.000 description 1
- 101000627854 Homo sapiens Matrix metalloproteinase-26 Proteins 0.000 description 1
- 101000627860 Homo sapiens Matrix metalloproteinase-27 Proteins 0.000 description 1
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 1
- 101000990908 Homo sapiens Neutrophil collagenase Proteins 0.000 description 1
- 101001098833 Homo sapiens Proprotein convertase subtilisin/kexin type 6 Proteins 0.000 description 1
- 101000990915 Homo sapiens Stromelysin-1 Proteins 0.000 description 1
- 101000577874 Homo sapiens Stromelysin-2 Proteins 0.000 description 1
- 101000577877 Homo sapiens Stromelysin-3 Proteins 0.000 description 1
- 101000598055 Homo sapiens Transmembrane protease serine 11A Proteins 0.000 description 1
- 101000598054 Homo sapiens Transmembrane protease serine 11B Proteins 0.000 description 1
- 101000637853 Homo sapiens Transmembrane protease serine 11F Proteins 0.000 description 1
- 101000638154 Homo sapiens Transmembrane protease serine 2 Proteins 0.000 description 1
- 101000798700 Homo sapiens Transmembrane protease serine 3 Proteins 0.000 description 1
- 101000798704 Homo sapiens Transmembrane protease serine 5 Proteins 0.000 description 1
- 101000798696 Homo sapiens Transmembrane protease serine 6 Proteins 0.000 description 1
- 101000798698 Homo sapiens Transmembrane protease serine 7 Proteins 0.000 description 1
- 101000798710 Homo sapiens Transmembrane protease serine 9 Proteins 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 102000001399 Kallikrein Human genes 0.000 description 1
- 108060005987 Kallikrein Proteins 0.000 description 1
- 102100027613 Kallikrein-10 Human genes 0.000 description 1
- 102100027612 Kallikrein-11 Human genes 0.000 description 1
- 102100038315 Kallikrein-13 Human genes 0.000 description 1
- 102100038298 Kallikrein-14 Human genes 0.000 description 1
- 102100034872 Kallikrein-4 Human genes 0.000 description 1
- 102100034868 Kallikrein-5 Human genes 0.000 description 1
- 102100034870 Kallikrein-8 Human genes 0.000 description 1
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 108010063045 Lactoferrin Proteins 0.000 description 1
- 102000010445 Lactoferrin Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 108010028275 Leukocyte Elastase Proteins 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- 102100027998 Macrophage metalloelastase Human genes 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100030417 Matrilysin Human genes 0.000 description 1
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 1
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 1
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 1
- 102100030216 Matrix metalloproteinase-14 Human genes 0.000 description 1
- 102100030201 Matrix metalloproteinase-15 Human genes 0.000 description 1
- 102100030200 Matrix metalloproteinase-16 Human genes 0.000 description 1
- 102100030219 Matrix metalloproteinase-17 Human genes 0.000 description 1
- 102100030218 Matrix metalloproteinase-19 Human genes 0.000 description 1
- 102100024129 Matrix metalloproteinase-24 Human genes 0.000 description 1
- 102100024131 Matrix metalloproteinase-25 Human genes 0.000 description 1
- 102100024128 Matrix metalloproteinase-26 Human genes 0.000 description 1
- 102100024132 Matrix metalloproteinase-27 Human genes 0.000 description 1
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- NPPQSCRMBWNHMW-UHFFFAOYSA-N Meprobamate Chemical compound NC(=O)OCC(C)(CCC)COC(N)=O NPPQSCRMBWNHMW-UHFFFAOYSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102000014171 Milk Proteins Human genes 0.000 description 1
- 108010011756 Milk Proteins Proteins 0.000 description 1
- 101150073847 Mmp23 gene Proteins 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 108010085220 Multiprotein Complexes Proteins 0.000 description 1
- 102000007474 Multiprotein Complexes Human genes 0.000 description 1
- 108010083674 Myelin Proteins Proteins 0.000 description 1
- 102000006386 Myelin Proteins Human genes 0.000 description 1
- 108090000973 Myeloblastin Proteins 0.000 description 1
- WTBIAPVQQBCLFP-UHFFFAOYSA-N N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O Chemical compound N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O WTBIAPVQQBCLFP-UHFFFAOYSA-N 0.000 description 1
- 108091008043 NK cell inhibitory receptors Proteins 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 102100030411 Neutrophil collagenase Human genes 0.000 description 1
- 102100033174 Neutrophil elastase Human genes 0.000 description 1
- 101710144111 Non-structural protein 3 Proteins 0.000 description 1
- KRWMERLEINMZFT-UHFFFAOYSA-N O6-benzylguanine Chemical class C=12NC=NC2=NC(N)=NC=1OCC1=CC=CC=C1 KRWMERLEINMZFT-UHFFFAOYSA-N 0.000 description 1
- MAGWLGAJMLWPLZ-UHFFFAOYSA-N OSW-1 Natural products COc1ccc(cc1)C(=O)OC2C(O)C(O)COC2OC3C(O)COC(OC4CC5C6CC=C7CC(O)CCC7(C)C6CCC5(C)C4(O)OC(C)C(=O)CCC(C)C)C3OC(=O)C MAGWLGAJMLWPLZ-UHFFFAOYSA-N 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 108010040201 Polymyxins Proteins 0.000 description 1
- 241000282405 Pongo abelii Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 229920003110 Primojel Polymers 0.000 description 1
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 102100038946 Proprotein convertase subtilisin/kexin type 6 Human genes 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 102000017975 Protein C Human genes 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 108091034057 RNA (poly(A)) Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 108090000783 Renin Proteins 0.000 description 1
- 102100028255 Renin Human genes 0.000 description 1
- 101000933133 Rhizopus niveus Rhizopuspepsin-1 Proteins 0.000 description 1
- 101000910082 Rhizopus niveus Rhizopuspepsin-2 Proteins 0.000 description 1
- 101000910079 Rhizopus niveus Rhizopuspepsin-3 Proteins 0.000 description 1
- 101000910086 Rhizopus niveus Rhizopuspepsin-4 Proteins 0.000 description 1
- 101000910088 Rhizopus niveus Rhizopuspepsin-5 Proteins 0.000 description 1
- RXGJTYFDKOHJHK-UHFFFAOYSA-N S-deoxo-amaninamide Natural products CCC(C)C1NC(=O)CNC(=O)C2Cc3c(SCC(NC(=O)CNC1=O)C(=O)NC(CC(=O)N)C(=O)N4CC(O)CC4C(=O)NC(C(C)C(O)CO)C(=O)N2)[nH]c5ccccc35 RXGJTYFDKOHJHK-UHFFFAOYSA-N 0.000 description 1
- 101150054830 S100A6 gene Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 1
- 101000898773 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Saccharopepsin Proteins 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 102100040107 Serine protease 27 Human genes 0.000 description 1
- 101710197422 Serine protease 27 Proteins 0.000 description 1
- 101710197596 Serine protease 57 Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- JOEPUFOWFXWEDN-UHFFFAOYSA-N Spongistatin 5 Natural products C1C(=O)C(C)C(C2C)OCC2=CC(O2)CC(C)(O)CC2(O2)CC(O)CC2CC(=O)OC(C(C(CC(=C)CC(O)C=CC(Cl)=C)O2)O)C(C)C2C(O)C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC22CC(OC)CC1O2 JOEPUFOWFXWEDN-UHFFFAOYSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 102100030416 Stromelysin-1 Human genes 0.000 description 1
- 102100028848 Stromelysin-2 Human genes 0.000 description 1
- 102100028847 Stromelysin-3 Human genes 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 102100037022 Transmembrane protease serine 11A Human genes 0.000 description 1
- 102100037023 Transmembrane protease serine 11B Human genes 0.000 description 1
- 102100032006 Transmembrane protease serine 11F Human genes 0.000 description 1
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 description 1
- 102100032472 Transmembrane protease serine 5 Human genes 0.000 description 1
- 102100032453 Transmembrane protease serine 7 Human genes 0.000 description 1
- 102100032468 Transmembrane protease serine 9 Human genes 0.000 description 1
- 102000001400 Tryptase Human genes 0.000 description 1
- 108060005989 Tryptase Proteins 0.000 description 1
- 102100025914 Ubiquitin thioesterase OTUB2 Human genes 0.000 description 1
- 108050001615 Ubiquitin thioesterase OTUB2 Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- HSRXSKHRSXRCFC-WDSKDSINSA-N Val-Ala Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(O)=O HSRXSKHRSXRCFC-WDSKDSINSA-N 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- 241000863480 Vinca Species 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- MPXTYZZFIJTPPA-JOQRFCRPSA-N [(2s,3r,4s,5r)-2-[(2s,3r,4s,5s)-3-acetyloxy-2-[[(3r,8s,9r,10r,13s,14r,16r,17s)-3,17-dihydroxy-10,13-dimethyl-17-[(2s)-6-methyl-3-oxoheptan-2-yl]-1,2,3,4,7,8,9,11,12,14,15,16-dodecahydrocyclopenta[a]phenanthren-16-yl]oxy]-5-hydroxyoxan-4-yl]oxy-4,5-dihydro Chemical compound C1=CC(OC)=CC=C1C(=O)O[C@H]1[C@H](O[C@@H]2[C@H]([C@H](O[C@H]3[C@]([C@@]4(C)CC[C@H]5[C@@]6(C)CC[C@@H](O)CC6=CC[C@@H]5[C@H]4C3)(O)[C@H](C)C(=O)CCC(C)C)OC[C@@H]2O)OC(C)=O)OC[C@@H](O)[C@@H]1O MPXTYZZFIJTPPA-JOQRFCRPSA-N 0.000 description 1
- 206010000269 abscess Diseases 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- OFLXLNCGODUUOT-UHFFFAOYSA-N acetohydrazide Chemical class C\C(O)=N\N OFLXLNCGODUUOT-UHFFFAOYSA-N 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 229960004308 acetylcysteine Drugs 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 238000007259 addition reaction Methods 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000003172 aldehyde group Chemical group 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229940098174 alkeran Drugs 0.000 description 1
- 125000005599 alkyl carboxylate group Chemical group 0.000 description 1
- 239000004007 alpha amanitin Substances 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- CIORWBWIBBPXCG-SXZCQOKQSA-N alpha-amanitin Chemical compound O=C1N[C@@H](CC(N)=O)C(=O)N2C[C@H](O)C[C@H]2C(=O)N[C@@H]([C@@H](C)[C@@H](O)CO)C(=O)N[C@@H](C2)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@H]1C[S@@](=O)C1=C2C2=CC=C(O)C=C2N1 CIORWBWIBBPXCG-SXZCQOKQSA-N 0.000 description 1
- CIORWBWIBBPXCG-UHFFFAOYSA-N alpha-amanitin Natural products O=C1NC(CC(N)=O)C(=O)N2CC(O)CC2C(=O)NC(C(C)C(O)CO)C(=O)NC(C2)C(=O)NCC(=O)NC(C(C)CC)C(=O)NCC(=O)NC1CS(=O)C1=C2C2=CC=C(O)C=C2N1 CIORWBWIBBPXCG-UHFFFAOYSA-N 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- WOLHOYHSEKDWQH-UHFFFAOYSA-N amantadine hydrochloride Chemical compound [Cl-].C1C(C2)CC3CC2CC1([NH3+])C3 WOLHOYHSEKDWQH-UHFFFAOYSA-N 0.000 description 1
- 229960004821 amikacin Drugs 0.000 description 1
- LKCWBDHBTVXHDL-RMDFUYIESA-N amikacin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O LKCWBDHBTVXHDL-RMDFUYIESA-N 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000012491 analyte Substances 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000002725 anti-mycoplasma Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 239000012131 assay buffer Substances 0.000 description 1
- 230000006470 autoimmune attack Effects 0.000 description 1
- 208000037979 autoimmune inflammatory disease Diseases 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 238000012575 bio-layer interferometry Methods 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 125000004057 biotinyl group Chemical group [H]N1C(=O)N([H])[C@]2([H])[C@@]([H])(SC([H])([H])[C@]12[H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C(*)=O 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 239000002981 blocking agent Substances 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 150000003857 carboxamides Chemical class 0.000 description 1
- 150000007942 carboxylates Chemical group 0.000 description 1
- 238000012754 cardiac puncture Methods 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 229920006317 cationic polymer Polymers 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- YMNCVRSYJBNGLD-KURKYZTESA-N cephalotaxine Chemical compound C([C@@]12C=C([C@H]([C@H]2C2=C3)O)OC)CCN1CCC2=CC1=C3OCO1 YMNCVRSYJBNGLD-KURKYZTESA-N 0.000 description 1
- DSRNKUZOWRFQFO-UHFFFAOYSA-N cephalotaxine Natural products COC1=CC23CCCN2CCc4cc5OCOc5cc4C3=C1O DSRNKUZOWRFQFO-UHFFFAOYSA-N 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000005081 chemiluminescent agent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 150000004814 combretastatins Chemical class 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 229940031670 conjugate vaccine Drugs 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 108090000711 cruzipain Proteins 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- REAZZDPREXHWNV-HJUJCDCNSA-N debromoaplysiatoxin Chemical compound C1([C@H](CC[C@H](C)[C@@H]2[C@H]([C@@H]3C[C@@]4(O[C@@](O)(CC(=O)O[C@H](CC(=O)O3)[C@@H](C)O)[C@H](C)CC4(C)C)O2)C)OC)=CC=CC(O)=C1 REAZZDPREXHWNV-HJUJCDCNSA-N 0.000 description 1
- REAZZDPREXHWNV-UHFFFAOYSA-N debromoaplysiatoxin Natural products O1C2(OC(O)(CC(=O)OC(CC(=O)O3)C(C)O)C(C)CC2(C)C)CC3C(C)C1C(C)CCC(OC)C1=CC=CC(O)=C1 REAZZDPREXHWNV-UHFFFAOYSA-N 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 238000000375 direct analysis in real time Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000012063 dual-affinity re-targeting Methods 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-M fusidate Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C([O-])=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-M 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 229940075613 gadolinium oxide Drugs 0.000 description 1
- 229910001938 gadolinium oxide Inorganic materials 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 108700026078 glutathione trisulfide Proteins 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 108010022683 guanidinobenzoate esterase Proteins 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- ULZJMXRIKBUHTO-UHFFFAOYSA-N halistatin 2 Natural products O1C2C(C)CC3(OC4CC5OC(CC5OC4C(C)C3)C(O)CO)OC2CC1(OC1CC2OC3CC4C(=C)C(C)CC(O4)CCC4C(=C)CC(O4)CC4)CC1OC2C(C)C3OC(=O)CC(O1)CCC2C1C(O1)C3OC5CC14OC5C3(O)O2 ULZJMXRIKBUHTO-UHFFFAOYSA-N 0.000 description 1
- 125000005179 haloacetyl group Chemical group 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 201000003911 head and neck carcinoma Diseases 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 1
- 108010057806 hemiasterlin Proteins 0.000 description 1
- 229930187626 hemiasterlin Natural products 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229940042795 hydrazides for tuberculosis treatment Drugs 0.000 description 1
- 150000002429 hydrazines Chemical class 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 150000002443 hydroxylamines Chemical class 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 230000002687 intercalation Effects 0.000 description 1
- 238000009830 intercalation Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 108010024383 kallikrein 4 Proteins 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 description 1
- 229940078795 lactoferrin Drugs 0.000 description 1
- 235000021242 lactoferrin Nutrition 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 241001515942 marmosets Species 0.000 description 1
- 108010047374 matriptase 2 Proteins 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 108091007169 meprins Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 235000021239 milk protein Nutrition 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 210000005012 myelin Anatomy 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002159 nanocrystal Substances 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006218 nasal suppository Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229960000988 nystatin Drugs 0.000 description 1
- VQOXZBDYSJBXMA-NQTDYLQESA-N nystatin A1 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/CC/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 VQOXZBDYSJBXMA-NQTDYLQESA-N 0.000 description 1
- 230000000771 oncological effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- FVFZSVRSDNUCGG-UHFFFAOYSA-M p-mercuribenzoate Chemical group [O-]C(=O)C1=CC=C([Hg])C=C1 FVFZSVRSDNUCGG-UHFFFAOYSA-M 0.000 description 1
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 1
- 239000005022 packaging material Substances 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 125000000538 pentafluorophenyl group Chemical group FC1=C(F)C(F)=C(*)C(F)=C1F 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 235000021118 plant-derived protein Nutrition 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000008389 polyethoxylated castor oil Substances 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- BKOVMXWXILSWCU-UHFFFAOYSA-N pyrrolo[3,2-e]benzimidazole Chemical class C1=CC2=NC=CC2=C2N=CN=C21 BKOVMXWXILSWCU-UHFFFAOYSA-N 0.000 description 1
- 239000002096 quantum dot Substances 0.000 description 1
- LISFMEBWQUVKPJ-UHFFFAOYSA-N quinolin-2-ol Chemical compound C1=CC=C2NC(=O)C=CC2=C1 LISFMEBWQUVKPJ-UHFFFAOYSA-N 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000003653 radioligand binding assay Methods 0.000 description 1
- 239000012217 radiopharmaceutical Substances 0.000 description 1
- 229940121896 radiopharmaceutical Drugs 0.000 description 1
- 230000002799 radiopharmaceutical effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 230000011514 reflex Effects 0.000 description 1
- 230000013878 renal filtration Effects 0.000 description 1
- 231100000205 reproductive and developmental toxicity Toxicity 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- QSHGUCSTWRSQAF-FJSLEGQWSA-N s-peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC(OS(O)(=O)=O)=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O)NC(=O)[C@@H](NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C1=CC=C(OS(O)(=O)=O)C=C1 QSHGUCSTWRSQAF-FJSLEGQWSA-N 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 229960000268 spectinomycin Drugs 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical class O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- FDDDEECHVMSUSB-UHFFFAOYSA-N sulfanilamide Chemical compound NC1=CC=C(S(N)(=O)=O)C=C1 FDDDEECHVMSUSB-UHFFFAOYSA-N 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- JGVWCANSWKRBCS-UHFFFAOYSA-N tetramethylrhodamine thiocyanate Chemical compound [Cl-].C=12C=CC(N(C)C)=CC2=[O+]C2=CC(N(C)C)=CC=C2C=1C1=CC=C(SC#N)C=C1C(O)=O JGVWCANSWKRBCS-UHFFFAOYSA-N 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 238000006177 thiolation reaction Methods 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 229960000707 tobramycin Drugs 0.000 description 1
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 description 1
- YXFVVABEGXRONW-UHFFFAOYSA-N toluene Substances CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 229940126836 transmembrane protease serine 6 synthesis reducer Drugs 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- WBPYTXDJUQJLPQ-VMXQISHHSA-N tylosin Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@@H]([C@H]1N(C)C)O)O[C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H](/C=C(\C)/C=C/C(=O)[C@H](C)C[C@@H]1CC=O)CO[C@H]1[C@@H]([C@H](OC)[C@H](O)[C@@H](C)O1)OC)CC)[C@H]1C[C@@](C)(O)[C@@H](O)[C@H](C)O1 WBPYTXDJUQJLPQ-VMXQISHHSA-N 0.000 description 1
- 229960003732 tyramine Drugs 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 208000023747 urothelial carcinoma Diseases 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 1
- 229960005502 α-amanitin Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21109—Matriptase (3.4.21.109)
Definitions
- the present disclosure generally relates to polypeptides that include a cleavable moiety that is a substrate for at least one protease (e.g., MT-SP1), and to methods of making and using the polypeptides and activatable molecules in a variety of therapeutic, diagnostic, and prophylactic applications.
- protease e.g., MT-SP1
- BACKGROUND Proteases are enzymes that catalyze the hydrolysis of peptide bonds between amino acid residues. Some proteases are known to break specific peptide bonds based on the presence of a particular amino acid sequence within a protein. Proteases occur naturally in all organisms and are involved in a variety of physiological reactions from simple degradation to highly regulated pathways.
- the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of HQSRS (SEQ ID NO: 2), wherein the cleavable moiety is a substrate for a protease.
- CM cleavable moiety
- the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that CYTX-083 comprises the amino acid sequence of HQSR (SEQ ID NO: 1), wherein the cleavable moiety is a substrate for a protease.
- CM cleavable moiety
- HQSR SEQ ID NO: 1
- the histidine residue of SEQ ID NO: 2 may be substituted with an alanine residue.
- the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of AQSRS (SEQ ID NO: 160), wherein the cleavable moiety is a substrate for a protease.
- the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of HQSKS (SEQ ID NO: 66), wherein the cleavable moiety is a substrate for a protease.
- CM comprises the amino acid sequence of SEQ ID NOs: 1-74 and 160.
- the CM comprises the amino acid sequence of HQSRSG (SEQ ID NO: 3).
- the CM comprises the amino acid sequence of SHQSRS (SEQ ID NO: 4).
- the CM comprises the amino acid sequence of HQSRSA (SEQ ID NO: 5).
- the CM comprises the amino acid sequence of DHQSRS (SEQ ID NO: 6). In some embodiments, the CM comprises the amino acid sequence of SDHQSRS (SEQ ID NO: 7). In some embodiments, the CM comprises the amino acid sequence of AQSRS (SEQ ID NO: 160).
- the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule. In some aspects of the present disclosure, cleavage of the CM by a protease activates the molecule.
- the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM.
- the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
- the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than CYTX-083 25% in vivo activation following 7 days of administration in vivo.
- the isolated polypeptide is a molecule comprising a CM that has a k cat /K M (M -1 s -1 ) of greater than 2.5 x 10 4 M -1 s -1 .
- the isolated polypeptide is a molecule comprising a CM that has a k cat /K M (M -1 s- 1 ) of greater than 1 x 10 4 M -1 s -1 .
- the isolated polypeptide is an activatable molecule and further comprises an “active moiety” (AM) that specifically binds a target.
- the AM is a therapeutic macromolecule.
- the AM is an antibody or antigen-binding fragment thereof.
- the antibody is a full- length antibody.
- the antigen-binding fragment is a monoclonal antibody, single chain antibody, Fab fragment, F(ab') 2 fragment, single-chain variable fragment (scFv), diabody (a noncovalent dimer of scFv), single chain antibody (scab), a VHH, a domain antibody (dAb) or single domain antibody (nanobody, e.g., single domain heavy chain antibody, single domain light chain antibody).
- the antibody is a monoclonal antibody, single chain antibody, Fab fragment, F(ab') 2 fragment, single-chain variable fragment (scFv), diabody (a noncovalent dimer of scFv), single chain antibody (scab), a VHH, a domain antibody (dAb) or single domain antibody (nanobody, e.g., single domain heavy chain antibody, single domain light chain antibody).
- the isolated polypeptide is an activatable molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo (e.g., as exemplified in Example 3).
- the isolated polypeptide is an activatable molecule that has masking efficiency of 25x, 40x, 41x, 50x, 75x, 100x, 150x, 200x, or higher (e.g., as exemplified in Example 4).
- the activatable molecule is activated by one, two, or all of TMPRSS11, MT-SP1, and plasmin.
- the activatable molecule is activated to an extent of having a cleavability percentage of at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT- SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
- the AM is a cytokine.
- the AM is a chimeric antigen receptor. In some aspects, the AM is a drug or agent, e.g., a therapeutic, imaging, or diagnostic agent. [0011] In some embodiments, the AM is coupled to the CM. In some embodiments, the AM is directly coupled to the CM. In some embodiments, the AM is indirectly coupled to the CM via a linking peptide. In some embodiments, the AM is indirectly coupled to the CM via one or more components of the activatable protein. [0012] In some embodiments, the isolated polypeptide further comprises a masking moiety (MM). In some embodiments, the MM has a dissociation constant for binding to the AM that is greater than a dissociation constant of the AM for binding to the target.
- MM masking moiety
- the MM does not interfere or compete with the AM for binding to the target in in the activated molecule (i.e., following cleavage of the CM by a protease).
- the MM is 2 to 40 amino acids in length.
- the MM does not bind the AM, but still interferes with AM’s binding to its binding partner through non- specific interactions.
- the MM is a steric mask.
- the MM is a protein.
- the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM-CM-MM.
- the MM is coupled directly to the CM. [0013] In some embodiments, the MM is coupled indirectly to the CM via a linking peptide.
- the isolated polypeptide comprises a linking peptide (LP) and wherein the isolated polypeptide has a structural arrangement from N-terminus to C-terminus as follows: MM-LP-CM-AM or MM-CM-LP-AM.
- the isolated polypeptide comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the isolated polypeptide has a structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM-LP2-AM or AM-LP2-CM-LP1-MM.
- the LP1 and LP2 are not identical to each other. In some embodiments, the LP1 and LP2 are identical to each other. In some embodiments, each of LP1 and LP2 is a peptide of 1 to 20 amino acids in length. [0014] In general, in each embodiment herein, unless otherwise stated, a polypeptide may comprise one or more optional linkers between each of the elements listed, and such linkers CYTX-083 may be 1 to 30, 6 to 29, 7 to 28, 8 to 27, 9 to 26, 10 to 25, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or 27 amino acids in length.
- the CM is a substrate for a serine protease.
- the k cat /K M of the CM by MT-SP1 cleavage is at least 1 ⁇ 10 2 M -1 s -1 .
- the k cat /K M of the CM by MT-SP1 cleavage is at least 1 ⁇ 10 3 M -1 s -1 .
- the k cat /K M of the CM by MT-SP1 cleavage is at least 1 ⁇ 10 4 M -1 s -1 .
- the serine protease is TMPRSS11.
- the k cat /K M of the CM by TMPRSS11 cleavage is at least 1 x 10 3 M -1 s -1 . In some embodiments, the kcat/KM of the CM by TMPRSS11cleavage is at least 1 x 10 4 M -1 s -1 .
- the CM is resistant to cleavage in situ in human bone marrow tissue, e.g., bone marrow aspirate.
- the CM is resistant to cleavage in vivo in human bone marrow tissue, e.g., bone marrow aspirate.
- the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with one-amino acid or two-amino acid mutation(s) of any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease.
- the mutations may include substitution between any one of lysine, arginine, and histidine residues.
- the present disclosure may include substitution of any arginine in the disclosed sequences with a lysine.
- the present disclosure also includes substitution of any arginine in the disclosed sequences with an amino acid that is not lysine.
- the mutations may include substitution between any one of alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan residues.
- the mutations may include substitution between any one of glycine, asparagine, glutamine, cysteine, serine, threonine, and tyrosine residues.
- the mutations may include substitution between any one of arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine residues.
- the mutations may include substitution between any one of alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine residues.
- the mutations may include substitution between any one of serine and threonine residues.
- the mutations may include substitution between any one of asparagine and glutamine residues.
- the mutations may include substitution between any one of alanine, valine, leucine and isoleucine residues.
- the mutations may include substitution between any one of phenylalanine, tryptophan, and tyrosine residues.
- the present disclosure provides a polypeptide complex comprising one or more of the isolated polypeptides comprising the CMs disclosed herein.
- the complex comprises one or more of the isolated polypeptides of the present disclosure bound to a second isolated polypeptide, e.g., via protein-protein affinity interactions, hydrophobic interactions, disulfide linkage(s), cross-link(s), covalent bond(s), chemical linkage(s), or any other type of binding between two polypeptides.
- the present disclosure provides a conjugated polypeptide comprising the isolated polypeptide herein conjugated to an agent.
- the agent is conjugated to the AM via a conjugating linker.
- the conjugating linker is cleavable. In some embodiments, the conjugating linker is non-cleavable. In some embodiments, the conjugating linker comprises an amino acid sequence selected from SEQ ID NOs: 1-74 and 160.
- the agent is a toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof.
- the present disclosure provides a composition comprising the isolated polypeptide, the polypeptide complex, or the conjugated polypeptide herein, and a carrier.
- the carrier is a pharmaceutically acceptable carrier.
- the composition comprises an additional agent.
- the additional agent is a therapeutic, imaging, or diagnostic agent.
- the polypeptide may comprise, e.g., one or more optional linkers between each of the elements listed.
- a linker is a peptide having a length of 5 to 30, 6 to 29, 7 to 28, 8 to 27, 9 to 26, 10 to 25, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 amino acids.
- one or more linkers may optionally be present between the elements.
- this disclosure also contemplates and includes activatable proteins in which any one or more of the disclosed elements optionally directly abut each other such that there are no linkers or other amino acid sequences between the elements.
- the present disclosure provides an isolated nucleic acid molecule encoding the isolated polypeptide herein. CYTX-083 [0025]
- the present disclosure provides a vector comprising the isolated nucleic acid molecule herein.
- the present disclosure provides a cell comprising the isolated nucleic acid molecule or the vector herein.
- the present disclosure provides a method of manufacturing an activatable molecule that contains a cleavable moiety (CM), the method comprising expressing and recovering a polypeptide comprising the isolated polypeptide herein.
- the present disclosure provides a method of treating, alleviating a symptom of, or delaying the progression of a disease or disorder in a subject, comprising administering a therapeutically effective amount of the isolated polypeptide, the polypeptide complex, the conjugated polypeptide, or the composition herein to the subject.
- the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder.
- the present disclosure provides a method of detecting or diagnosing a disease or health condition in a subject, comprising: contacting the isolated polypeptide, the polypeptide complex, the conjugated polypeptide, or the composition herein with a sample from the subject; and measuring a level of cleavage of the isolated polypeptide, thereby detecting or diagnosing the disease or health condition in the subject.
- the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder.
- FIG. 1 is a graph showing the in vitro masking efficiency of an exemplary anti- EGFR activatable antibody of the present disclosure. These exemplary results show that the substrate affected the masking efficiency of the prodomain of the activatable antibody.
- FIG. 2A shows the effects of exemplary activatable antibodies on tumor regression in mice.
- FIG. 2B shows intra-tumoral activation of the activatable antibodies.
- FIG.3 shows in situ stability of exemplary activatable antibodies in human bone marrow aspirates.
- FIGs. 4A-4C show activation of exemplary activatable antibodies in patient- derived tumor samples (Head and Neck A in Fig.4A, Head and Neck B in Fig.4B, and TNBC in Fig.4C).
- Proteases play a critical role in the homeostasis of healthy tissues but are known to be dysregulated within diseases, including cancer and autoimmune disorders (Vasiljeva et al. “The multifaceted roles of tumor-associated proteases and harnessing their activity for prodrug activation,” Biol. Chem. 2019 Apr 22). This dysregulation of protease activity provides new opportunities for the development of protease-activatable therapeutic molecules, which are preferentially activated in the local tissue microenvironment. These therapeutics have demonstrated a greater therapeutic window and safety profile with less on- target toxicities occurring in healthy tissues.
- CM cleavable moieties
- TMPRSS11 transmembrane protease serine 11
- CM cleavable moiety
- the CMs may be a substrate for a second protease such as a TMPRSS11 (e.g., TMPRSS11A, TMPRSS11B, TMPRSS11D, TMPRSS11E, or TMPRSS11F).
- a TMPRSS11 e.g., TMPRSS11A, TMPRSS11B, TMPRSS11D, TMPRSS11E, or TMPRSS11F
- the CMs are substrates for MT-SP1 and a TMPRSS11D.
- the CMs herein are cleaved in a diseased tissue (e.g., tumor tissue) but less in a healthy tissue. These CMs are useful in a variety of therapeutic, diagnostic and prophylactic applications.
- the CM-containing polypeptides are activatable molecules and further comprise an active moiety (AM) that specifically binds a target.
- AM active moiety
- the AM may be a therapeutic protein, a therapeutic agent, an imaging agent, a diagnostic agent, an antibody or antigen-binding fragment, a cytokine, chimeric antigen receptor, or other molecules used in therapeutic and diagnostic applications.
- compositions, kits, nucleic acids, vectors, and recombinant cells as well as related methods, including methods of using and methods of producing any of the CM-containing polypeptides described herein.
- a cell encompasses one or more cells.
- CYTX-083 As used herein, the terms “about” and “approximately,” when used to modify an amount specified in a numeric value or range, indicate that the numeric value as well as reasonable deviations from the value known to the skilled person in the art. For example ⁇ 20%, ⁇ 10%, or ⁇ 5%, are within the intended meaning of the recited value where appropriate. [0042] Concentrations, amounts, and other numerical data may be expressed or presented herein in a range format.
- isolated polynucleotide shall mean a polynucleotide of genomic, cDNA, RNA, mRNA, or synthetic origin or some combination thereof, which by virtue of its origin the “isolated polynucleotide” (1) is not associated with all or a portion of a polynucleotide in which the “isolated polynucleotide” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, and/or (3) does not occur in nature as part of a larger sequence.
- polynucleotides include the nucleic CYTX-083 acid molecules encoding heavy chain immunoglobulin molecules, and nucleic acid molecules encoding light chain immunoglobulin molecules.
- isolated polypeptide refers a polypeptide that is present in a form other than that found in nature.
- An “isolated polypeptide” as used herein may be encoded by cDNA, recombinant RNA, messenger RNA, recombinant DNA, or a polynucleotide of synthetic origin or some combination thereof.
- the “isolated polypeptide” (1) is not in a naturally occurring organism (e.g., is not an endogenous polypeptide of a naturally occurring organism) and (2) is present in a form not found in nature.
- the “isolated polypeptide” is expressed by a cell from a different species.
- the “isolated polypeptide” is a therapeutic protein or a diagnostic protein and not a naturally occurring protein.
- the “isolated polypeptide” is not a plant protein or a protein naturally occurring in bacteria or other natural organisms.
- isolated polypeptide includes and provides support for activatable molecules including activatable macromolecules, activatable polypeptides, activatable antibodies, activatable cytokines, and the like.
- isolated polypeptide includes and provides support for activatable molecules in which cleavage of the CM activates the molecule.
- polypeptide is used herein as a generic term to refer to a native protein, fragments, or analogs of a polypeptide sequence. Hence, proteins, protein fragments, and analogs are species of the polypeptide genus.
- polypeptides in accordance with the disclosure comprise the heavy chain immunoglobulin, and the light chain immunoglobulin molecules, as well as antibody molecules formed by combinations comprising the heavy chain immunoglobulin molecules with light chain immunoglobulin molecules, such as kappa light chain immunoglobulin molecules, and vice versa, as well as fragments and analogs thereof.
- minor variations in the amino acid sequences of polypeptides are contemplated as being encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain at least 75%, in some embodiments, at least 80%, at least 90%, at least 95%, and in some embodiments, at least 99% identity to the amino acid sequence that is not varied.
- conservative amino acid substitutions are contemplated.
- Conservative substitutions include those that take place within a family of amino acids that are related in their side chains.
- Genetically encoded amino acids are CYTX-083 generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine.
- the hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine.
- the hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine.
- families of amino acids include (i) serine and threonine, which are the aliphatic- hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family.
- Suitable amino- and carboxyl- termini of fragments or analogs occur near boundaries of functional domains.
- Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases.
- computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known, e.g., as described in Bowie et al. Science 253:164 (1991).
- Suitable amino acid substitutions include those that: (1) alter susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (5) confer or modify other physicochemical or CYTX-083 functional properties of such analogs.
- Analogs can include various muteins of a sequence other than the naturally-occurring peptide sequence. For example, single or multiple amino acid substitutions (for example, conservative amino acid substitutions) may be made in the naturally- occurring sequence (for example, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts.
- a conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterizes the parent sequence).
- Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et at. Nature 354:105 (1991).
- sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term “sample,” therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph.
- therapeutic macromolecule refers to any protein or nucleic acid that may be administered to a subject and have a therapeutic effect.
- the therapeutic macromolecule may be a therapeutic polynucleotide or therapeutic polypeptide, i.e., a polynucleotide or polynucleotide that may be used in therapy.
- an activatable molecule may comprise MM-CM construct(s), also referred to herein as a prodomain.
- prodomain refers to a polypeptide domain comprising a masking moiety (MM) and a cleavable moiety (CM).
- MM masking moiety
- CM cleavable moiety
- the MM and the CM are separated by a linker, referred to herein as LP1.
- the prodomain comprises a linker (referred to herein as LP2) that links the CM of the prodomain to the active moiety (AM) in an activatable molecule.
- the prodomain comprises a linker between the MM and the CM and a linker between the CM and the AM. In some embodiments, the MM and the CM are not separated by a linker.
- a prodomain comprises one of the following formulas (where the formulas below represent amino acid sequences in either N- to C-terminal direction or C- to N-terminal direction): MM-LP1-CM, MM-CM- LP2, MM-LP1-CM-LP2, or MM-CM.
- each dash CYTX-083 (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linking peptides.
- Proteases are involved in the control of numerous physiological processes, and their dysregulation has been identified in a number of pathologies, such as, for example, oncological, cardiovascular, autoimmune, and neurodegenerative diseases. See, e.g., O. Vasiljeva, et al., “Monitoring protease activity in biological tissues using antibody prodrugs as sensing probes,” Scientific Reports, 10, 5894 (2020); O. Managerer, et al., “Site-specific targeting of antibody activity in vivo mediated by disease-associated proteases,” J. Control Release, 161(3):804-812 (2012); and L.
- the profile of dysregulated protease activity in diseased tissue may differ from one type of disease tissue/disorder to another.
- the present disclosure provides cleavable moieties that exhibit enhanced cleavability to membrane type serine protease 1 (MT-SP1).
- the cleavable moieties are cleaved by a second protease, e.g., a TMPRSS11.
- the cleavable moieties are selectively cleavable by certain proteases (e.g., MT-SP1 and/or TMPRSS11), but have reduced or no cleavability by another protease/s.
- the cleavable moieties may be resistant or substantially resistant to cleavage in bone marrow tissue, e.g., bone marrow aspirate.
- resistance of cleavable moieties to protease cleavage in healthy tissue may reduce systemic toxicities by limiting binding of the activatable molecule to targets that also may be present in healthy tissues.
- CM cleavable moiety
- a CM is a polypeptide that comprises a substrate for a sequence-specific protease.
- the present disclosure provides polypeptides and polypeptide complexes comprising a CM and an active moiety.
- the CM comprises the amino acid sequence of SEQ ID NO: 1.
- the CM comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 3. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 4. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 5. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 6. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 7. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 9. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 10.
- the CM comprises the amino acid sequence of SEQ ID NO: 11. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 13. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 15. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 16. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 17. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 18. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 19.
- the CM comprises the amino acid sequence of SEQ ID NO: 20. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 21. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 22. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 23. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 24. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 25. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 26. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 27. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 28.
- the CM comprises the amino acid sequence of SEQ ID NO: 29. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 30. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 31. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 32. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 33. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 34. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 35. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 36.
- the CM comprises the amino acid sequence of SEQ ID NO: 37. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 38. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 39. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 40. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 41. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 42. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 43. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 44. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 45.
- the CM comprises the amino acid sequence of SEQ ID NO: 46. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 47. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 48. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 49. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 50. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 51. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 52. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 53. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 54.
- the CM comprises the amino acid sequence of SEQ ID NO: 55. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 56. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 57. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 58. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 59. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 60. In some CYTX-083 embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 61. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 62.
- the CM comprises the amino acid sequence of SEQ ID NO: 63. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 64. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 65. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 66. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 67. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 68. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 69. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 70.
- the CM comprises the amino acid sequence of SEQ ID NO: 71. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 73. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 74. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 160. [0059] In some embodiments, the CM comprises a combination, a C-terminal truncation variant, a C-terminal extension variant, an N-terminal truncation variant, or an N-terminal extension variant of the amino acid sequences of any one of SEQ ID NOs: 1-74 and 160.
- Truncation variants of the aforementioned amino acid sequences that are suitable for use in a CM may be any that retain the recognition site for the corresponding protease. These include C-terminal and/or N-terminal truncation variants comprising at least 1, 2, 3, 4, 5, or more contiguous amino acids of the above-described amino acid sequences that retain a recognition site for a protease. In certain embodiments, the truncation variant comprises a C-terminal deletion and/or an N-terminal deletion of one amino acid residue from an amino acid sequence selected from the group consisting of SEQ ID NOs: 2-64.
- the truncation variant comprises a C-terminal deletion and/or an N-terminal deletion of one amino acid residue from an amino acid sequence selected from the group consisting of SEQ ID Nos: 66-74.
- Extension variants of the aforementioned amino acid sequences that are suitable for use in a CM may be any that have one or more (e.g., 1, 2, 3, 4, 5 or more) additional amino acids and retain the recognition site for the corresponding protease.
- the additional amino acids are coupled to the C-terminus of the aforementioned amino acid sequences.
- the additional amino acids are coupled to the N-terminus of CYTX-083 the aforementioned amino acid sequences.
- the extension variants may comprise additional amino acids coupled to both the C-terminus and the N-terminus of the aforementioned amino acid sequences.
- the C-terminus or N-terminus extension variants can have a C-terminal glycine or an N-terminal serine amino acid.
- the CM comprises one, two, three, four, five, six or more amino acids in addition to the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM comprises one, two, three, four, five, six or more additional amino acids at the N-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM comprises one, two, three, four, five, six or more additional amino acids at the C-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. In some examples, the CM comprises one, two, three, four, five, six or more additional amino acids at the N-terminus, and one, two, three, four, five, six or more additional amino acids at the C-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. [0061] In some embodiments, the CM comprises a sequence with mutation(s) of one or more amino acid of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM comprises a sequence with one-amino acid, two-amino acid, three-amino acid, four-amino acid, or five-amino acid mutation(s) of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-74 and 160 and having one conservative substitution.
- the CM consists of the amino acid sequence of SEQ ID NO: 1.
- the CM consists of the amino acid sequence of SEQ ID NO: 2.
- the CM consists of the amino acid sequence of SEQ ID NO: 3.
- the CM consists of the amino acid sequence of SEQ ID NO: 4. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 5. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 6. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 7. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 8. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 9. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 10. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 11.
- the CM consists of the amino acid sequence of SEQ ID NO: 12. In some CYTX-083 embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 13. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 14. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 15. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 16. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 17. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 18. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 19.
- the CM consists of the amino acid sequence of SEQ ID NO: 20. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 21. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 22. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 23. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 24. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 25. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 26. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 27.
- the CM consists of the amino acid sequence of SEQ ID NO: 28. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 29. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 30. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 31. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 32. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 33. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 34. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 35.
- the CM consists of the amino acid sequence of SEQ ID NO: 36. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 37. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 38. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 39. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 40. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 41. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 42. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 43.
- the CM consists of the amino acid sequence of SEQ ID NO: 44. In some CYTX-083 embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 45. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 46. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 47. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 48. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 49. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 50. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 51.
- the CM consists of the amino acid sequence of SEQ ID NO: 52. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 53. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 54. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 55. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 56. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 57. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 58. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 59.
- the CM consists of the amino acid sequence of SEQ ID NO: 60. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 61. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 62. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 63. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 64. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 65. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 66. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 67.
- the CM consists of the amino acid sequence of SEQ ID NO: 68. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 69. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 70. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 71. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 72. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 73. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 74. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 160.
- the CM consists of a sequence with mutation(s) of one or more amino acid of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM consists of a sequence with one-amino acid, two-amino acid, three-amino acid, four-amino acid, or five-amino acid mutation(s) of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM comprises a total of 3 amino acids to 25 amino acids.
- the CM may comprise a total of 3 to 25, 3 to 20, 3 to 15, 3 to 10, 3 to 5, 5 to 25, 5 to 20, 5 to 15, 5 to 10, 10 to 25, 10 to 20, 10 to 15, 15 to 25, 15 to 20, or 20 to 25 amino acids.
- the CM consists of a total of 3 amino acids to 25 amino acids.
- the CM may consist of a total of 3 to 25, 3 to 20, 3 to 15, 3 to 10, 3 to 5, 5 to 25, 5 to 20, 5 to 15, 5 to 10, 10 to 25, 10 to 20, 10 to 15, 15 to 25, 15 to 20, or 20 to 25 amino acids.
- the CM may be specifically cleaved by a protease (e.g., by MT-SP1) at a desired rate.
- the rate may be measured as substrate cleavage kinetics (k cat /K M ) as disclosed in WO2016118629, which is incorporated by reference in its entirety.
- k cat is the turnover number and describes how many substrate molecules are transformed into products per unit time by a protease.
- the K M value describes the affinity of the substrate to the active site of the protease.
- the k cat /K M ratio provides a measurement of cleavability of the substrate by the protease. In general, the greater the ratio, the higher the rate of cleavability is; conversely, the lower the ratio, the slower the rate of cleavability is.
- the CM is cleaved by MT-SP1 at a rate that has a kcat/KM value from 1 ⁇ 10 to 1 ⁇ 10 6 M -1 s -1 , e.g., from 1 ⁇ 10 to 5 ⁇ 10, from 5 ⁇ 10 to 1 ⁇ 10 2 , from 1 ⁇ 10 2 to 5 ⁇ 10 2 , from 5 ⁇ 10 2 to 1 ⁇ 10 3 , from 1 ⁇ 10 3 to 5 ⁇ 10 3 , from 5 ⁇ 10 3 to 1 ⁇ 10 4 , from 1 ⁇ 10 4 to 5 ⁇ 10 4 , from 5 ⁇ 10 4 to 1 ⁇ 10 5 , from 1 ⁇ 10 5 to 5 ⁇ 10 5 , or from 5 ⁇ 10 5 to 1 ⁇ 10 6 M -1 s -1 .
- the CM is cleaved by MT-SP1 at a rate that has a k cat /K M value of at least 1 ⁇ 10, CYTX-083 at least 5 ⁇ 10, at least 1 ⁇ 10 2 , at least 5 ⁇ 10 2 , at least 1 ⁇ 10 3 , 5 ⁇ 10 3 , at least 1 ⁇ 10 4 , at least 5 ⁇ 10 4 , at least 1 ⁇ 10 5 , at least 5 ⁇ 10 5 , or at least 1 ⁇ 10 6 .
- the CM is cleaved by TMPRSS11 at a rate that has a k cat /K M value from 1 ⁇ 10 to 1 ⁇ 10 6 M -1 s -1 , e.g., from 1 ⁇ 10 to 5 ⁇ 10, from 5 ⁇ 10 to 1 ⁇ 10 2 , from 1 ⁇ 10 2 to 5 ⁇ 10 2 , from 5 ⁇ 10 2 to 1 ⁇ 10 3 , from 1 ⁇ 10 3 to 5 ⁇ 10 3 , from 5 ⁇ 10 3 to 1 ⁇ 10 4 , from 1 ⁇ 10 4 to 5 ⁇ 10 4 , from 5 ⁇ 10 4 to 1 ⁇ 10 5 , from 1 ⁇ 10 5 to 5 ⁇ 10 5 , or from 5 ⁇ 10 5 to 1 ⁇ 10 6 M -1 s -1 .
- a k cat /K M value from 1 ⁇ 10 to 1 ⁇ 10 6 M -1 s -1 , e.g., from 1 ⁇ 10 to 5 ⁇ 10, from 5 ⁇ 10 to 1 ⁇ 10 2 , from 1 ⁇ 10 2 to 5 ⁇ 10 2 , from 5 ⁇ 10 2 to 1
- the CM is cleaved by TMPRSS11 at a rate that has a kcat/KM value of at least 1 ⁇ 10, at least 5 ⁇ 10, at least 1 ⁇ 10 2 , at least 5 ⁇ 10 2 , at least 1 ⁇ 10 3 , 5 ⁇ 10 3 , at least 1 ⁇ 10 4 , at least 5 ⁇ 10 4 , at least 1 ⁇ 10 5 , at least 5 ⁇ 10 5 , or at least 1 ⁇ 10 6 .
- the cleavability of the CMs are presented as the percentage of the fraction of cleaved CMs (or polypeptides comprising the CMs), e.g., as determined in a capillary electrophoresis assay described Example 2.
- the cleavability of the CM by a protease is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%. In some examples, the cleavability of the CM by MT-SP1 is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% when 500nM activatable antibody c225 containing a prodomain with the CM being tested was incubated with 10 nM of MT-SP1 for 1.5 hours or 4 hours at 37oC.
- the cleavability of the CM by TMPRSS11 is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% when 500nM activatable antibody c225 containing a prodomain with the CM being tested was incubated with 10 nM of TMPRSS11 for 4 hours at 37oC.
- contact between the enzyme and CM is made.
- a CM-containing polypeptide e.g., activatable molecule comprising an AM coupled to a MM and a CM
- the CM can be cleaved.
- CM according to the present disclosure and a reference polypeptide can be cleaved by the same protease, but the CM according to the present disclosure has reduced cleavage or resistance to cleavage (e.g., by a different protease or proteases) in certain tissues in situ compared to a reference polypeptide.
- a CM according to the present disclosure and a reference polypeptide can be cleaved by MT- SP1, but the CM according to the present disclosure has reduced cleavage or resistance to CYTX-083 cleavage (e.g., by a different protease(s) than MT-SP1) in the bone marrow in situ compared to a reference polypeptide.
- the cleavage (e.g., by a different protease than MT- SP1) in the bone marrow in situ of the CM may be less than 99%, less than 95%, less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% compared to the cleavage of the reference polypeptide.
- such proteases different than an MT-SP1 may be other proteases in the bone marrow or other normal tissues, as well as other proteases involved in inflammation and wound healing.
- the cleavage (e.g., by a different protease than MT-SP1) in the bone marrow in situ may be measured by increased activity of an activatable molecule comprising the CM or the reference polypeptide in the bone marrow, e.g., the method described in Example 6.
- a CM that is resistant to cleavage by a protease, or a sample or tissue comprising a protease refers to (i) a CM in which no peptide bond is hydrolyzed by the protease, or no peptide bond is hydrolyzed when incubated in the sample or tissue comprising the protease or (ii) a CM in which a reduced level of peptide bond is hydrolyzed by the protease, or reduced level of peptide bond is hydrolyzed when incubated in the sample or tissue comprising the protease, compared to a reference CM.
- the CM is cleavable by more than one proteases.
- the CM may be cleaved by one or more type II transmembrane serine proteases (e.g., MT-SP1 and/or TMPRSS11) and by a second or multiple additional proteases.
- additional protease could be any one or more of the following proteases: a disintegrin and metalloprotease (ADAM), an ADAM-like, or a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS, such as, for example, ADAM8, ADAM9, ADAM10, ADAM12, ADAM15, ADAM17/TACE, ADAMDEC1, ADAMTS1, ADAMTS4, ADAMTS5); an aspartate protease (such as, for example, BACE, Renin, and the like); an aspartic cathepsin (such as, for example, Cathepsin D, Cathepsin E, and the like); a caspase (such as, for example, Ca
- the polypeptide or polypeptide complex comprising a CM is an activatable molecule.
- the activatable molecule may comprise an active moiety (AM) that specifically binds a target.
- the AM may be coupled to the CM.
- the activatable molecule comprises a masking moiety (MM) coupled with the AM via the CM.
- the coupling of two components in a polypeptide or polypeptide complex may be direct or indirect.
- the amino acid residue at the C-terminus of a component forms a peptide bond with the amino acid residue at the N-terminus of the other component.
- the two components are coupled indirectly, there is a stretch of amino acids between the two components.
- the two components of a polypeptide may be indirectly coupled via one or more other components in the polypeptide, i.e., the one or more other components are between the two coupled components.
- the one or more other components may be a linker, AM(s), CM(s), MM(s), or any combination thereof.
- CYTX-083 the term “activatable molecule” refers to a molecule that comprises at least one set of MM, CM, and AM and which exhibits attenuated binding to a target as compared to the binding of a counterpart “activated” molecule comprising the same AM to the same target.
- activated molecule and “cleaved activatable molecule,” are used interchangeably herein to refer to the AM-containing cleavage product that is generated after exposure of the activatable molecule to a CM-specific protease (i.e., after cleavage of the CM by at least one protease).
- a cleaved activatable molecule may lack a MM due to cleavage of the CM (e.g., by a protease), resulting in release of the MM.
- An AM may be any polypeptide that specifically binds a target.
- the AM may be a therapeutic macromolecule.
- the AM may be an antibody or an antigen-binding fragment. In some examples, the AM may be an antineoplastic macromolecule. In some examples, the AM may be a cytokine. In some examples, the AM may be a chimeric antigen receptor. [0076] In some examples, the AM may be a diagnostic macromolecule.
- the diagnostic macromolecule may be a diagnostic polypeptide having 3 to 30, 5 to 25, 7 to 20, or 9 to 15 amino acids in length. Such diagnostic polypeptide may be used, in non-limiting aspects, e.g., for testing cleavage in tissues, and/or assessment of the tissue microenvironment.
- the terms “specific binding” and “specifically binds” refer to the non-covalent interactions of the type that occur between an AM and its target, e.g., an immunoglobulin molecule and an antigen or a cytokine and its receptor, for which the AM is specific.
- the strength or affinity of binding interactions can be expressed in terms of the dissociation constant (K d ) of the interaction, wherein a smaller K d represents a greater affinity.
- affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of an AM and its target. Affinity can be measured by common methods known in the art, including those described herein.
- Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®). Additional methods for determining the affinity for an AM and its target are known in the art. Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex CYTX-083 formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
- SPR surface plasmon resonance
- FORTEBIO® biolayer interferometry
- both the “on rate constant” (K on ) and the “off rate constant” (K off ) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)).
- the ratio of K off /K on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant Kd. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
- a statement that an AM “specifically binds” to its target refers to an AM that binds its target with a dissociation constant (Kd) of less than 100 ⁇ M (e.g., less than 5 ⁇ M or 10 ⁇ M).
- the AM specifically binds its target with a K d of about 0.01 nM to about 500 nM.
- an AM is said to specifically bind the target, when the equilibrium binding constant (K d ) is d1 PM, in some embodiments d 100 nM, in some embodiments d 10 nM, and in some embodiments d 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
- an activatable molecule may be designed by selecting an AM of interest and constructing the remainder of the activatable molecule so that, when conformationally constrained, the MM provides for masking of the AM or reduction of binding of the AM to its target. Structural design criteria can be to be taken into account to provide for this functional feature.
- Activatable molecules may be provided in a variety of structural configurations. Exemplary formulas for activatable molecules are provided below. It is contemplated that the N- to C-terminal order of the AM, MM and CM may be reversed within an activatable molecule.
- activatable molecules can be represented by the following formulas (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM-CM-AM AM-CM-MM As used herein and unless otherwise stated, each dash (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linkers. It should be noted that although MM and CM are indicated as distinct components in the formulas above, in all exemplary embodiments (including formulae) disclosed herein it is contemplated that the amino acid sequences of the MM and the CM may overlap, e.g., such that the CM is completely or partially contained within the MM.
- CYTX-083 formulas above provide for additional amino acid sequences that may be positioned N- terminal or C-terminal to the activatable molecules components.
- Examples include targeting moieties (e.g., a ligand for a receptor of a cell present in a target tissue) and half-life extending moieties.
- MM, CM, and/or AM are coupled indirectly via one or more linkers (e.g., a linking peptide (LP)).
- linkers e.g., a linking peptide (LP)
- an activatable molecule may comprise one of the following formulae (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM-LP-CM-AM MM-CM-LP-AM MM-LP1-CM-LP2-AM AM-LP-CM-MM AM-CM-LP-MM AM-LP2-CM-LP1-MM wherein LP1 and LP2 are two linking peptides.
- the LP1 and LP2 are identical to each other.
- the LP1 and LP2 are not identical to each other.
- the activatable molecule comprises a plurality of CMs, at least one of which comprises the sequence of any of SEQ ID NOs: 1-74 or 160.
- the CM comprising the sequence of any of SEQ ID NOs: 1-74 or 160 may be engineered into a longer cleavage substrate that has a plurality of CMs.
- the additional CM(s) in the activatable molecule that are not the CM comprising the sequence of any of SEQ ID NOs: 1-74 or 160 include those described in WO 2010/081173, WO2021207669, WO2021207657, WO2021142029, WO2021061867, WO2020252349, WO2020252358, WO2020236679, WO2020176672, WO2020118109, WO2020092881, WO2020086665, WO2019213444, WO2019183218, WO2019173771, WO2019165143, WO2019075405, WO2019046652, WO2019018828, WO2019014586, WO2018222949, WO2018165619, WO2018085555, WO2017011580,
- one or more of the additional CMs may be cleavable by legumain.
- the CM cleavable by legumain may comprise a sequence of any of SEQ ID NO: 1-74 or 160 and an Asparagine (Asn) residue at the N-terminus or C-terminus.
- CYTX-083 the substrate comprises CM1 cleavable by a first protease, and CM2 cleavable by a second protease.
- the substrate comprises CM1 cleavable by a first protease, CM2 cleavable by a second protease, and CM3 cleavable by a third protease. In some embodiments, the substrate comprises CM1 cleavable by a first protease, CM2 cleavable by a second protease, CM3 cleavable by a third protease, and CM4 cleavable by a fourth protease.
- the activatable molecule comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM1-CM2-AM, MM-CM2- CM1-AM, AM-CM1-CM2-MM, or AM-CM2-CM1-MM, MM-CM2-CM1-CM3-AM, MM- CM1-CM2-CM3-AM, MM-CM1-CM3-CM2-AM, MM-CM3-CM1-CM2-AM, or MM- CM3-CM2-CM1-AM.
- a CM4 may be inserted any position between the MM and AM.
- the activatable molecule comprises a linking peptide (LP) and wherein the activatable molecule has a structural arrangement from N-terminus to C- terminus as follows: MM-LP-CM1-CM2-AM, MM-CM1-CM2-LP-AM, MM-LP-CM2- CM1-AM, MM-CM2-CM1-LP-AM, MM-LP-CM2-CM1-CM3-AM, MM-LP-CM1-CM2- CM3-AM, MM-LP-CM1-CM3-CM2-AM, MM-LP-CM3-CM1-CM2-AM, MM-LP-CM3-CM2-CM1-AM, MM-CM2-CM1-CM3-LP-AM, MM-CM1-CM2-CM3-LP-AM, MM-CM1-CM2-CM3-LP-AM, MM-CM1-CM2-CM3-LP-AM, MM-CM1-CM2-CM3-LP-AM, MM-CM1-CM2-LP-AM
- the activatable molecule comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the activatable molecule has a structural arrangement from N-terminus to C-terminus as follows: MM- LP1-CM1-CM2- LP2-AM, MM-LP1-CM2-CM1-LP2-AM, AM-LP2-CM1-CM2-LP1-MM, or AM-LP2- CM2-CM1-LP1-MM, MM-LP1-CM2-CM1-CM3-LP2-AM, MM-LP1-CM1-CM2-CM3- LP2-AM, MM-LP1-CM1-CM3-CM2-LP2-AM, MM-LP1-CM1-CM3-CM2-LP2-AM, MM-LP1-CM3-CM1-CM2-LP2-AM, MM-LP1-CM3-CM1-CM2-LP2-AM, MM-LP1-CM3-CM2-CM1-LP2-AM, MM-LP1-CM3-
- the activatable molecule comprises an additional linking peptide (LP3) and wherein the activatable molecule has a structural arrangement from N- CYTX-083 terminus to C-terminus as follows: MM-LP-CM1-LP3-CM2-AM, MM-CM1-LP3-CM2-LP- AM, MM-LP-CM2-LP3-CM1-AM, MM-CM2-LP3-CM1-LP-AM, MM-LP-CM2-LP3- CM1-CM3-AM, MM-LP-CM1-LP3-CM2-CM3-AM, MM-LP-CM1-LP3-CM3-CM2-AM, MM-LP-CM1-LP3-CM3-CM2-AM, MM-LP-CM3-LP3-CM1-CM2-AM, MM-LP-CM3-LP3-CM1-CM2-AM, MM-LP-CM3-LP3-CM2-CM1-AM, MM-CM2-LP3- CM1-AM, MM-
- the activatable molecule has a structural arrangement from N-terminus to C-terminus as follows: MM-LP-CM2-LP3-CM1-LP4-CM3-AM, MM-LP- CM1-LP3-CM2-LP4-CM3-AM, MM-LP-CM1-LP3-CM3-LP4-CM2-AM, MM-LP-CM3- LP3-CM1-LP4-CM2-AM, MM-LP-CM3-LP3-CM2-LP4-CM1-AM, MM-CM2-LP3-CM1- LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-
- CM4 may be inserted any position between the MM and AM.
- the CM1 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM2 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM3 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160.
- the CM4 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160.
- the activatable molecule comprises a plurality of CMs
- at least a portion of a first CM overlaps with at least a portion of a second CM in the substrate, such that one or more amino acids in the substrate belong to both CMs.
- a substrate with the sequence X 1 X 2 X 3 X 4 X 5 X 6 may comprise overlapping CM1 and CM2, in which CM1 is X 1 X 2 X 3 X 4 and CM2 is X 3 X 4 X 5 X 6 .
- CMs do not overlap in amino acid sequences such that no amino acid in the substrate belongs to both CMs.
- a substrate with the sequence X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 (each X is an amino acid) may comprise non-overlapping CM1 and CM2, in which CM1 is X 1 X 2 X 3 X 4 and CM2 is X 5 X 6 X 7 X 8 .
- the non- overlapping CM1 and CM2 are coupled directly.
- the non-overlapping CM1 and CM2 are coupled indirectly (e.g., via a linking peptide).
- two CMs, e.g., CM1 and CM2, in a substrate have a structural arrangement from N-terminus to C-terminus as CM1-CM2.
- two CMs, e.g., CM1 and the CM2 in a substrate have a structural arrangement from N- terminus to C-terminus as CM2-CM1.
- CM1 and CM2 in the formula CM1-CM2 or CM2-CM1 may be overlapping CM1 and CM2, non-overlapping CM1 and CM2 coupled directly, or non-overlapping CM1 and CM2 coupled indirectly (e.g., via a linking peptide).
- two CMs, e.g., CM2 or CM4 and CM3 or CM4, in a substrate have a structural arrangement from N-terminus to C-terminus as CM2-CM3, CM2- CM4 or CM3-CM4.
- two CMs e.g., CM2 and the CM3 in a substrate CYTX-083 have a structural arrangement from N-terminus to C-terminus as CM3-CM2 or CM4-CM2 or CM4-CM3.
- the CM2 and CM3 in the formula CM2-CM3 or CM3-CM2 may be overlapping CM2 and CM3, non-overlapping CM2 and CM3 coupled directly, or non- overlapping CM2 and CM3 coupled indirectly (e.g., via a linking peptide).
- the CM2 and CM4 in the formula CM2-CM4 or CM4-CM2 may be overlapping CM2 and CM4, non-overlapping CM2 and CM4 coupled directly, or non-overlapping CM2 and CM4 coupled indirectly (e.g., via a linking peptide).
- the CM4 and CM3 in the formula CM4-CM3 or CM3-CM4 may be overlapping CM4 and CM3, non-overlapping CM4and CM3 coupled directly, or non-overlapping CM4 and CM3 coupled indirectly (e.g., via a linking peptide).
- the AM is an antibody or antigen-binding fragment thereof.
- antibody is used herein in its broadest sense and includes certain types of immunoglobulin molecules that include one or more target-binding domains that specifically bind an antigen or epitope. Examples of antibodies include intact antibodies (e.g., intact immunoglobulins), antibody fragments, bispecific, and multi-specific antibodies.
- a target-binding domain is formed by a V H -V L dimer. Additional examples of an antibody are described herein. Additional examples of an antibody are known in the art.
- a “light chain” includes one variable domain (VL) and one constant domain (CL).
- a “heavy chain” consists of one variable domain (VH) and three constant region domains (CH1, CH2, CH3).
- VH variable domain
- CH1, CH2, CH3 constant region domains
- the five major classes of immunoglobulin are immunoglobulin M (IgM), immunoglobulin D (IgD), immunoglobulin G (IgG), immunoglobulin A (IgA), and immunoglobulin E (IgE).
- IgG is by far the most abundant immunoglobulin and has several subclasses (IgG1, IgG2, IgG3, and IgG4 in humans).
- the antigen-binding fragment is a Fab fragment, a F(ab')2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, or a single domain light chain antibody.
- antigen-binding fragments include a VH domain, a VHH domain, a VNAR domain, and a single chain fragment variable (scFv), BiTE or a component thereof, a (scFv) 2 , a NANOBODY ® , a nanobody-HSA, VHH-scAb, a VHH- CYTX-083 Fab, a Dual scFab, a F(ab’) 2 , a diabody, a CROSSMAB ® , a DAF (two-in-one), a DAE (four- in-one), a DUTAMAB ® , a DT- IgG, a knobs-in-holes common light chain, a knobs-in-holes assembly, a charge pair, a Fab-arm exchange, a SEEDbody, a LUZ-Y, a FcAb, a kl-body, an orthogonal Fab, a DVD
- a “fragment antigen binding” includes a complete light chain paired with the VH domain and the CH1 domain of a heavy chain.
- $ ⁇ ) ⁇ DE ⁇ 2 fragment is formed when an antibody is cleaved by pepsin (or otherwise truncated) below the hinge region, in which case the two fragment target-binding domains (Fabs) of the antibody molecule remain linked.
- a ) ⁇ DE ⁇ 2 fragment contains two complete light chains paired with the two VH and CH1 domains of the heavy chains joined together by the hinge region.
- a “fragment crystallizable” (Fc) fragment corresponds to the paired CH2 and CH3 domains and is the part of the antibody molecule that interacts with effector molecules and cells.
- the functional differences between heavy-chain isotypes lie mainly in the Fc fragment.
- a “single chain fragment variable” (scFv) contains only the variable domain of a light chain (VL) linked by a stretch of peptide to a variable domain of a heavy chain (VH).
- VL variable domain of a light chain
- VH variable domain of a heavy chain
- the name single-chain Fv is derived from Fragment variable.
- a “hinge region” or “interdomain” is flexible amino acid stretch that joins or links the Fab fragment to the Fc domain.
- a “synthetic hinge region” is an amino acid sequence that joins or links a Fab fragment to an Fc domain.
- An “Fv” fragment includes a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
- a “dual variable domain immunoglobulin G” or “DVD-IgG” refers to multivalent and multispecific target-binding proteins as described, e.g., in DiGiammarino et al., Methods Mol. Biol.
- a VHH domain is a single monomeric variable antibody domain that can be found in camelids.
- a VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish.
- VHH domains and VNAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem.15:2543-2557, 2016; De Genst et al. Dev. Comp. Immunol. 30:187-198, 2006; De Meyer et al, Trends Biotechnol 32:263-270, 2014; Kijanka et al., Nanomedicine 10:161-174, 2015; Kovaleva et al., Expert. Opin. Biol. Ther.14: 1527-1539, 2014; Krah et al., Immunopharmacol.
- the AM may be a mouse, rat, rabbit, goat, camel, donkey, primate, human, or humanized or chimeric polypeptide.
- the AM may be a human polypeptide.
- the AM may be a humanized (e.g., fully humanized) polypeptide.
- humanized refers to an AM having an amino acid sequence that includes VH and VL region sequences from a reference protein raised in a non-human species (e.g., a mouse), but also includes modifications in those sequences relative to the reference protein intended to render them more “human-like,” i.e., more similar to human germline variable sequences.
- a “humanized” AM is one that immunospecifically binds an antigen of interest and that has a framework (FR) region having substantially the amino acid sequence as that of a human protein, and a complementary determining region (CDR) having substantially the amino acid sequence as that of a non- human protein contains humanized VH and VL regions.
- FR framework
- CDR complementary determining region
- human polypeptide is intended to include AMs having variable and constant regions generated, assembled, or derived from human immunoglobulin sequences.
- an AM may be considered to be “human” even though its amino acid sequence include residues or elements not encoded by human germline immunoglobulin sequences (e.g., include sequence variations, for example that may (originally) have been introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), e.g., in one or more CDRs.
- antibodies and antigen-binding fragments include those binding to cell surface receptors and secreted binding proteins (e.g., growth factors), soluble enzymes, structural proteins (e.g. collagen, fibronectin) and the like, or an extracellular target (e.g., an extracellular protein target).
- antibodies and antigen-binding fragments are designed for cellular uptake and are activatable inside a cell.
- Examples of antibodies and antigen-binding fragments include those in Example 1, e.g., those comprising a light chain comprising the sequence of SEQ ID NOs: 83, 85, 87, 89, 90, 92, or 93, and a heavy chain comprising the sequence of SEQ ID NOs: 84, 86, 88, or 91.
- Multispecific Activatable Antibodies [0104] In some embodiments, the activatable antibodies are multispecific activatable antibodies.
- the multispecific activatable antibodies herein recognize two or more different antigens or epitopes and that include at least one masking moiety (MM) linked to at least one antigen- or epitope-binding domain of the multispecific antibody such that coupling of the MM reduces the ability of the antigen- or epitope-binding domain to bind its target.
- the MM is coupled to the antigen- or epitope-binding domain of the multispecific antibody via a cleavable moiety (CM) that functions as a substrate for at least one protease, e.g., MT-SP1.
- CM cleavable moiety
- the activatable multispecific antibodies provided herein are stable in circulation, activated at intended sites of therapy and/or diagnosis but not in normal, i.e., healthy tissue, and, when activated, exhibit binding to a target that is at least comparable to the corresponding, unmodified multispecific antibody.
- the multispecific activatable molecules may be used to target a first and a second target tissues.
- the first and second target tissues are spatially separated, for example, at different sites in the organism.
- the first and second target tissues are the same tissue temporally separated, for example the same tissue at two different points in time, for example the first time point is when the tissue is an early stage tumor, and the second time point is when the tissue is a late stage tumor.
- the multispecific activatable antibody includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first target, where the AB1 is coupled to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target, and the multispecific activatable antibody includes a second antibody or antigen-binding fragment thereof (AB2) that binds a second target, where the AB2 is coupled to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind the second target.
- AB1 antibody or antigen-binding fragment thereof
- MM1 masking moiety
- AB1 is coupled to MM1 via CM1, and AB2 is coupled to MM2 via CM2.
- AB1 is directly coupled to CM1, CM1 is directly coupled to MM1, AB2 is directly coupled to CM2, and/or CM2 is directly coupled to MM2.
- the multispecific activatable antibodies can be represented by the following formulas (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM1-CM1-AB1 : MM2-CM2-AB2 AB1-CM1-MM1 : MM2-CM2-AB2 AB1-CM1-MM1 : AB2-CM2-MM2 wherein “:” separates two polypeptides, which may be two independent polypeptides on two different molecules, or two polypeptides on the same molecule (e.g., two polypeptide chains of the same protein).
- each dash (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linking peptides.
- the multispecific activatable antibodies are designed to engage immune effector cells, also referred to herein as immune-effector cell engaging multispecific activatable antibodies.
- the multispecific activatable antibodies are designed to engage leukocytes, also referred to herein as leukocyte engaging multispecific activatable antibodies.
- the multispecific activatable antibodies are designed to engage T cells, also referred to herein as T-cell engaging multispecific activatable antibodies.
- the multispecific activatable antibodies engage a surface antigen on a leukocyte, such as on a T cell, on a natural killer (NK) cell, on a myeloid mononuclear cell, on a macrophage, and/or on another immune CYTX-083 effector cell.
- the immune effector cell is a leukocyte.
- the immune effector cell is a T cell.
- the immune effector cell is a NK cell.
- the immune effector cell is a mononuclear cell, such as a myeloid mononuclear cell.
- the multispecific activatable antibodies are designed to bind or otherwise interact with more than one target and/or more than one epitope, also referred to herein as multi-antigen targeting activatable antibodies.
- target and “antigen” are used interchangeably.
- immune effector cell engaging multispecific activatable antibodies of the disclosure include a targeting antibody or antigen-binding fragment thereof and an immune effector cell engaging antibody or antigen-binding portion thereof, where at least one of the targeting antibody or antigen-binding fragment thereof and/or the immune effector cell engaging antibody or antigen-binding portion thereof is masked.
- the non-immune effector cell engaging antibody is a cancer targeting antibody.
- the non-immune cell effector antibody is an IgG. In some embodiments the immune effector cell engaging antibody is a scFv. In some embodiments the targeting antibody (e.g., non-immune cell effector antibody) is an IgG and the immune effector cell engaging antibody is a scFv. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is a NK cell. In some embodiments, the immune effector cell is a myeloid mononuclear cell.
- one antigen is typically an antigen present on the surface of a tumor cell or other cell type associated with disease, and another antigen is typically a stimulatory or inhibitory receptor present on the surface of a T-cell, natural killer (NK) cell, myeloid mononuclear cell, macrophage, and/or other immune effector cell.
- NK natural killer
- One embodiment of the disclosure is a multispecific activatable antibody that is activatable in a cancer microenvironment and that includes an antibody, for example an IgG or scFv, directed to a tumor target and an agonist antibody, for example an IgG or scFv, directed to a co-stimulatory receptor expressed on the surface of an activated T cell or NK cell, wherein at least one of the cancer target antibody and/or agonist antibody is masked.
- an antibody for example an IgG or scFv
- an agonist antibody for example an IgG or scFv
- the multispecific activatable antibody once activated by tumor-associated proteases, effectively crosslinks and activates the T cell or NK cell expressed co-stimulatory CYTX-083 receptors in a tumor-dependent manner to enhance the activity of T cells that are responding to any tumor antigen via their endogenous T cell antigen or NK-activating receptors.
- the activation-dependent nature of these T cell or NK cell costimulatory receptors focuses the activity of the activated multispecific activatable antibody to tumor-specific T cells, without activating all T cells independent of their antigen specificity.
- At least the co-stimulatory receptor antibody of the multispecific activatable antibody is masked to prevent activation of auto-reactive T cells that may be present in tissues that also express the antigen recognized by the tumor target-directed antibody in the multispecific activatable antibody, but whose activity is restricted by lack of co-receptor engagement.
- One embodiment of the disclosure is a multispecific activatable antibody that is activatable in a disease characterized by T cell overstimulation, such as an autoimmune disease or inflammatory disease microenvironment.
- Such a multispecific activatable antibody includes an antibody, for example an IgG or scFv, directed to a target comprising a surface antigen expressed in a tissue targeted by a T cell in autoimmune or inflammatory disease and an antibody, for example an IgG or scFv, directed to an inhibitory receptor expressed on the surface of a T cell or NK cell, wherein at least one of the disease tissue target antibody and/or T cell inhibitory receptor antibody is masked.
- tissue antigen targeted by T cells in autoimmune disease include a surface antigen expressed on myelin or nerve cells in multiple sclerosis or a surface antigen expressed on pancreatic islet cells in Type 1 diabetes.
- the multispecific activatable antibody when localized in the tissue under autoimmune attack or inflammation is activated and co-engages the T cell or NK cell inhibitory receptor to suppress the activity of autoreactive T cells responding to any disease tissue-targeted antigens via their endogenous TCR or activating receptors.
- at least one or multiple antibodies are masked to prevent suppression of T cell responses in non-disease tissues where the target antigen may also be expressed.
- the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies include at least a first antibody or antigen-binding fragment thereof that binds a first target and/or first epitope and a second antibody or antigen-binding fragment thereof that binds a second target and/or a second epitope.
- the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different targets.
- the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different CYTX-083 epitopes on the same target.
- the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind a combination of two or more different targets and two or more different epitopes on the same target.
- Masking Moieties MMs
- the activatable molecules herein may comprise one or more masking moieties (MMs) capable of interfering with the binding of the AMs to the target.
- a masking moiety in an activatable molecule “masks” or reduces or otherwise inhibits the binding of the activatable molecule to its target.
- the coupling of an AM (e.g., an antibody or fragment thereof, or other therapeutic or diagnostic protein) with an MM may inhibit the ability of the AM to specifically bind its target by means of inhibition known in the art (e.g., structural change, competition for antigen-binding domain, and the like).
- the coupling of an AM with an MM may effect a structural change that reduces or inhibits the ability of the AM to specifically bind its target.
- the coupling of a protein comprising an AM with an MM sterically blocks, reduces or inhibits the ability of the AM to specifically bind its target and or epitope.
- an MM when an activatable molecule is not activated, the MM prevents the AM from target binding; but when the activatable molecule is activated (when the CM is cleaved by a protease), the MM does not substantially or significantly interfere with the AM’s binding to the target.
- An MM may be coupled to an AM (e.g., an antibody or fragment thereof, or other therapeutic or diagnostic protein) via the CM described herein, either directly or indirectly (e.g., via one or more linkers described herein).
- an MM interfering with the target binding of an AM may be coupled, either directly or indirectly, to a component of the activatable molecule that is not the AM.
- the MM may be coupled, either directly or indirectly, to a different AM.
- the MM may be coupled, either directly or indirectly, with a half-life extending moiety (EM).
- EM half-life extending moiety
- the MM in the tertiary or quaternary structure of the activatable structure, the MM may be in a position (e.g., proximal to the AM to be masked) that allows the MM to mask the AM.
- an MM interacts with the AM, thus reducing or inhibiting the interaction between the AM and its binding partner.
- the MM comprises at least a partial or complete amino acid sequence of a naturally occurring binding partner of the AM.
- the term “naturally occurring” as used herein as applied to an object refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide CYTX-083 sequence that is present in an organism (including viruses or bacteria) that can be isolated from a source in nature and that has not been intentionally modified by man in the laboratory or otherwise is naturally occurring.
- the MM may be a fragment of a naturally occurring binding partner. The fragment may retain at least 95%, at least 90%, at least 80%, at least 75%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 25%, or at least 20% nucleic acid or amino acid sequence homology to the naturally occurring binding partner.
- the MM is a cognate peptide of the AM.
- the MM may comprise a sequence of the AM’s epitope or a fragment thereof.
- the MM comprises an amino acid sequence that is not naturally occurring or does not contain the amino acid sequence of a naturally occurring binding partner or target protein.
- the MM is not a natural binding partner of the AM.
- the MM does not comprise a subsequence of more than 4, 5, 6, 7, 8, 9 or 10 consecutive amino acid residues of a natural binding partner of the AM.
- the MM may be a modified binding partner for the AM which contains amino acid changes that decrease affinity and/or avidity of binding to the AM.
- the MM contains no or substantially no nucleic acid or amino acid homology to the AM’s natural binding partner. In other embodiments the MM has no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% homology to the natural binding partner of the AM. [0120] In some embodiments, the MM is a polypeptide that binds to the AM.
- the MM may be an antibody or antibody fragment (e.g., a Fab fragment, a F(ab’) 2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, and a single domain light chain antibody) that binds to the AM such that interrupts the AM’s binding to its target.
- the MM may be a ligand, a receptor, a fragment thereof (e.g., an extracellular domain of a receptor) of the AM that binds to the AM and interrupts the AM’s binding to its target.
- the MM when the AM is an antibody or antibody fragment thereof, the MM may be an anti-idiotypic antibody or fragment thereof (e.g., scFv) that binds to the idiotype of the AM.
- the MM may be a cytokine or a receptor for a cytokine.
- the MM may have an amino acid sequence that is at least 85% identical to a cytokine or to a receptor for a cytokine.
- CYTX-083 [0121]
- the MM does not bind the AM, but still interferes with AM’s binding to its binding partner through non-specific interactions such as steric hindrance.
- the MM may be positioned in the activatable molecule such that the tertiary or quaternary structure of the activatable molecule allows the MM to mask the AM through charge-based interaction, thereby holding the MM in place to interfere with binding partner access to the AM.
- MMs include an albumin, e.g., human serum albumin (HSA), a fragment crystallizable (Fc) domain, an antibody constant domain (e.g., CH domains), a polymer (e.g., branched or multi-armed polyethylene glycol (PEG)), a latency associated protein (LAP), and any polypeptide or other moieties that sterically interfere AM- target interactions.
- HSA human serum albumin
- Fc fragment crystallizable domain
- an antibody constant domain e.g., CH domains
- PEG branched or multi-armed polyethylene glycol
- LAP latency associated protein
- the MM may recruit a large protein binding partner that sterically interfere AM-target interactions.
- the MM may be an antibody or a fragment thereof that binds to serum albumin.
- suitable masking moieties include the full-length or a AM-binding fragment or mutein of a cognate receptor of the AM, and AM-binding antibodies and fragment thereof, e.g., a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody a single chain variable fragment (scFv), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL), a variable domain of camelid-type nanobody (VHH), a dAb and the like.
- exemplary antigen-binding domain that bind the AM can also be used as an MM include non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds.
- a peptide that is modified by conjugation to a water-soluble polymer, such as PEG can sterically inhibit or prevent binding of the cytokine to its receptor.
- the MMs e.g., those sterically interfere with the AM-target interaction
- the MM can also function as half-life extending elements.
- the MM may have a dissociation constant for binding to the AM that is no more than the dissociation constant of the AM to the target.
- the MM does not interfere or compete with the AM for binding to the target in in the activated molecule (i.e., following cleavage of the CM by a protease).
- the structural properties of the MMs may be selected according to factors such as the minimum amino acid sequence required for interference with the AM binding to target, the target protein-protein binding pair of interest, the size of the AM, the presence or absence of linkers, and the like.
- the MM may be unique for the coupled AM. Examples of MMs include MMs that were specifically screened to bind a binding domain of the AM or fragment thereof (e.g., affinity masks).
- the term “masking efficiency” refers to the activity (e.g., EC 50 ) of the activatable molecule divided by the activity of a control molecule, wherein the control molecule may be either cleavage product of the activatable molecule (i.e., the activated molecule) or the AM used in the activatable molecule.
- An activatable molecule having a reduced level of an AM activity may have a masking efficiency that is greater than 10.
- the activatable molecules described herein have a masking efficiency that is greater than 10, 100, 1000, or 5000.
- the MM is a polypeptide of about 2 to 50 amino acids in length.
- the MM may be a polypeptide of from 2 to 40, from 2 to 30, from 2 to 20, from 2 to 10, from 5 to 15, from 10 to 20, from 15 to 25, from 20 to 30, from 25 to 35, from 30 to 40, from 35 to 45, from 40 to 50 amino acids in length.
- the MM may be a polypeptide with 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids in length.
- the MM may be a polypeptide of more than 50 amino acids in length, e.g., 100, 200, 300, 400, 500, 600, 700, 800, or more amino acids.
- the MM is a steric mask.
- an activatable molecule with an AM and an interfering MM in the presence of the target of an AM, there is no binding or substantially no binding of the AM to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AM to its target, as compared to the binding of an counterpart molecule without the interfering MM, for at CYTX-083 least 0.1, 0.5, 1, 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months when measured in vitro immunoabsorbant assay, e.g., as described in US20200308243A1.
- the binding affinity of the AM towards the target or binding partner with an interfering MM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 times lower than the binding affinity of the AM towards its binding partner without an interfering MM, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100- 1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000- 100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000- 10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AM towards its binding partner when there is no interfering MM.
- the dissociation constant (K d ) of the MM towards the AM it masks may be greater than the dissociation constant of the AM towards the target.
- the dissociation constant of the MM towards the masked AM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times greater than the dissociation constant of the AM towards the target.
- the binding affinity of the MM towards the masked AM may be lower than the binding affinity of the AM towards the target.
- the binding affinity of MM towards the AM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times lower than the binding affinity of the AM towards the target.
- the K d of the activatable molecule comprising an MM and a CM towards the AM’s target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000- 100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000- 10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the Kd of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the MM or CM towards the AM’s target.
- the binding affinity of the activatable molecule comprising an MM and a CM towards the AM’s target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, CYTX-083 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100- 1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000- 10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the MM or CM towards the AM’s target.
- the target-binding ability of the AM coupled with the MM may be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or more when measured in vivo or in an in vitro assay.
- the MM comprises a non-binding steric moiety (NB) that does not bind the AM but is able to interfere the binding between the AM and its target via steric hindrance.
- the MM comprises a binding partner (BP) for a NB, where the BP recruits or otherwise attracts the NB to the activatable molecule.
- the MM contains genetically encoded or genetically non- encoded amino acid(s). Examples of genetically non-encoded amino acids include D-amino DFLGV ⁇ -DPLQR ⁇ DFLGV ⁇ DQG ⁇ -amino acids.
- the MMs contain no more than 50%, 40%, 30%, 20%, 15%, 10%, 5% or 1% of genetically non-encoded amino acids.
- the MM may have a biological activity or a therapeutic effect, such as binding capability.
- the free peptide may bind with the same or a different binding partner.
- the free MM may exert a therapeutic effect, providing a secondary function to the compositions disclosed herein.
- the MM may advantageously not exhibit biological activity.
- Suitable MMs may be identified and/or further optimized through a screening procedure from a library of candidate activatable molecule having variable MMs.
- an AM and a CM may be selected to provide for a desired enzyme/target combination, and the amino acid sequence of the MM can be identified by the screening procedure described below to identify an MM that provides for an activatable phenotype.
- a random peptide library e.g., of peptides comprising 2 to 40 amino acids or more
- MMs with specific binding affinity for an AM may be identified through a screening procedure that includes providing a library of peptide scaffolds comprising candidate MMs wherein each scaffold is made up of a transmembrane protein and the candidate MM.
- the library may then be contacted with an entire or portion of a protein such as a full length protein, a naturally occurring protein fragment, or a non-naturally occurring fragment containing a protein (also capable of binding the binding partner of interest), and identifying one or more candidate MMs having detectably bound protein.
- the screening may be performed by one more rounds of magnetic-activated sorting (MACS) or fluorescence-activated sorting (FACS), as well as determination of the binding affinity of MM towards the AM and subsequent determination of the masking efficiency, e.g., as described in WO2009025846 and US20200308243A1, which are incorporated herein by reference in their entireties.
- MCS magnetic-activated sorting
- FACS fluorescence-activated sorting
- MMs examples include WO2021207657, WO2021142029, WO2021061867, WO2020252349, WO2020252358, WO2020236679, WO2020176672, WO2020118109, WO2020092881, WO2020086665, WO2019213444, WO2019183218, WO2019173771, WO2019165143, WO2019075405, WO2019046652, WO2019018828, WO2019014586, WO2018222949, WO2018165619, WO2018085555, WO2017011580, WO2016179335, WO2016179285, WO2016179257, WO2016149201, and WO2016014974, which are incorporated herein by reference in their entireties.
- the AM in an activatable molecule is an antibody or antigen-binding fragment that specifically binds EGFR.
- such an activatable molecule comprises an MM that comprises the amino acid sequence of SEQ ID NO: 81.
- such an activatable molecule comprises an MM that comprises the amino acid sequence of SEQ ID NO: 82.
- such an activatable molecule comprises an MM that consists of the amino acid sequence of SEQ ID NO: 81.
- such an activatable molecule comprises an MM that consists of the amino acid sequence of SEQ ID NO: 82.
- the present disclosure includes an activatable antibody comprising an anti-EGFR antibody coupled directly or indirectly to a CM, wherein the CM is directly or indirectly coupled to an MM that comprises or consists of the amino acid sequence of SEQ ID NO: 82.
- Linkers [0141]
- the activatable molecules may comprise one or more linkers.
- the linkers may be linking peptides that comprise a stretch of amino acid sequence that link two components in the activatable molecule.
- the linkers may be non-cleavable by any protease.
- one or more linkers may be introduced into the activatable molecule to provide flexibility at one or more of the junctions between domains, between moieties, between moieties and domains, or at any other junctions where a linker would be beneficial.
- a flexible linker may be inserted to facilitate formation and maintenance of a structure in the activatable molecule. Any of the linkers described herein may provide the desired flexibility to facilitate the inhibition of the binding of a target, or to facilitate cleavage of a CM by a protease.
- linkers included in the activatable molecule may be all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable molecule. Some linkers may include cysteine residues, which may form disulfide bonds and reduce flexibility of the construct.
- a linker coupled to an MM may have a length that allows the MM to be in a position in the tertiary or quaternary to effectively mask an AM, (e.g., proximal to the AM to be masked) that allows the MM to mask the AM.
- the linker’s length may be determined by counting, in a N- to C- direction, the number of amino acids from the N-terminus of the linker adjacent to the C- terminal amino acid of the preceding component, to the C-terminus of the linker adjacent to the N-terminal amino acid of the following component (i.e., where the linker length does not include either the C-terminal amino acid of the preceding component or the N-terminal amino acid of the following component).
- a linker may include a total of 1 to 50, 1 to 40, 1 to 30, 1 to 25 (e.g., 1 to 24, 1 to 22, 1 to 20, 1 to 18, 1 to 16, 1 to 15, 1 to 14, 1 to 12, 1 to 10, 1 to 8, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 25, 2 to 24, 2 to 22, 2 to 20, 2 to 18, 2 to 16, 2 to 15, 2 to 14, 2 to 12, 2 to 10, 2 to 8, 2 to 6, 2 to 5, 2 to 4, 2 to 3, 4 to 25, 4 to 24, 4 to 22, 4 to 20, 4 to 18, 4 to 16, 4 to 15, 4 to 14, 4 to 12, 4 to 10, 4 to 8, 4 to 6, 4 to 5, 5 to 25, 5 to 24, 5 to 22, 5 to 20, 5 to 18, 5 to 16, 5 to 15, 5 to 14, 5 to 12, 5 to 10, 5 to 8, 5 to 6, 6 to 25, 6 to 24, 6 to 22, 6 to 20, 6 to 18, 6 to 16, 6 to 15, 6 to 14, 6 to 12, 6 to 10, 6 to 8, 8 to 25, 8 to 24, 8 to 22, 8 to 22, 8 to to 22, 8 to to
- the linker may include a total of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids.
- a linker may be rich in glycine (Gly or G) residues.
- the linker may be rich in serine (Ser or S) residues.
- the linker may be rich in glycine and serine residues.
- the linker may have one or more glycine-serine residue pairs (GS) (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GS pairs).
- the linker may have one or more Gly-Gly-Gly-Ser (GGGS) (SEQ ID NO: 102) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGS (SEQ ID NO: 102) sequences).
- the linker may have one or more Gly-Gly-Gly-Gly-SEQ ID NO: 108) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGGS (SEQ ID NO: 108) sequences).
- the linker may have one or more Gly-Gly-Ser-Gly (GGSG) (SEQ ID NO: 95) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGSG (SEQ ID NO: 95) sequences).
- the linkers may include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GGS)n, (GSGGS)n (SEQ ID NO: 159) and (GGGS)n (SEQ ID NO: 102), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art.
- Glycine and glycine-serine polymers may be relatively unstructured, and therefore may be able to serve as a neutral link between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side CYTX-083 chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)).
- Exemplary flexible linkers include one of or a combination of one or more of: GGSG (SEQ ID NO: 95), GGSGG (SEQ ID NO: 96), GSGSG (SEQ ID NO: 97), GSGGG (SEQ ID NO: 98), GGGSG (SEQ ID NO: 99), GSSSG (SEQ ID NO: 100), GSSGGSGGSGG (SEQ ID NO: 101), GGGS (SEQ ID NO: 102), GGGSGGGS (SEQ ID NO: 103), GGGSGGGSGGGS (SEQ ID NO: 104), GGGGSGGGGSGGGGS (SEQ ID NO: 105), GGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 106), GGGGSGGGGS (SEQ ID NO: 107), GGGGS (SEQ ID NO: 108), GS, GGGGSGS (SEQ ID NO: 109), GGGGSGGGGSGGGGSGS (SEQ ID NO: 110), GGSLDPKGGGGS (SEQ ID NO
- linkers may further include a sequence that is at least 70% identical (e.g., at least 72%, at least 74%, at least 75%, at least 76%, at least 78%, at least 80%, at least 82%, at least 84%, at least 85%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the example linkers described herein.
- a sequence that is at least 70% identical e.g., at least 72%, at least 74%, at least 75%, at least 76%, at least 78%, at least 80%, at least 82%, at least 84%, at least 85%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the example linkers described herein.
- an activatable molecule can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable molecules structure.
- an activatable molecule may include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences of any of the exemplary linker sequences described herein or known in the art).
- a linker may comprise sulfo-SIAB, SMPB, and sulfo-SMPB, wherein the linkers react with primary amines sulfhydryls.
- Half-life extending moieties EMs
- the activatable molecule may further comprise a half-life extending moiety (EM).
- the half-life extending moiety may be a serum half-life extending moiety, i.e., capable of extending the serum half-life of the molecule attached to the EM.
- CYTX-083 [0150]
- the EM may comprise a fragment crystallizable region (Fc domain) of an antibody.
- the EM may be the Fc domain of an IgG (e.g., IgG1, IgG2, IgG3, or IgG4).
- the EM may comprise a dimer formed by two Fc domains.
- the Fc domain may be a wild type peptide or a mutant.
- the EM may comprise a dimer formed by two Fc domain mutants.
- the two Fc domain mutants may be a Fc domain hole mutant and a Fc domain knob mutant. The knob and hole mutants may interact with each other to facilitate the dimerization of the two Fc domains.
- the knob and hole mutants may comprise one or more amino acid modifications within the interface between two Fc domains (e.g., in the CH3 domain).
- the modifications comprise amino acid substitution T366W and optionally the amino acid substitution S354C in one IgG Fc domain and the amino acid substitutions T366S, L368A, Y407V and optionally Y349C in the other IgG Fc domain (numbering according to EU numbering system).
- Example of Fc mutants also include SEQ ID NOs: 123-124. [0151]
- Examples of the Fc domain mutants also include those described in U.S. Pat. Nos. 7,695,936, which is incorporated herein by reference in its entirety.
- the modifications comprise amino acid substitution T366Y in one IgG Fc domain, and the amino acid substitutions Y407T in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution T366W in one IgG Fc domain, and the amino acid substitutions Y407A in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405A in one IgG Fc domain, and the amino acid substitutions T394W in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution T366Y and F405A in one IgG Fc domain, and the amino acid substitutions T394W and Y407T in the other IgG Fc domain.
- the modifications comprise amino acid substitution T366W and F405W in one IgG Fc domain, and the amino acid substitutions T394S and Y407A in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405W and Y407A in one IgG Fc domain, and the amino acid substitutions T366W and T394S in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405W in one IgG Fc domain, and the amino acid substitutions T394S in the other IgG Fc domain.
- the mutation positions in the Fc domains are numbered according to EU numbering system.
- the IgG Fc domain may be comprise a sequence of SEQ ID NOs: 125-128 (IgG1, IgG2, IgG3 or IgG4). In these sequences, amino acids 1-107 correspond to EU numbering 341-447. CYTX-083 [0152] In some examples, the Fc domains mutants may have reduced effector function. Examples of such Fc domains include those disclosed in in US20190135943, which incorporated herein by reference in its entirety.
- EMs include immunoglobulin (e.g., IgG), serum albumin (e.g., human serum albumin (HSA), hexa-hat GST (glutathione S-transferase) glutathione affinity, Calmodulin-binding peptide (CBP), Strep-tag, Cellulose Binding Domain, Maltose Binding Protein, S-Peptide Tag, Chitin Binding Tag, Immuno-reactive Epitopes, Epitope Tags, E2Tag, HA Epitope Tag, Myc Epitope, FLAG Epitope, AU1 and AU5 Epitopes, Glu- Glu Epitope, KT3 Epitope, IRS Epitope, Btag Epitope, Protein Kinase-C Epitope, and VSV Epitope.
- immunoglobulin e.g., IgG
- serum albumin e.g., human serum albumin (HSA)
- HSA human serum albumin
- CBP
- the serum half-life of an activatable molecule comprising an EM is longer than that of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the EM, e.g., the pK of the activatable molecule is longer than that of the reference molecule.
- the activatable molecule with an EM may have a serum half-life that is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 2-fold, 4-fold, 6-fold, 8-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold longer than the serum half-life of the reference counterpart molecule.
- the serum half-life of the activatable molecule with an EM may be at least 15 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, 1 day, 20 hours, 18 hours, 16 hours, 14 hours, 12 hours, 10 hours, 8 hours, 6 hours, 4 hours, 3 hours, 2 hours, or 1 hour when administered to an organism.
- Conjugation Agents [0155] In some aspects, the present disclosure provides conjugated polypeptides.
- a conjugated polypeptide comprises a CM-containing polypeptide herein conjugated to one or more agent, e.g., a targeting moiety to facilitate delivery to a cell or tissue of interest, a therapeutic agent (e.g., an antineoplastic agent such as chemotherapeutic or anti-neoplastic agent), a toxin, or a fragment thereof.
- agent e.g., a targeting moiety to facilitate delivery to a cell or tissue of interest
- a therapeutic agent e.g., an antineoplastic agent such as chemotherapeutic or anti-neoplastic agent
- the agents may be conjugated to a component of the activatable molecules.
- the conjugated polypeptide is an antibody-drug conjugate (ADC), which comprises an antibody or antigen-binding fragment thereof conjugated with a drug.
- ADC antibody-drug conjugate
- the antibody or antigen-binding fragment thereof may be conjugated with the drug via a CM disclosed herein.
- the antibody or antigen-binding fragment thereof may be an activatable antibody CYTX-083 or antigen-binding fragment thereof (e.g., coupled with a MM via a CM), which is further conjugated with a drug (e.g., via a cleavable or non-cleavable conjugating linker).
- a drug e.g., via a cleavable or non-cleavable conjugating linker.
- the agent examples include toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof.
- the activatable molecule is conjugated to a cytotoxic agent, e.g., a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof) or a radioactive isotope.
- cytotoxic agents include that can be conjugated to the activatable molecules dolastatins and derivatives thereof (e.g., auristatin E, AFP, monomethyl auristatin D (MMAD), monomethyl auristatin F (MMAF), monomethyl auristatin E (MMAE), desmethyl auristatin E (DMAE), auristatin F, desmethyl auristatin F (DMAF), dolastatin 16 (DmJ), dolastatin 16 (Dpv), auristatin derivatives (e.g., auristatin tyramine, auristatin quinolone), maytansinoids (e.g., DM-1, DM-4), maytansinoid derivatives, duocarmycin, alpha-amanitin, turbostatin, phenstatin, hydroxyphenstatin, spongistatin 5, spongistatin 7, halistatin 1, halistatin 2, halistatin
- the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or derivative thereof. In some embodiments, the agent is a calicheamicin or derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine.
- Examples of enzymatically active toxins that can be conjugated to the activatable molecules include diphtheria toxin, exotoxin A chain from Pseudomonas aeruginosa, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuriies fordii proteins, dianfhin proteins, Phytolaca Americana proteins (e.g., PAPI, PAPII, and PAP-8), momordica charantia inhibitor, curcin, crotirs, sapaonaria officinalis inhibitor, geionin, mitogeliin, restrictocin, phenomycin, neomycin, and tricothecenes.
- diphtheria toxin exotoxin A chain from Pseudomonas aeruginosa
- ricin A chain abrin A chain
- modeccin A chain alpha-sarcin
- Aleuriies fordii proteins dianfhin
- radionuclides are available for the CYTX-083 production of radioconjugated molecules.
- radionuclides include 212 Bi, 131 I, 131 In, 90 Y, and 186 Re.
- anti-neoplastics that can be conjugated to the activatable molecules include: adriamycin, cerubidine, bleomycin, alkeran, velban, oncovin, fluorouracil, methotrexate, thiotepa, bisantrene, novantrone, thioguanine, procarabizine, and cytarabine.
- Examples of antivirals that can be conjugated to the activatable molecules include acyclovir, vira A, and symmetrel.
- Examples of antifungals that can be conjugated to the activatable molecules include: nystatin.
- Examples of detection reagents that can be conjugated to the activatable molecules include: fluorescein and derivatives thereof, fluorescein isothiocyanate (FITC).
- Examples of antibacterials that can be conjugated to the activatable molecules include: aminoglycosides, streptomycin, neomycin, kanamycin, amikacin, gentamicin, and tobramycin.
- OSW-1 examples include: s-nitrobenzyloxycarbonyl derivatives of O6-benzylguanine, toposisomerase inhibitors, hemiasterlin, cephalotaxine, homoharringionine, pyrrol Whyzodiazepine dimers (PBDs), functionalized pyrrolobenzodiazepenes, calcicheamicins, podophyiitoxins, taxanes, and vinca alkoids.
- radiopharmaceuticals that can be conjugated to the activatable molecules include: 123 I , 89 Zr, 125 I, 131 I, 201 T1, 62 Cu, 18 F, 68 Ga, 13 N, 15 O, 38 K, 82 Rb, 111 In, 133 Xe, 11 C, and 99m Tc (Technetium).
- heavy metals that can be conjugated to the activatable molecules include: barium, gold, and platinum.
- anti-mycoplasmals that can be conjugated to the activatable molecules include: tylosine, spectinomycin, streptomycin B, ampicillin, sulfanilamide, polymyxin, and chloramphenicol.
- the agent is a nucleic acid damaging agent, such as a DNA alkylator or DNA intercalator, or other DNA damaging agent.
- nucleic acid damaging agent such as a DNA alkylator or DNA intercalator, or other DNA damaging agent.
- Additional examples of the agents that can be conjugated include those in Table 1 below.
- Table 1 Exemplary Pharmaceutical Agents for Conjugation CYTOTOXIC AGENTS CYTX-083 Desmethyl auristatin E (DMAE) Spongistatin 7 Auristatin F Halistatin 1 M hl i i F MMAF Hli i 2 CYTX-083 Velban 11 C Oncovin 62 Cu Fl il 18 F
- the activatable molecule comprises a signal peptide.
- the activatable molecule may comprise multiple signal peptides, e.g., one signal peptide for each of the multiple polypeptides.
- a signal peptide may be a peptide (e.g., 10-30 amino acids long) present at a terminus (e.g., the N-terminus or C- terminus) of a newly synthesized proteins that are destined toward the secretory pathway.
- the signal peptide may be conjugated to the activatable molecule via a spacer.
- the spacer may be conjugated to the activatable molecule in the absence of a signal peptide.
- agents may be conjugated to any of the activatable molecules described herein.
- the agents may be conjugated to another component of the activatable molecule by a conjugating linker.
- Conjugation may include any chemical reaction that binds the two molecules so long as the activatable molecule and the other moiety retain their respective activities.
- Conjugation may CYTX-083 include many chemical mechanisms, e.g., covalent binding, affinity binding, intercalation, coordinate binding, and complexation.
- the binding may be covalent binding. Covalent binding may be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules.
- conjugation may include organic compounds, such as thioesters, carbodiimides, succinimide esters, glutaraldehyde, diazobenzenes, and hexamethylene diamines.
- the activatable molecules may include, or otherwise introduce, one or more non-natural amino acid residues to provide suitable sites for conjugation.
- an agent is attached by disulfide bonds (e.g., disulfide bonds on a cysteine molecule) to the activatable molecule.
- glutathione present in the cancerous tissue microenvironment can reduce the disulfide bonds, and subsequently release the agent at the site of delivery.
- the agent when the agent binds its target in the presence of complement within the target site (e.g., diseased tissue (e.g., cancerous tissue)), the amide or ester bond attaching the agent to the linker is cleaved, resulting in the release of the agent in its activated form.
- the agent when administered to a subject, may accomplish delivery and release of the agent at the target site (e.g., diseased tissue (e.g., cancerous tissue)).
- the one or more agents is conjugated to a component of the activatable molecule (e.g., AM) via a conjugating linker.
- the conjugating linker may be a peptide or chemical moiety linking the agent and the activatable molecule.
- the conjugating linker may be cleavable (e.g., by an enzyme such as a protease).
- the conjugating linker may be non-cleavable (e.g., cannot be cleaved by an enzyme such as a protease).
- the conjugating linker may be non-cleavable by enzymes of the complement system.
- two or more conjugating linkers are present.
- the two or more conjugating linkers may be the same, i.e., cleavable or non- cleavable.
- the two or more conjugating linkers may be different, i.e., at least one cleavable and at least one non-cleavable.
- the agent may be released without complement activation since complement activation ultimately lyses the target cell.
- the conjugate and/or agent is to be delivered to the target cell (e.g., hormones, enzymes, CYTX-083 corticosteroids, neurotransmitters, or genes).
- the conjugating linker may be mildly susceptible to cleavage by serum proteases, and the conjugate and/or agent is released slowly at the target site.
- the agent is conjugated to a component of the activatable molecule via a maleimide caproyl-valine-citrulline linker or a maleimide PEG-valine- citrulline linker.
- the agent is conjugated to a component of the activatable molecule via a maleimide caproyl-valine-citrulline linker.
- the agent is conjugated to a component of the activatable molecule via a maleimide PEG- valine-citrulline linker.
- the agent is monomethyl auristatin D (MMAD) conjugated to a component of the activatable molecule via a maleimide PEG- valine-citrulline-para-aminobenzyloxycarbonyl linker, and this linker payload construct is vc- MMAD.
- the agent is monomethyl auristatin E (MMAE) conjugated to a component of the activatable molecule via a maleimide PEG-valine-citrulline-para- aminobenzyloxycarbonyl linker, and this linker payload construct is vc-MMAE.
- the agent may be designed such that the agent is delivered to the target site (e.g., disease tissue (e.g., cancerous tissue)) but the conjugate and/or agent is not released.
- the agent may be attached to an AM either directly or via amino acids (e.g., D-amino acids), peptides, thiol-containing moieties, or other organic compounds that may be modified to include functional groups that can subsequently be utilized in attachment to AM by methods described herein.
- an activatable molecule includes at least one point of conjugation for an agent. In some embodiments, all possible points of conjugation are available for conjugation to an agent.
- the one or more points of conjugation may include sulfur atoms involved in disulfide bonds, sulfur atoms involved in interchain disulfide bonds, sulfur atoms involved in interchain sulfide bonds but not sulfur atoms involved in intrachain disulfide bonds, and/or sulfur atoms of cysteine or other amino acid residues containing a sulfur atom.
- residues may occur naturally in the protein construct structure or may be incorporated into the protein construct using methods including site-directed mutagenesis, chemical conversion, or mis-incorporation of non- natural amino acids.
- CYTX-083 [0173] The present disclosure also provides methods and materials for preparing an activatable molecule with one or more conjugated agents.
- an activatable molecule may be modified to include one or more interchain disulfide bonds.
- disulfide bonds may undergo reduction following exposure to a reducing agent such DV ⁇ ZLWKRXW ⁇ OLPLWDWLRQ ⁇ 7&(3 ⁇ '77 ⁇ RU ⁇ -mercaptoethanol.
- the reduction of the disulfide bonds may be only partial.
- partial reduction refers to situations where an activatable molecule is contacted with a reducing agent and a fraction of all possible sites of conjugation undergo reduction (e.g., not all disulfide bonds are reduced).
- an activatable molecule may be partially reduced following contact with a reducing agent if less than 99%, (e.g., less than 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or 5%) of all possible sites of conjugation are reduced.
- the activatable molecule having a reduction in one or more interchain disulfide bonds may be conjugated to a drug reactive with free thiols.
- the present disclosure also provides methods and materials for conjugating a therapeutic agent to a particular location on an activatable molecule.
- an activatable molecule may be modified so that the therapeutic agents can be conjugated to the activatable molecule at particular locations on the activatable molecule.
- an activatable molecule may be partially reduced in a manner that facilitates conjugation to the activatable molecule. In such cases, partial reduction of the activatable molecule may occur in a manner that conjugation sites in the activatable molecule are not reduced.
- the conjugation site(s) on the activatable molecule may be selected to facilitate conjugation of an agent at a particular location on the protein construct.
- Various factors can influence the “level of reduction” of the activatable molecule upon treatment with a reducing agent.
- the ratio of reducing agent to activatable molecule, length of incubation, incubation temperature, and/or pH of the reducing reaction solution can require optimization in order to achieve partial reduction of the activatable molecule with the methods and materials described herein. Any appropriate combination of factors (e.g., ratio of reducing agent to activatable molecule, the length and temperature of incubation with reducing agent, and/or pH of reducing agent) may be used to achieve partial reduction of the activatable molecule (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
- An effective ratio of reducing agent to activatable molecule can be any ratio that at least partially (i.e., partially or fully) reduces the activatable molecule in a manner that allows conjugation to an agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
- the ratio of reducing agent to activatable molecule may be in a range from about 20:1 to 1:1, from 10:1 to 1:1, from 9:1 to 1:1, from 8:1 to 1:1, from 7:1 to 1:1, from 6:1 to 1:1, from 5:1 to 1:1, from 4:1 to 1:1, from 3:1 to 1:1, from 2:1 to 1:1, from 20:1 to 1:1.5, from 10:1 to 1:1.5, from 9:1 to 1:1.5, from 8:1 to 1:1.5, from 7:1 to 1:1.5, from 6:1 to 1:1.5, from 5:1 to 1:1.5, from 4:1 to 1:1.5, from 3:1 to 1:1.5, from 2:1 to 1:1.5, from 1.5:1 to 1:1.5, or from 1:1 to 1:1.5.
- An effective incubation time and temperature for treating an activatable molecule with a reducing agent may be any time and temperature that at least partially reduces the activatable molecule in a manner that allows conjugation of an agent to an activatable molecule (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
- the incubation time and temperature for treating an activatable molecule may be in a range from about 1 hour at 37 °C to about 12 hours at 37 °C (or any subranges therein).
- An effective pH for a reduction reaction for treating an activatable molecule with a reducing agent can be any pH that at least partially reduces the activatable molecule in a manner that allows conjugation of the activatable molecule to an agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
- an agent e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites.
- an agent can be modified in a manner to include thiols using a thiol-containing reagent (e.g., cysteine or N-acetyl cysteine).
- the activatable molecule can be partially reduced following incubation with reducing agent (e.g., TEPC) for about 1 hour at about 37 °C at a desired ratio of reducing agent to activatable molecule.
- reducing agent e.g., TEPC
- An effective ratio of reducing agent to activatable molecule may be any ratio that partially reduces at least two interchain disulfide bonds located in the activatable molecule in a manner that allows conjugation of a thiol- containing agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
- an activatable molecule may be reduced by a reducing agent in a manner that avoids reducing any intrachain disulfide bonds.
- CYTX-083 of, an activatable molecule may be reduced by a reducing agent in a manner that avoids reducing any intrachain disulfide bonds and reduces at least one interchain disulfide bond.
- the agent may be a detectable moiety such as, for example, a label or other marker.
- the agent may be or include a radiolabeled amino acid, one or more biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods), one or more radioisotopes or radionuclides, one or more fluorescent labels, one or more enzymatic labels, and/or one or more chemiluminescent agents.
- detectable moieties may be attached by spacer molecules.
- the detectable label may include an imaging agent, a contrasting agent, an enzyme, a fluorescent label, a chromophore, a dye, one or more metal ions, or a ligand-based label.
- the imaging agent may comprise a radioisotope.
- the radioisotope may be indium or technetium.
- the contrasting agent may comprise iodine, gadolinium or iron oxide.
- the fluorescent label may comprise yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), green fluorescent protein (GFP), modified red fluorescent protein (mRFP), red fluorescent protein tdimer2 (RFP tdimer2), HCRED, or a europium derivative.
- the luminescent label may comprise an N- methylacrydium derivative.
- the label may comprise an Alexa Fluor® label, such as Alex Fluor® 680 or Alexa Fluor® 750.
- the ligand-based label may comprise biotin, avidin, streptavidin or one or more haptens.
- detectable labels also include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline SKRVSKDWDVH ⁇ -galactosidase, or acetylcholinesterase
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin
- an example of a luminescent material includes luminol
- examples of bioluminescent materials include luciferase, luciferin, and aequorin
- suitable radioactive material include 125I, 131I, 35S or 3H.
- the agent may be conjugated to the activatable molecule using a carbohydrate moiety, sulfhydryl group, amino group, or carboxylate group. In some embodiments, the agent may be conjugated to the activatable molecule via a linker and/or a CM described herein. In some embodiments, the agent may be conjugated to a cysteine or a lysine in the activatable molecule. In some embodiments, the agent may be conjugated to another residue of the activatable molecule, such as those residues disclosed herein.
- a variety of bifunctional protein-coupling agents may be used to conjugate the agent to the activatable molecule including N-succinimidyl-3-(2- pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (e.g., dimethyl adipimidate HCL), active esters (e.g., disuccinimidyl suberate), aldehydes (e.g., glutareldehyde), bis-azido compounds (e.g., bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (e.g., bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (e.g., tolyene 2,6-diisocyanate), and bis-active fluorine compounds (e.g., 1,5-difluor
- a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987).
- a carbon-14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) chelating agent can be used to conjugate a radionucleotide to the activatable molecule.
- MX-DTPA 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
- Suitable conjugating linkers also include those described in the literature. (See, for example, Ramakrishnan, S.
- suitable conjugating linkers include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4- succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido] hexanoate (Pierce Chem.
- Sulfo-LC-SPDP sulfosuccinimidyl 6 [3-(2- pyridyldithio)-propianamide] hexanoate
- sulfo- NHS N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510 conjugated to EDC.
- Additional example agents include SMCC, sulfo-SMCC, SPDB, and sulfo-SPDB.
- Exemplary conjugating linkers for attachment to reduced activatable molecules include those having certain reactive groups capable of reaction with a sulfhydryl group of a CYTX-083 reduced antibody or fragment.
- Such reactive groups include reactive haloalkyl groups (including, for example, haloacetyl groups), p-mercuribenzoate groups and groups capable of Michael-type addition reactions (including, for example, maleimides and groups of the type described by Mitra and Lawton, 1979, J. Amer. Chem. Soc.101: 3097-3110).
- Exemplary conjugating linkers for attachment to neither oxidized nor reduced activatable molecules include those having certain functional groups capable of reaction with the primary amino groups present in unmodified lysine residues in the activatable molecules.
- Such reactive groups include NHS carboxylic or carbonic esters, sulfo-NHS carboxylic or carbonic esters, 4-nitrophenyl carboxylic or carbonic esters, pentafluorophenyl carboxylic or carbonic esters, acyl imidazoles, isocyanates, and isothiocyanates, and other dehydrating agents utilized for carboxamide formation.
- the functional groups present in the suitable conjugating linkers include primary and secondary amines, hydrazines, hydroxylamines, and hydrazides.
- the agent may be attached to the conjugating linker before or after the conjugating linker is attached to the activatable molecule. In certain applications it may be desirable to first produce an activatable molecule-conjugating linker intermediate in which the conjugating linker is free of an associated agent. Depending upon the particular application, a specific agent may then be covalently attached to the conjugating linker. In some embodiments, the AM is first attached to the MM, CM and associated linking peptides and then attached to the conjugating linker for conjugation purposes.
- branched conjugating linkers that have multiple sites for attachment of agents are utilized.
- a single covalent attachment to an activatable molecule may result in an activatable molecule-linker intermediate capable of binding an agent at a number of sites.
- the sites may be aldehyde or sulfhydryl groups or any chemical site to which agents can be attached.
- higher specific activity or higher ratio of agents to activatable molecule
- attachment of a single site conjugating linker at a plurality of sites on the activatable molecule This plurality of sites may be introduced into the activatable molecule by either of two methods.
- the functional CYTX-083 sites of the branched conjugating linker or multiple site conjugating linker may be aldehyde or sulfhydryl groups, or may be any chemical site to which conjugating linkers may be attached. Still higher specific activities may be obtained by combining these two approaches, that is, attaching multiple site conjugating linkers at several sites on the activatable molecule.
- Peptide conjugating linkers that are susceptible to cleavage by enzymes of the complement system, such as but not limited to u-plasminogen activator, tissue plasminogen activator, trypsin, plasmin, or another enzyme having proteolytic activity may be used in one embodiment of the present disclosure.
- an agent is attached via a conjugating linker susceptible to cleavage by complement.
- the antibody is selected from a class that can activate complement. The antibody-agent conjugate, thus, activates the complement cascade and releases the agent at the target site.
- an agent is attached via a conjugating linker susceptible to cleavage by enzymes having a proteolytic activity such as a u-plasminogen activator, a tissue plasminogen activator, plasmin, or trypsin.
- cleavable conjugating linkers are useful in conjugated activatable molecules that include an extracellular toxin, e.g., by way of non-limiting example, any of the extracellular toxins shown in Table 1.
- Non-limiting examples of cleavable linker sequences include any cleavable sequence disclosed herein or incorporated herein by reference as well as the exemplary sequences provided in Table 2.
- Table 2 Exemplary Conjugating Linker Sequences for Conjugation Types of Cleavable Sequences Amino Acid Sequence CYTX-083 &DOI ⁇ VNLQ ⁇ FROODJHQ ⁇ , ⁇ FKDLQ ⁇ GPQGIAGQ (SEQ ID NO: 139) &DOI ⁇ VNLQ ⁇ FROODJHQ ⁇ , ⁇ FKDLQ ⁇ GPQGLLGA (SEQ ID NO: 140) RYL H ⁇ FD L D H ⁇ FR D H ⁇ ⁇ ⁇ FKDL ⁇ IA E ID 141 , g y p , e disulfide bonds on a cysteine molecule) to the activatable molecule.
- the reducing agent that would modify a CM would also modify the conjugating linker of the conjugated activatable molecule.
- the conjugating linker may comprise a spacer element and a cleavable element.
- the spacer element serves to position the cleavable element away from the core of the activatable molecule such that the cleavable element is more accessible to the CYTX-083 enzyme responsible for cleavage.
- Certain of the branched linkers described above may serve as spacer elements.
- attachment of the conjugating linker to the agent need not be by a particular mode of attachment or reaction. Any reaction providing a product of suitable stability and biological compatibility is acceptable.
- an activatable molecule that is an antibody of a class that can activate complement is used. The resulting conjugate retains both the ability to bind antigen and activate the complement cascade.
- an agent is joined to one end of the cleavable conjugating linker or cleavable element and the other end of the conjugating linker group is attached to a specific site on the activatable molecule.
- the agent may be attached to the carboxyl terminus of a peptide, amino acid or other suitably chosen conjugating linker via an ester or amide bond, respectively.
- such agents may be attached to the linker peptide via a carbodimide reaction. If the agent contains functional groups that would interfere with attachment to the conjugating linker, these interfering functional groups can be blocked before attachment and deblocked once the product conjugate or intermediate is made.
- Conjugating linkers may be of any desired length, one end of which can be covalently attached to specific sites on the activatable molecule. The other end of the conjugating linker or spacer element may be attached to an amino acid or peptide conjugating linker.
- conjugates when administered to a subject, will accomplish delivery and release of the agent at the target site, and are particularly effective for the in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents and the like.
- release of the agent without complement activation is desired since activation of the complement cascade will ultimately lyse the target cell.
- CYTX-083 this approach is useful when delivery and release of the agent should be accomplished without killing the target cell.
- cell mediators such as hormones, enzymes, corticosteroids, neurotransmitters, genes or enzymes to target cells is desired.
- conjugates may be prepared by attaching the agent to an activatable molecule that is not capable of activating complement via a linker that is mildly susceptible to cleavage by serum proteases.
- this conjugate is administered to an individual, antigen-antibody complexes will form quickly whereas cleavage of the agent will occur slowly, thus resulting in release of the compound at the target site.
- the activatable molecule may be conjugated to one or more therapeutic agents using certain biochemical cross-linkers.
- Cross-linking reagents form molecular bridges that tie together functional groups of two different molecules.
- hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
- Peptidyl conjugating linkers cleavable by lysosomal proteases are also useful, for example, Val-Cit, Val-Ala or other dipeptides.
- acid-labile conjugating linkers cleavable in the low-pH environment of the lysosome may be used, for example: bis-sialyl ether.
- Other suitable conjugating linkers include cathepsin-labile substrates, particularly those that show optimal function at an acidic pH.
- Exemplary hetero-bifunctional cross-linkers are referenced in Table 3.
- Table 3 Exemplary Hetero-Bifunctional Cross-Linkers HETERO-BIFUNCTIONAL CROSS-LINKERS Spacer Arm Length after Advantages and cross-linking Linker Reactive Toward Applications (Angstroms)
- SMPT Primary amines Greater stability 11.2 ⁇ Sulfhydryls SPDP Primary amines Thiolation 6.8 ⁇ Sulfhydryls Cleavable cross-linking LC-SPDP Primary amines Extended spacer arm 15.6 ⁇ Sulfhydryls Sulfo-LC-SPDP Primary amines Extender spacer arm 15.6 ⁇ Sulfhydryls Water-soluble CYTX-083 SMCC Primary amines Stable maleimide reactive 11.6 ⁇ group Sulfhydryls Enzyme-antibody conjugation Hapten-carrier protein conjugation Sulfo-SMCC Primary amines Stable maleimide reactive 11.6 ⁇ group Sulfhydryls Water-soluble Enzyme-antibody conjugation
- Non-cleavable conjugating linkers may include amino acids, peptides, D- amino acids or other organic compounds that may be modified to include functional groups that can subsequently be utilized in attachment to activatable molecules by the methods described herein.
- a compound may be attached to activatable molecules that do not activate complement. When using activatable molecules that are incapable of CYTX-083 complement activation, this attachment may be accomplished using conjugating linkers that are susceptible to cleavage by activated complement or using linkers that are not susceptible to cleavage by activated complement.
- CM-containing polypeptides disclosed herein can also be formulated as immunoliposomes.
- Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos.4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- a component of an activatable molecule can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction.
- the agents described above may contain components that have different attributes, thus leading to conjugates with differing physio-chemical properties.
- sulfo- NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates.
- NHS-ester containing linkers are less soluble than sulfo-NHS esters.
- the SMPT contains a sterically-hindered disulfide bond, and can form conjugates with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available.
- Sulfo-NHS in particular, can enhance the stability of carbodimide couplings.
- Carbodimide couplings when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone.
- an effective conjugation of an agent (e.g., cytotoxic agent) to an activatable molecule can be accomplished by any chemical reaction that will bind the agent to the activatable molecule while also allowing the agent and the activatable molecule to retain functionality.
- agent e.g., cytotoxic agent
- the present disclosure further provides nucleic acids comprising sequences that encode the CM-containing polypeptides and polypeptide complexes (e.g., activatable molecules) herein, or components or fragment thereof.
- the nucleic acids may comprise coding sequences for the CMs.
- the nucleic acids may further comprise coding sequences for other components in an activatable molecule, e.g., the AMs, the MMs, the EM and/or the linker(s).
- the activatable molecule comprises multiple polypeptides
- the nucleic acids may comprise coding sequences for the multiple polypeptides.
- the coding sequence for one of the polypeptides is comprised in a nucleic acid molecule
- the coding sequence for another one of the polypeptides is comprised in another nucleic acid molecule.
- the coding sequences for two or more of the multiple polypeptides are comprised in the same nucleic acid molecule.
- nucleic acid sequence encoding a protein includes all nucleotide sequences that are degenerate versions of each other and thus encode the same amino acid sequence.
- nucleic acid refers to a deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), or a combination thereof, in either a single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses complementary sequences as well as the sequence explicitly indicated.
- the nucleic acid is DNA. In some embodiments, the nucleic acid is RNA.
- Modifications may be introduced into a nucleotide sequence by standard techniques known in the art, such as site-directed mutagenesis and polymerase chain reaction (PCR)-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with acidic side chains e.g., aspartate and glutamate
- amino acids with basic side chains e.g., lysine, arginine, and histidine
- non-polar amino acids e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan
- uncharged polar amino acids e.g., glycine, asparagine, glutamine, cysteine, serine, threonine and tyrosine
- hydrophilic amino acids e.g., arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine
- hydrophobic amino acids e.g., alanine, CYTX-083 cysteine, isoleucine, leucine, methionine, phenylalanine, proline, trypto
- amino acids include: aliphatic-hydroxy amino acids (e.g., serine and threonine), amide family (e.g., asparagine and glutamine), alphatic family (e.g., alanine, valine, leucine and isoleucine), and aromatic family (e.g., phenylalanine, tryptophan, and tyrosine).
- aliphatic-hydroxy amino acids e.g., serine and threonine
- amide family e.g., asparagine and glutamine
- alphatic family e.g., alanine, valine, leucine and isoleucine
- aromatic family e.g., phenylalanine, tryptophan, and tyrosine
- One skilled in the art will be capable of selecting suitable vectors or sets of vectors (e.g., expression vectors) for making any of the activatable molecules described herein, and using the vectors or sets of vectors to express any of the activatable molecules described herein.
- suitable vectors or sets of vectors e.g., expression vectors
- the type of cell may be selected such that the vector(s) may need to be able to integrate into a chromosome of the cell and/or replicate in it.
- Example vectors that can be used to produce an activatable molecule are also described herein.
- the term “vector” refers to a polynucleotide capable of inducing the expression of a recombinant protein (e.g., a first or second monomer) in a cell (e.g., any of the cells described herein).
- a “vector” is able to deliver nucleic acids and fragments thereof into a host cell, and includes regulatory sequences (e.g., promoter, enhancer, poly(A) signal). Exogenous polynucleotides may be inserted into the expression vector in order to be expressed.
- the term “vector” also includes artificial chromosomes, plasmids, retroviruses, and baculovirus vectors.
- suitable vectors that comprise any of the nucleic acids described herein, and suitable for transforming cells (e.g., mammalian cells) are well-known in the art. See, e.g., Sambrook et al., Eds. “Molecular Cloning: A Laboratory Manual,” 2nd Ed., Cold Spring Harbor Press, 1989 and Ausubel et al., Eds. “Current Protocols in Molecular Biology,” Current Protocols, 1993.
- vectors include plasmids, transposons, cosmids, and viral vectors (e.g., any adenoviral vectors (e.g., pSV or pCMV vectors), adeno-associated virus (AAV) vectors, lentivirus vectors, and retroviral vectors), and any Gateway® vectors.
- a vector may, for example, include sufficient cis-acting elements for expression; other elements for expression may be supplied by the host mammalian cell or in an in vitro expression system. Skilled practitioners will be capable of selecting suitable vectors and mammalian cells for making any activatable molecule described herein.
- the CM-containing polypeptides may be made biosynthetically using recombinant DNA technology and expression in eukaryotic or prokaryotic species.
- CELLS the present disclosure provides recombinant host cells comprising any of the vectors or nucleic acids described herein. The cells may be used to produce the CM-containing polypeptides (e.g., activatable molecules) described herein.
- the cell may be an animal cell, a mammalian cell (e.g., a human cell), a rodent cell (e.g., a mouse cell, a rat cell, a hamster cell, or a guinea pig cell), a non-human primate cell, an insect cell, a bacterial cell, a fungal cell, or a plant cell.
- the cell may be a eukaryotic cell.
- the term “eukaryotic cell” refers to a cell having a distinct, membrane-bound nucleus.
- Such cells may include, for example, mammalian (e.g., rodent, non-human primate, or human), insect, fungal, or plant cells.
- the eukaryotic cell is a yeast cell, such as Saccharomyces cerevisiae. In some embodiments, the eukaryotic cell is a higher eukaryote, such as mammalian, avian, plant, or insect cells.
- mammalian cells include Chinese hamster ovary (CHO) cells and human embryonic kidney cells (e.g., HEK293 cells).
- the cell may be a prokaryotic cell, e.g., an E coli cell.
- the introducing step includes introducing into a cell a vector (e.g., any of the vectors or sets of vectors described herein) including a nucleic acid encoding the monomers that make up any activatable molecule described herein.
- a vector e.g., any of the vectors or sets of vectors described herein
- compositions and kits comprising the CM- containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein.
- the compositions and kits may further comprise one or more excipients, carriers, reagents, instructions needed for the use of the activatable molecules.
- CYTX-083 the compositions may be pharmaceutical compositions, which comprise the CM-containing polypeptides, derivatives, fragments, analogs and homologs thereof.
- the pharmaceutical compositions may comprise the CM-containing and a pharmaceutically acceptable carrier.
- the term “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington’s Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Suitable examples of such carriers or diluents include water, saline, ringer’s solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art.
- a pharmaceutical composition may be formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (e.g., topical), transmucosal, and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application may include one or more of the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- the pH may be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- any of the activatable molecules described herein are prepared with carriers that protect against rapid elimination from the body, e.g., sustained and controlled release formulations, including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, e.g., ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, CYTX-083 polyorthoesters, polylactic-co-glycolic acid, and polylactic acid. Methods for preparation of such pharmaceutical compositions and formulations are apparent to those skilled in the art.
- the activatable molecules may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules
- Sustained-release preparations may be prepared.
- sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the CM-containing polypeptides, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
- sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides, copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers (e.g., injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D- ⁇ -3-hydroxybutyric acid.
- polyesters for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)
- polylactides for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)
- copolymers of L-glutamic acid and y ethyl-L-glutamate non-degradable ethylene-vin
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ® EL (CAS No.
- the composition may be sterile and should be fluid and of a viscosity that facilitates easy syringeability. It may be stable under the conditions of manufacture and storage and preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for CYTX-083 example, by the use of a coating on the particles such as lecithin, and by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the pharmaceutical compositions may further comprise one or more antibacterial and/or antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, and the like, as well as salts, such as, for example, sodium chloride and the like may be included in the composition. Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
- the pharmaceutical composition may comprise a sterile injectable solution. Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions may be prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the pharmaceutical composition may comprise an oral composition.
- Oral compositions may include an inert diluent or an edible carrier. They may be enclosed in gelatin capsules or compressed into tablets.
- the active compound may be incorporated with excipients and used in the form of tablets, troches, or capsules.
- Oral compositions may also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
- Pharmaceutically compatible binding agents, and/or adjuvant materials may be included as part of the composition.
- the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primojel ® (sodium starch glycolate), or corn starch; a lubricant such as magnesium stearate; a CYTX-083 glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primojel ® (sodium starch glycolate), or corn starch
- a lubricant such as magnesium stearate
- the pharmaceutical composition may be formulized for administration by inhalation.
- the compounds may be delivered in the form of an aerosol spray from pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- the pharmaceutical composition may be formulized for systemic administration.
- systemic administration may be by intravenous, as well by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated may be used in the formulation.
- Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration may be accomplished through the use of nasal sprays or suppositories.
- the active compounds may be formulated into ointments, salves, gels, or creams as generally known in the art.
- the pharmaceutical composition may be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- the pharmaceutical composition may be prepared with carriers that protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- a controlled release formulation including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers may be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic-co-glycolic acid and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the disclosure may be dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic CYTX-083 effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- the compositions e.g., pharmaceutical compositions
- kits that include any of the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein, any of the compositions that include any of the polypeptides described herein, or any of the pharmaceutical compositions that include any of the polypeptides described herein.
- kits that include one or more second therapeutic agent(s) in addition to a polypeptide described herein.
- the second therapeutic agent(s) may be provided in a dosage administration form that is separate from the polypeptides herein. Alternatively, the second therapeutic agent(s) may be formulated together with the polypeptides herein.
- kits described herein can include instructions for using any of the compositions (e.g., pharmaceutical compositions) and/or any of the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein.
- the kits can include instructions for performing any of the methods described herein.
- the kits can include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein.
- the kits can provide a syringe for administering any of the pharmaceutical compositions described herein.
- CM-containing polypeptides e.g., activatable molecules or conjugated polypeptides
- compositions e.g., pharmaceutical compositions
- kits that include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein.
- CM-containing polypeptides e.g., activatable molecules or conjugated polypeptides
- methods of producing the CM-containing polypeptides include: (a) culturing any of the recombinant host cells described herein in a liquid culture medium under conditions CYTX-083 sufficient to produce the CM-containing polypeptides; and (b) recovering the CM-containing polypeptides from the host cell and/or the liquid culture medium.
- Methods of culturing cells are well known in the art. In some embodiments, cells may be maintained in vitro under conditions that favor cell proliferation, cell differentiation and cell growth.
- the recombinant cells may be cultured by contacting a cell (e.g., any of the cells described herein) with a cell culture medium that includes the necessary growth factors and supplements sufficient to support cell viability and growth.
- a cell e.g., any of the cells described herein
- the method may further include isolating the recovered CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides).
- the isolation of the CM-containing polypeptides may be performed using any separation or purification technique for separating protein species, e.g., affinity tag-based protein purification (e.g., polyhistidine (His) tag, glutathione-S-transferase tag, and the like), ammonium sulfate precipitation, polyethylene glycol precipitation, size exclusion chromatography, ligand-affinity chromatography (e.g., Protein A chromatography), ion- exchange chromatography (e.g., anion or cation), hydrophobic interaction chromatography, and the like.
- affinity tag-based protein purification e.g., polyhistidine (His) tag, glutathione-S-transferase tag, and the like
- ammonium sulfate precipitation polyethylene glycol precipitation
- size exclusion chromatography size exclusion chromatography
- ligand-affinity chromatography e.g., Protein A chromatography
- compositions and methods described herein may involve use of non-reducing or partially-reducing conditions that allow disulfide bonds to form between the MM and the AM of the activatable molecules.
- the method further includes formulating the isolated polypeptides into a pharmaceutical composition.
- a pharmaceutical composition e.g., a pharmaceutical composition.
- Any isolated polypeptides described herein can be formulated for any route of administration (e.g., intravenous, intratumoral, subcutaneous, intradermal, oral (e.g., inhalation), transdermal (e.g., topical), transmucosal, or intramuscular).
- the present disclosure further provides methods of using the CM- containing polypeptides herein.
- the present disclosure provides methods of the treating a disease (e.g., a cancer (e.g., any of the cancers described herein)) in a subject including administering a therapeutically effective amount of any of the polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein to the subject.
- the disclosure provides methods of preventing, delaying the progression of, treating, alleviating a symptom of, or otherwise ameliorating disease in a CYTX-083 subject by administering a therapeutically effective amount of an polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein to a subject in need thereof.
- treatment refers to ameliorating at least one symptom of a disorder.
- the disorder being treated may be a cancer or autoimmune disease or to ameliorate at least one symptom of a cancer or autoimmune disease.
- the term “subject” refers to any mammal.
- the subject is a feline (e.g., a cat), a canine (e.g., a dog), an equine (e.g., a horse), a rabbit, a pig, a rodent (e.g., a mouse, a rat, a hamster or a guinea pig), a non-human primate (e.g., a simian (e.g., a monkey (e.g., a baboon, a marmoset), or an ape (e.g., a chimpanzee, a gorilla, an orangutan, or a gibbon)), or a human.
- a feline e.g., a cat
- a canine e.g., a dog
- an equine e.g., a horse
- a rabbit e.g., a pig
- a rodent e.g., a
- the subject is a human.
- the terms subject and patient are used interchangeably herein.
- the subject has been previously identified or diagnosed as having the disease (e.g., cancer (e.g., any of the cancers described herein)).
- a therapeutically effective amount of a CM-containing polypeptide (e.g., activatable molecule or conjugated polypeptide) of the disclosure relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the AM and its target that, in certain cases, interferes with the functioning of the targets.
- the amount required to be administered will furthermore depend on the binding affinity of the polypeptides for its specific target, and will also depend on the rate at which an administered polypeptide is depleted from the free volume other subject to which it is administered. Common ranges for therapeutically effective dosing of a polypeptides of the disclosure may be, by way of non-limiting example, from about 0.001, 0.01, 0.1, 0.3, 0.5, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, or 50 mg/kg body weight or higher.
- the structure of the polypeptides of the present disclosure makes it possible to reduce the dosage of the polypeptide that is administered to a subject compared to conventional activatable molecules and compared to conventional antibodies.
- the administered dose on a unit dosage basis or total dosage over a dosage regimen period may be reduced by 10, 20, 30, 40, or 50% compared to the corresponding dose of a corresponding conventional therapeutic molecules.
- Common dosing frequencies may range, for example, from once or twice daily, weekly, biweekly, or monthly.
- Efficaciousness of treatment is determined in association with any known method for diagnosing or treating the particular disorder. Methods for the screening of polypeptides CYTX-083 that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art.
- ELISA enzyme linked immunosorbent assay
- a polypeptide directed two or more targets are used in methods known within the art relating to the localization and/or quantitation of the targets (e.g., for use in measuring levels of one or more of the targets within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like).
- a polypeptide directed two or more targets, or a derivative, fragment, analog or homolog thereof, that contain the antibody derived antigen binding domain are utilized as pharmacologically active compounds (referred to hereinafter as “Therapeutics”).
- the CM-containing polypeptides used in any of the embodiments of these methods and uses may be administered at any stage of the disease.
- such a polypeptide may be administered to a patient suffering cancer of any stage, from early to metastatic.
- the CM-containing polypeptides and formulations thereof may be administered to a subject suffering from or susceptible to a disease or disorder associated with aberrant target expression and/or activity.
- a subject suffering from or susceptible to a disease or disorder associated with aberrant target expression and/or activity may be identified using any of a variety of methods known in the art.
- subjects suffering from cancer or other neoplastic condition may be identified using any of a variety of clinical and/or laboratory tests such as, physical examination and blood, urine and/or stool analysis to evaluate health status.
- subjects suffering from inflammation and/or an inflammatory disorder may be identified using any of a variety of clinical and/or laboratory tests such as physical examination and/or bodily fluid analysis, e.g., blood, urine and/or stool analysis, to evaluate health status.
- administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression and/or activity may be considered successful if any of a variety of laboratory or clinical objectives is achieved.
- administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression and/or activity may be considered successful if one or more of the symptoms associated with the disease or disorder is alleviated, reduced, inhibited or does not progress to a further, i.e., worse, state.
- Administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression CYTX-083 and/or activity may be considered successful if the disease or disorder enters remission or does not progress to a further, i.e., worse, state.
- the term “treat” includes reducing the severity, frequency or the number of one or more (e.g., 1, 2, 3, 4, or 5) symptoms or signs of a disease (e.g., a cancer (e.g., any of the cancers described herein)) in the subject (e.g., any of the subjects described herein).
- a disease e.g., a cancer (e.g., any of the cancers described herein)
- treating results in reducing cancer growth, inhibiting cancer progression, inhibiting cancer metastasis, or reducing the risk of cancer recurrence in a subject having cancer.
- the CM comprises a substrate for a protease that is active, e.g., upregulated or otherwise unregulated, in a disease condition or diseased tissue.
- Exemplary disease conditions include, for example, a cancer (e.g., where the diseased tissue is a tumor tissue) and an inflammatory or autoimmune condition (e.g., where the diseased tissue is inflamed tissue).
- the CM comprises a substrate for an extracellular protease.
- the CM comprises a substrate for an intracellular protease.
- the CM is a substrate for an intracellular protease and an extracellular protease.
- the disease may be a cancer.
- the subject may have been identified or diagnosed as having a cancer.
- cancer examples include: solid tumor, hematological tumor, sarcoma, a leukemia (e.g., hairy cell leukemia, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL)), , stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, brain cancer, colon cancer, bone cancer, lung cancer, breast cancer, colorectal cancer, ovarian cancer, non-small cell lung carcinoma (NSCLC), squamous cell head and neck carcinoma, endometrial cancer, bladder cancer, cervical cancer, and liver cancer.
- a leukemia e.g., hairy cell leukemia, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL)
- the disease may be an autoimmune disease or condition.
- the subject may have been identified or diagnosed as having an autoimmune disease or condition or is at heightened risk of developing an autoimmune disease or condition.
- autoimmune diseases include Type 1 diabetes, Rheumatoid arthritis (RA), Psoriasis/psoriatic arthritis, Multiple sclerosis, Systemic lupus erythematosus, Inflammatory bowel disease (e.g., Crohn’s disease, ulcerative colitis), chronic inflammation, CYTX-083 or transplant rejection (e.g., in kidney, liver, or heart transplantation), autoimmune diseases, infectious disease, chronic inflammation, or transplant rejection.
- the disease is a cardiovascular disorder.
- the disease is a neurodegenerative disorder.
- the methods herein may result in a reduction in the number, severity, or frequency of one or more symptoms of the cancer in the subject (e.g., as compared to the number, severity, or frequency of the one or more symptoms of the cancer in the subject prior to treatment).
- the methods may further comprise administering to a subject one or more additional agents.
- the CM-containing polypeptides e.g., activatable molecules or conjugated polypeptides
- the polypeptide may be formulated into a single therapeutic composition, and the polypeptide and additional agent(s) may be administered simultaneously.
- polypeptide and additional agent(s) may be separate from each other, e.g., each is formulated into a separate therapeutic composition, and the polypeptide and the additional agent are administered simultaneously, or the polypeptide and the additional agent are administered at different times during a treatment regimen.
- the polypeptide may be administered prior to the administration of the additional agent, subsequent to the administration of the additional agent, or in an alternating fashion.
- the polypeptide and additional agent(s) may be administered in single doses or in multiple doses.
- One of more of the polypeptides herein may be co-formulated with, and/or co- administered with, one or more anti-inflammatory drugs, immunosuppressants, or metabolic or enzymatic inhibitors.
- one or more polypeptides herein may be combined with one or more polypeptides of other types.
- the present disclosure also provides methods of detecting presence or absence of a cleaving agent and/or the target in a subject or a sample.
- Such methods may comprise (i) contacting a subject or biological sample with an activatable molecule, wherein the activatable molecule includes a detectable label that is positioned on a portion of the activatable molecule that is released following cleavage of the CM and (ii) measuring a level of activated molecule in the subject or biological sample, wherein a detectable level of activated molecule in the subject or biological sample indicates that the cleaving agent, the CYTX-083 target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable molecule cannot be detected in the subject or biological sample, and wherein a reduced detectable level of activated molecule in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample.
- Such detection methods may be adapted to also provide for detection of the presence or absence of a target that is capable of binding the AM of the activatable molecules when cleaved.
- the assays can be adapted to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest.
- the presence or absence of the cleaving agent can be detected by the presence of and/or an increase in detectable label of the activatable molecules as described above, and the presence or absence of the target can be detected by detection of a target-AM complex e.g., by use of a detectably labeled anti-target antibody.
- activatable molecules are also useful in in situ imaging for the validation of activatable molecule activation, e.g., by protease cleavage, and binding to a particular target.
- In situ imaging is a technique that enables localization of proteolytic activity and target in biological samples such as cell cultures or tissue sections. Using this technique, it is possible to confirm both binding to a given target and proteolytic activity based on the presence of a detectable label (e.g., a fluorescent label).
- a detectable label e.g., a fluorescent label
- an activatable molecule may be labeled with a detectable label.
- the detectable label may be a fluorescent dye, (e.g. a fluorophore, Fluorescein Isothiocyanate (FITC), Rhodamine Isothiocyanate (TRITC), an Alexa Fluor® label), a near infrared (NIR) dye (e.g., Qdot® nanocrystals), a colloidal metal, a hapten, a radioactive marker, biotin and an amplification reagent such as streptavidin, or an enzyme (e.g. horseradish peroxidase or alkaline phosphatase).
- FITC Fluorescein Isothiocyanate
- TRITC Rhodamine Isothiocyanate
- Alexa Fluor® label Alexa Fluor® label
- NIR near infrared
- colloidal metal e.g., a hapten, a radioactive marker, biotin
- Detection of the label in a sample that has been incubated with the labeled, activatable molecule indicates that the sample contains the target and contains a protease that is specific for the CM of the activatable molecule.
- the presence of the protease can be confirmed using broad spectrum protease inhibitors such as those described CYTX-083 herein, and/or by using an agent that is specific for the protease, for example, an antibody such as A11, which is specific for the protease matriptase and inhibits the proteolytic activity of matriptase; see e.g., International Publication Number WO 2010/129609, published 11 November 2010.
- the same approach of using broad spectrum protease inhibitors such as those described herein, and/or by using a more selective inhibitory agent can be used to identify a protease that is specific for the CM of the activatable molecule.
- the presence of the target can be confirmed using an agent that is specific for the target, e.g., another antibody, or the detectable label can be competed with unlabeled target.
- unlabeled activatable molecule may be used, with detection by a labeled secondary antibody or more complex detection system.
- Similar techniques are also useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the activatable molecule. [0261] These techniques are also useful in kits and/or as reagents for the detection, identification or characterization of protease activity in a variety of cells, tissues, and organisms based on the protease-specific CM in the activatable molecule.
- a reduced level of detectable label may be, for example, a reduction of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or a reduction of substantially 100%.
- the detectable label may be conjugated to a component of the polypeptide, e.g., the AM.
- measuring the level of polypeptide in the subject or sample may be accomplished using a secondary reagent that specifically binds the activated protein, wherein the reagent comprises a detectable label.
- the secondary reagent may be an antibody comprising a detectable label.
- the CM-containing polypeptides may also be useful in the detection of the target in patient samples and accordingly are useful as diagnostics.
- the polypeptides may be used in in vitro assays, e.g., ELISA, to detect target levels in a patient sample.
- a polypeptide may be immobilized on a solid support (e.g., the well(s) of a microtiter plate). The immobilized polypeptide may serve as a capture protein for any target that may be present in a test sample.
- the solid support Prior to contacting the immobilized CYTX-083 polypeptide with a patient sample, the solid support may be rinsed and treated with a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte.
- a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte.
- the stage of a disease in a subject may be determined based on expression levels of the target protein (e.g., antigen). For a given disease, samples of blood may be taken from subjects diagnosed as being at various stages in the progression of the disease, and/or at various points in the therapeutic treatment of the disease.
- Polypeptides herein may also be used in diagnostic and/or imaging methods. In some embodiments, such methods may be in vitro methods. In some embodiments, such methods may be in vivo methods. In some embodiments, such methods may be in situ methods. In some embodiments, such methods may be ex vivo methods. For example, polypeptides having a CM may be used to detect the presence or absence of an enzyme capable of cleaving the CM.
- Such polypeptides may be used in diagnostics, which can include in vivo detection (e.g., qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased reduction potential such as that which can provide for reduction of a disulfide bond) through measured accumulation of activated antibodies (i.e., antibodies resulting from cleavage of a polypeptide) in a given cell or tissue of a given host organism.
- activated antibodies i.e., antibodies resulting from cleavage of a polypeptide
- Such accumulation of activated proteins indicates not only that the tissue expresses enzymatic activity (or an increased reduction potential depending on the nature of the CM) but also that the tissue expresses target to which the activated protein binds.
- the polypeptides may be used for detecting protease activity with an assay that does not rely on target binding, e.g., a quantitative ex vivo zymography (QZ) assay as described in Howng et al., “Novel Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies,” Pharmaceutics. 2021 Sep 2; 13(9):1390, which is incorporated by reference herein in its entirety.
- QZ quantitative ex vivo zymography
- the CM may be selected to be a protease substrate for a protease found at the site of a tumor, at the site of a viral or bacterial infection at a biologically confined site (e.g., such as in an abscess, in an organ, and the like), and the like.
- the AM may be one that binds a target protein (e.g., antigen).
- a CYTX-083 detectable label e.g., a fluorescent label or radioactive label or radiotracer
- Suitable detectable labels may be discussed in the context of the above screening methods and additional specific examples are provided below.
- polypeptides may exhibit an increased rate of binding to disease tissue relative to tissues where the CM specific enzyme is not present at a detectable level or is present at a lower level than in disease tissue or is inactive (e.g., in zymogen form or in complex with an inhibitor). Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non-disease tissues or is present in inactive conformation), accumulation of activated protein in the disease tissue may be enhanced relative to non-disease tissues.
- the CM-containing polypeptides may be useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the polypeptide.
- the in vivo imaging may be used to identify or otherwise refine a patient population suitable for treatment with a polypeptide of the disclosure. For example, patients that test positive for both the target and a protease that cleaves the substrate in the CM of the polypeptide being tested (e.g., accumulate activated proteins at the disease site) are identified as suitable candidates for treatment with such a polypeptide comprising such a CM.
- patients that test negative may be identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the polypeptide being tested).
- such patients that test negative with respect to a first polypeptide can be tested with other polypeptides comprising different CMs until a suitable polypeptide for treatment is identified (e.g., a polypeptide comprising a CM that is cleaved by the patient at the site of disease).
- in situ imaging may be useful in methods to identify which patients to treat.
- the polypeptides may be used to screen patient samples to identify those patients having the appropriate protease(s) and target(s) at the appropriate location, e.g., at a tumor site.
- in situ imaging is used to identify or otherwise refine a patient population suitable for treatment with a polypeptide of the disclosure. For example, patients that test positive for both the target and a protease CYTX-083 that cleaves the substrate in the CM of the polypeptide being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such a polypeptide comprising such a CM.
- patients that test negative for either or both of the target and the protease that cleaves the CM used in the polypeptide being tested using these methods are identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the polypeptide being tested).
- such patients that test negative with respect to a first polypeptide can be tested with other polypeptides comprising different CMs until a suitable polypeptide for treatment is identified (e.g., a polypeptide comprising a CM that is cleaved by the patient at the site of disease).
- a suitable polypeptide for treatment e.g., a polypeptide comprising a CM that is cleaved by the patient at the site of disease.
- an isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence selected from HQSRS (SEQ ID NO: 2), HQSR (SEQ ID NO: 1), AQSRS (SEQ ID NO: 160), or HQSKS (SEQ ID NO: 66), wherein the CM is a substrate for a protease.
- the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule.
- cleavage of the CM by a protease activates the molecule.
- the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM.
- the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
- the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo.
- the isolated polypeptide is a molecule comprising a CM that has a CYTX-083 k cat /K M (M -1 s -1 ) of greater than 2.5 x 10 4 M -1 s -1 .
- the isolated polypeptide is a molecule comprising a CM that has a k cat /K M (M -1 s- 1 ) of greater than 1 x 10 4 M -1 s -1 .
- Statement 2. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence HQSRSG (SEQ ID NO: 3).
- Statement 3. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence SHQSRS (SEQ ID NO: 4).
- Statement 6. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence SDHQSRS (SEQ ID NO: 7).
- Statement 7. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence selected from SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease.
- the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule.
- the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM.
- the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
- the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50% in the presence of MT-SP1 (see Example 2). In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CYTX-083 CM is at least 70% and up to 100% in the presence of MT-SP1. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is up to 100% in the presence of TMPRSS11.
- the isolated polypeptide is a molecule in which the % cleavability of the CM is improved by 3x, 5x, 7x, 8x, or 10x or more over the % cleavability of SEQ ID NO: 78 (see, e.g., Example 2).
- the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo.
- the isolated polypeptide is a molecule comprising a CM that has a kcat/KM (M -1 s -1 ) of greater than 2.5 x 10 4 M -1 s -1 .
- Statement 8 The isolated of any one of Statements 1-7, wherein the isolated polypeptide is an and further comprises an active moiety (AM) that specifically binds a target.
- the isolated polypeptide may be an activatable molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo.
- the isolated polypeptide may be an activatable molecule that has masking efficiency of 25x, 40x, 41x, 50x, 75x, 100x, 150x, 200x, or higher.
- the activatable molecule may be activated by one, two, or all of TMPRSS11, MT-SP1, and plasmin.
- the activatable molecule may be activated to an extent of having a cleavability percentage of at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
- the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is at least 70% and up to 100% in the presence of MT-SP1. In some aspects, the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is up to 100% in the presence of TMPRSS11. In some aspects, the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is improved by 3x, 5x, 7x, 8x, or 10x or more over the % cleavability of SEQ ID NO: 78 (see Example 2).
- the activatable molecule exhibits attenuated binding to a target as compared to the binding of a counterpart “activated” molecule comprising the same active moiety (AM) to the same target.
- AM active moiety
- CYTX-083 [0278] Statement 9. The isolated polypeptide of Statement 8, wherein the AM is an antibody or antigen-binding fragment thereof.
- the isolated polypeptide of Statement 8, wherein the AM is a therapeutic macromolecule.
- Statement 12. The isolated polypeptide of Statement 8, wherein the AM is a cytokine.
- Statement 13. The isolated polypeptide of Statement 8, wherein the AM is a chimeric antigen receptor.
- Statement 14. The isolated polypeptide of any one or combination of Statements 8-13, wherein the AM is coupled to the CM.
- Statement 15. The isolated polypeptide of Statement 14, wherein the AM is directly coupled to the CM.
- Statement 16 The isolated polypeptide of Statement 14, wherein the AM is indirectly coupled to the CM via a linking peptide.
- the MM interferes with AM’s binding to its binding partner through non-specific interactions such as steric hindrance, optionally wherein the MM is positioned in the activatable molecule such that the tertiary or quaternary structure of the activatable molecule allows the MM to mask the AM through charge-based interaction, optionally wherein the MM is an albumin, e.g., human serum albumin (HSA), a fragment crystallizable (Fc) domain, an antibody constant domain (e.g., CH domains), a polymer (e.g., branched or multi-armed polyethylene glycol CYTX-083 (PEG)), a latency associated protein (LAP), and any polypeptide or other moieties that sterically interfere AM-target interactions, optionally wherein the MM may recruit a large protein binding partner that sterically interfere AM-target interactions, optionally wherein the MM is an antibody or a fragment thereof that binds to an albumin, optionally wherein the MM is an antibody
- Statement 21 The isolated polypeptide of any one or combination of Statements 17-20, wherein the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM- CM-MM.
- Statement 22 The isolated polypeptide of Statement 21, wherein the MM is coupled directly to the CM.
- Statement 23 The isolated polypeptide of Statement 21, wherein the MM is coupled indirectly to the CM via a linking peptide.
- Statement 24 The isolated polypeptide of any one or combination of Statements 17-20, wherein the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM- CM-MM.
- Statement 25 The isolated polypeptide of Statement 24, wherein the LP1 and LP2 are not identical to each other.
- Statement 26 The isolated polypeptide of Statement 24, wherein the LP1 and LP2 are identical to each other.
- Statement 27 The isolated polypeptide of any one of Statements 24-26, wherein each of LP1 and LP2 is a peptide of 1 to 20 amino acids in length.
- Statement 28 The isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for a serine protease, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1 and TMPRSS11, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for plasmin and TMPRSS11, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1 and plasmin, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1, plasmin, and TMPRSS
- Statement 29 The isolated polypeptide of Statement 28, wherein the serine protease is membrane type serine protease 1 (MT-SP1).
- Statement 30 The isolated polypeptide of Statement 29, wherein the k cat /K M of the CM by MT-SP1 cleavage is at least 1 x 10 3 M -1 s -1 , optionally where k cat /K M of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20.
- Statement 31 The isolated polypeptide of Statement 29, wherein the k cat /K M of the CM by MT-SP1 cleavage is at least 1 x 10 3 M -1 s -1 , optionally where k cat /K M of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20.
- CM cleavable moiety
- Statement 41 An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with two-amino acid mutations in any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease.
- CM cleavable moiety
- Statement 43 An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with four-amino acid mutations of any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease.
- Statement 45 A polypeptide complex comprising one or more of the isolated polypeptide of any one or combination of Statements 1-46.
- CYTX-083 A conjugated polypeptide comprising the isolated polypeptide of any one or combination of Statements 1-45 conjugated to an agent.
- Statement 47 The conjugated polypeptide of Statement 46, wherein the agent is conjugated to the isolated polypeptide via a conjugating linker.
- Statement 48 The conjugated polypeptide of Statement 47, wherein the conjugating linker is cleavable.
- Statement 49 The conjugated polypeptide of Statement 47, wherein the conjugating linker is non-cleavable.
- Statement 50 The conjugated polypeptide of Statement 48, wherein the conjugating linker comprises an amino acid sequence selected from SEQ ID NOs: 1-74 and 160. [0320] Statement 51.
- Statement 52 The composition of Statement 52 or 53, comprising an additional agent.
- Statement 55 The composition of Statement 54, wherein the additional agent is a therapeutic agent.
- Statement 56 An isolated nucleic acid molecule encoding the isolated polypeptide of any one or combination of Statements 1-44.
- Statement 57 A vector comprising the isolated nucleic acid molecule of Statement 58.
- Statement 58 A cell comprising the isolated polypeptide of any one or combination of Statements 1-44 or the isolated nucleic acid molecule of Statement 56 or the vector of Statement 57.
- CYTX-083 [0328] Statement 59.
- a method of manufacturing an isolated polypeptide or an activatable molecule that contains a cleavable moiety comprising expressing and recovering a polypeptide comprising the isolated polypeptide of any one or combination of Statements 1-44, optionally wherein the polypeptide is an activatable molecule.
- a method of treating, alleviating a symptom of, or delaying the progression of a disease or disorder in a subject comprising administering a therapeutically effective amount of the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 to the subject.
- Statement 60 wherein the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder.
- Statement 62 A kit comprising the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52- 55.
- Statement 63 The use of the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52-55 for the manufacture of a medicament for the treatment of a disease or disorder.
- Statement 64 The use of Statement 63, wherein the disease or disorder is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder.
- Statement 65 A method of detecting or diagnosing a disease or health condition in a subject, comprising: contacting the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52-55 with a sample from the subject; and measuring a level of cleavage of the isolated polypeptide, thereby detecting or diagnosing the disease or health condition in the subject.
- the exemplary activatable antibodies include an antibody or antigen binding fragment thereof (AB) that is based on a mouse/human chimeric monoclonal antibody that specifically binds epidermal growth factor receptor (EGFR).
- the exemplary activatable antibodies also include a prodomain coupled to the N-terminus of the light chain of the AB.
- Each prodomain includes a masking moiety (MM) and a cleavable moiety (CM), and the CM includes at least one MT- SP1 substrate sequence of Table 4.
- Table 4 Exemplary CMs with Matriptase (MT-SP1) Substrates Name Sequence SEQ ID NO: 6001 HQSRS 2
- Table 5 Exemplary Activatable Antibodies Molecule Light chain Light chain CM Protein description N m EGFR M k (Li ht h in / H y CYTX-083 CX-229 CISPRGCLDGPYVMY 3001 C225v539543001 (SEQ ID NO: 82) (SEQ ID NO: 79) (SEQ ID NO: 89/ SEQ ID NO 84
- EXAMPLE 2 In Vitro Cleavability of Activatable Antibodies with Exemplary CMs [0338] The studies provided herein evaluate the in vitro cleavability of activatable antibodies containing exemplary CMs cleavable by a matriptase (MT-SP1).
- Protease concentrations were determined by active site titration. Activity assays were performed in the following buffer 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20. Following incubation, the presence of cleavage product was determined by capillary electrophoresis for each protease enzyme using a LabChip GXII Touch system (Perkin Elmer), or by capillary electrophoresis immunoassay for each protease enzyme using the Wes TM Western Blot instrument (Protein Simple). For capillary electrophoresis assays, the HT Protein Express 100 protocol (Perkin Elmer) was used.
- LabChip GXII Touch HT Chips (Perkin Elmer #760499) were set up using the protocol of the Protein Express Assay Reagent Kit (Perkin Elmer #CLS960008).
- the fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the LabChip GX Reviewer software (Perkin Elmer).
- the A110UK goat anti-human IgG antibody American Qualex
- an anti-goat secondary CYTX-083 antibody Jackson ImmunoResearch
- the fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the Compass software (Protein Simple).
- the fraction of activatable antibody, and hence the CM that is cleaved by each particular protease, is presented as a “cleavability percentage” in Tables 6A and 6B.
- the results in Table 6A indicate that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) were each substantially cleaved by MT-SP1 (as compared to control CM 2001).
- CM 6006 SEQ ID NO: 7
- CM 6001 SEQ ID NO: 2
- CM 6001 SEQ ID NO: 2
- a second study the cleavability with matriptase, TMPRSS11 and plasmin was determined.
- CM 6006 SEQ ID NO: 7
- CM 6001 SEQ ID NO: 2
- Table 6B CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) were cleaved by matriptase, plasmin, and TMPRSS11 to a greater extent than the control CM 2001.
- Table 6A In Vitro Activation of Activatable Antibodies with Exemplary CMs Cleavability (%) CM of Activatable Antibody CM MT-SP1 lary CMs CM of Cleavability (%) Activatable CM MT-SP1 Plasmin TMPRSS11
- Table 6C In Vitro Activation of Activatable Antibodies with Exemplary CMs CM of k cat /K M (M -1 s -1 ) k cat /K M (M -1 s -1 ) Activatable CM CYTX-083
- EXAMPLE 3 In Vivo Stability of Activatable Antibodies with Exemplary CMs [0347] The study provided herein evaluates the in vivo stability of activatable antibodies of the present disclosure with the exemplary CMs 6006 (SEQ ID NO: 7) and 6001 (SEQ ID NO: 2).
- This exemplary study measured the stability of activatable antibodies containing the exemplary CMs by administering a dose of the activatable antibodies to mice, and then measuring the cleaved activatable antibody in the plasma by capillary electrophoresis immunoassay. The stability was compared to the activatable antibody with control CM 2001 (SEQ ID NO: 78).
- nu/nu mice of about 7-8 weeks of age were administered intraperitoneally with the indicated test article at a dosage of 10 mg/kg. After 7 days following the administration, terminal blood was collected by cardiac puncture and processed to plasma within 1 hour of collection. The collected sample was diluted 1:50 in phosphate-buffered saline solution and denatured.
- the sample was analyzed using the Wes TM Western Blot instrument (Protein Simple) with the A110UK goat anti-human IgG antibody (American Qualex) and an anti-goat secondary antibody (Jackson ImmunoResearch).
- the fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the Compass software (Protein Simple).
- the results of these exemplary assays are summarized in Table 7. [0350] These exemplary results showed that activatable antibodies with CMs 6001 (SEQ ID NO: 2) and 6006 (SEQ ID NO: 7) demonstrated a higher in vivo stability than the activatable antibody with the control CM 2001 (SEQ ID NO: 78).
- H292 human lung cancer-derived cell line
- H292 cell line is responsive to the anti-EGFR antibody cetuximab.
- the mice were then randomized into groups of 8 mice each and each group was dosed intraperitoneally on day 1 with 9 mg/kg of the indicated test article.
- the mean tumor volume ⁇ SEM was plotted for each time point following administration of the test article, as shown in FIG. 2A.
- CM 6006 SEQ ID NO: 7
- CM 2001 SEQ ID NO: 78
- cetuximab or immunoglobulin (IVIG) control cetuximab or immunoglobulin (IVIG) control.
- CYTX-083 An intra-tumoral activation assay was performed using the indicated activatable antibodies as shown in FIG. 2B. Tumors were collected from the mice 7 days after dosing. The tumor tissue was lysed with immunoprecipitation buffer (Pierce) containing HALT protease inhibitor cocktail (Thermo Fisher) and EDTA and lysed using the Barocycler (Pressure Bioscience).
- the sample was analyzed using the Wes TM Western Blot instrument (Protein Simple) with the A110UK goat anti-human IgG antibody (American Qualex) and an anti-goat secondary antibody (Jackson ImmunoResearch).
- the fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody.
- the results of these exemplary assays are summarized in FIG.2B.
- the activatable antibody comprising CM 6006 demonstrated an in vivo efficacy that is comparable with the activatable antibody with the control CM 2001 (SEQ ID NO: 78) and similar to cetuximab, which lacks a prodomain.
- the activatable antibody with CM 6006 was cleaved by proteases present in the tumor resulting in activation of the antibody.
- EXAMPLE 6 In situ Stability of Anti-EGFR Activatable Antibodies in Human Bone Marrow Aspirates [0359] The study provided herein evaluates the in situ stability of activatable antibodies of the present disclosure with the CM 6006 (SEQ ID NO: 7) by human bone marrow aspirates. Fresh human bone marrow aspirates from healthy donors were purchased from Stemcell Technology Inc. (Catalog No.70502) and AllCells Inc. and were processed to lyse red blood cells and washed 5 times with buffer or serum-free media.
- the cells were plated at a density of 250,000 cells per well in serum-free RPMI media and incubated for 30 min at room temperature with an equal volume of 80 ⁇ g/mL unmasked control c225v5 antibody prepared in serum-free RPMI media.
- An equal volume of AF647-labeled c225 activatable antibodies prepared at 40 ⁇ g/mL in serum-free RPMI media were then added to form a mixture and incubated at a final concentration of 20 ⁇ g/mL at 37 o C for 21 or 24 hours. Cells were pelleted through centrifugation for 5 min at 300 x g.
- Protein Express Assay LabChips (Perkin Elmer #760499) were set up using the protocol of the Protein Pico Assay Reagent Kit (Perkin Elmer #760498).
- CM 6006 demonstrated a resistance to cleavage in situ in the bone marrow as compared to activatable antibodies with control CMs 2001 (SEQ ID NO: 78), 5007 (APRSALAHGLF; SEQ ID NO: 80)(WO2020118109) and 3001 (AVGLLAPPGGLSGRSDNH, SEQ ID NO: 79)(WO2016118629).
- EXAMPLE 7 Evaluation of Protease Activity in Patient-Derived Tumor Samples [0361] Protease activities in patient-derived tumor samples were evaluated using the quantitative zymography (QZ) assay. See Howng, B. et al.
- a hydrophobic barrier was drawn around the tissue sample to maintain liquid on the tissue using an ImmEdge Hydrophobic Barrier Pen (Vector Laboratories), and the slides were then incubated with 40 ⁇ g/mL unmasked control c225v5 antibody in buffer consisting of 150 mM Tris HCl pH 7.4, 5 mM CaCl 2 100 ⁇ M ZnCl 2 , and 0.005% Tween-20 (QZ assay buffer) for 30 minutes at room temperature.
- Each supernatant sample was mixed with Pico Sample Buffer (Perkin Elmer) containing 2-beta-mercaptoethanol at four parts sample and one part of Pico Sample Buffer and then heated at 95°C for 10 minutes.
- the composition of each supernatant sample was then assessed using the LabChip GXII Touch (Perkin Elmer) with the HT Pico Protein Express 100 protocol (Perkin Elmer). Protein Express Assay LabChips (Perkin Elmer #760499) were set up using the protocol of the Protein Pico Assay Reagent Kit (Perkin Elmer #760498).
- the fraction of cleaved activatable antibody in the tumor tissue supernatants was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the LabChip GX Reviewer software (Perkin Elmer).
- LC light chain
- CM 6006 SEQ ID NO: 7
- control CM 3001 SEQ ID NO: 79
- Comparable levels of LC activation are observed for activatable antibodies with CM 6006 and control CM 5007 (SEQ ID NO: 80) across the three tumor tissues.
- EXAMPLE 8 In Vitro Cleavability of Exemplary CMs in a Peptide Probe Cleavage Assay [0365] The study provided herein evaluated the cleavability kinetics (i.e., pM/s and k cat /K M (M -1 s -1 )) of CMs with membrane type serine protease 1 (MT-SP1). The CMs listed in Table 9 below were presented in an internally quenched peptide probe format, rather than included in an activatable antibody format.
- the CM sequence was positioned between a 7-methoxycoumarin-4-acetyl (MCA) fluorophore and a 2,4-dinitrophenyl (DNP) quencher such that cleavage of the CM sequence produced a fluorescence signal.
- MCA 7-methoxycoumarin-4-acetyl
- DNP 2,4-dinitrophenyl
- the probes were of the following designs: (MCA)-Gly-Ser-His-Gln-Ser- X 1 -X 2 -Gly-Ser-Lys(DNP)-D-Arg (SEQ ID NO: 161) where X 1 is Arg or Lys and X 2 is Ser, and (MCA)-Gly-Ser-His-Gln-Ser-X1-Gly-Gly-Ser-Lys(DNP)-D-Arg (SEQ ID NO: 162) where X 1 is Arg, as indicated in Table 9.
- the cleavage rates (pM/s) were measured using 20 ⁇ M internally quenched peptide probe and 20 nM MT-SP1.
- Cleavability kinetics (i.e., pM/s and k cat /K M (M -1 s -1 )) were determined in 96- or 384-well plate format at 37oC in 50 mM TRIS- HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20 on an Infinite 200 PRO (Tecan) multimode CYTX-083 plate reader using a fluorescence excitation wavelength of 320 nm and an emission wavelength of 405 nm.
- Table 9 CMs tested in peptide format Sequence SEQ ID NO: HQSRS 2 [0366] plary CMs of Table 9 with MT-SP1.
- Table 11 provides exemplary k cat /K M (M -1 s -1 ) values of the exemplary CMs of Table 9 with MT-SP1.
- Table 10 In Vitro Activation of Peptide Probes with Exemplary CMs (pM/s) Probe CM Sequence Probe Cleavage (pM/s) MT-SP1 Table 11.
- CMs HQSRS SEQ ID NO: 2
- HQSR SEQ ID NO: 1
- HQSKS SEQ ID NO: 66
Abstract
Isolated polypeptides that include a cleavable moiety that is a substrate for at least one protease (e.g., MT-SP1) are disclosed. Activatable molecules including the isolated polypeptides are disclosed. Methods of making and using the isolated polypeptides and activatable molecules including the isolated polypeptides in a variety of therapeutic, diagnostic, and prophylactic applications are disclosed.
Description
CYTX-083 PROTEASE-CLEAVABLE MOIETIES AND METHODS OF USE THEREOF CROSS-REFERENCE TO RELATED APPLICATIONS [0001] This application claims the priority benefit of U.S. provisional application no. 63/370,020 filed August 1, 2022, the contents of which are incorporated herein in their entireties by reference thereto. SEQUENCE LISTING [0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on July 25, 2023 is named CYTX-083-PCT_SL.xml and is 150,801 bytes in size. TECHNICAL FIELD [0003] The present disclosure generally relates to polypeptides that include a cleavable moiety that is a substrate for at least one protease (e.g., MT-SP1), and to methods of making and using the polypeptides and activatable molecules in a variety of therapeutic, diagnostic, and prophylactic applications. BACKGROUND [0004] Proteases are enzymes that catalyze the hydrolysis of peptide bonds between amino acid residues. Some proteases are known to break specific peptide bonds based on the presence of a particular amino acid sequence within a protein. Proteases occur naturally in all organisms and are involved in a variety of physiological reactions from simple degradation to highly regulated pathways. Some proteases break specific peptide bonds based on the presence of a particular amino acid sequence within a protein while some amino acid sequences are resistant to cleavage by particular proteases. [0005] Accordingly, there exists a need to identify new substrates for proteases and to use these substrates in a variety of therapeutic, diagnostic and prophylactic applications. SUMMARY OF THE INVENTION [0006] In one aspect, the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of HQSRS (SEQ ID NO: 2), wherein the cleavable moiety is a substrate for a protease. In one aspect, the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that
CYTX-083 comprises the amino acid sequence of HQSR (SEQ ID NO: 1), wherein the cleavable moiety is a substrate for a protease. In one aspect, the histidine residue of SEQ ID NO: 2 may be substituted with an alanine residue. Accordingly, the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of AQSRS (SEQ ID NO: 160), wherein the cleavable moiety is a substrate for a protease. In one aspect, the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) that comprises the amino acid sequence of HQSKS (SEQ ID NO: 66), wherein the cleavable moiety is a substrate for a protease. [0007] In some embodiments, the CM comprises the amino acid sequence of SEQ ID NOs: 1-74 and 160. In some embodiments, the CM comprises the amino acid sequence of HQSRSG (SEQ ID NO: 3). In some embodiments, the CM comprises the amino acid sequence of SHQSRS (SEQ ID NO: 4). In some embodiments, the CM comprises the amino acid sequence of HQSRSA (SEQ ID NO: 5). In some embodiments, the CM comprises the amino acid sequence of DHQSRS (SEQ ID NO: 6). In some embodiments, the CM comprises the amino acid sequence of SDHQSRS (SEQ ID NO: 7). In some embodiments, the CM comprises the amino acid sequence of AQSRS (SEQ ID NO: 160). [0008] According to the present disclosure, the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule. In some aspects of the present disclosure, cleavage of the CM by a protease activates the molecule. In some aspects, the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin. According to the present disclosures, the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than
CYTX-083 25% in vivo activation following 7 days of administration in vivo. According to embodiments of the present disclosures, the isolated polypeptide is a molecule comprising a CM that has a kcat/KM (M-1s-1) of greater than 2.5 x 104 M-1 s-1. According to embodiments of the present disclosures, the isolated polypeptide is a molecule comprising a CM that has a kcat/KM (M-1s- 1) of greater than 1 x 104 M-1 s-1. [0009] In some embodiments, the isolated polypeptide is an activatable molecule and further comprises an “active moiety” (AM) that specifically binds a target. In some embodiments, the AM is a therapeutic macromolecule. In some embodiments, the AM is an antibody or antigen-binding fragment thereof. In some embodiments, the antibody is a full- length antibody. In some embodiments, the antigen-binding fragment is a monoclonal antibody, single chain antibody, Fab fragment, F(ab')2 fragment, single-chain variable fragment (scFv), diabody (a noncovalent dimer of scFv), single chain antibody (scab), a VHH, a domain antibody (dAb) or single domain antibody (nanobody, e.g., single domain heavy chain antibody, single domain light chain antibody). In some embodiments, the antibody is a monoclonal antibody, single chain antibody, Fab fragment, F(ab')2 fragment, single-chain variable fragment (scFv), diabody (a noncovalent dimer of scFv), single chain antibody (scab), a VHH, a domain antibody (dAb) or single domain antibody (nanobody, e.g., single domain heavy chain antibody, single domain light chain antibody). According to some embodiments of the present disclosures, the isolated polypeptide is an activatable molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo (e.g., as exemplified in Example 3). According to some embodiments of the present disclosures, the isolated polypeptide is an activatable molecule that has masking efficiency of 25x, 40x, 41x, 50x, 75x, 100x, 150x, 200x, or higher (e.g., as exemplified in Example 4). According to the present disclosures, the activatable molecule is activated by one, two, or all of TMPRSS11, MT-SP1, and plasmin. According to the present disclosures, the activatable molecule is activated to an extent of having a cleavability percentage of at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT- SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin.
CYTX-083 [0010] In some embodiments, the AM is a cytokine. In some embodiments, the AM is a chimeric antigen receptor. In some aspects, the AM is a drug or agent, e.g., a therapeutic, imaging, or diagnostic agent. [0011] In some embodiments, the AM is coupled to the CM. In some embodiments, the AM is directly coupled to the CM. In some embodiments, the AM is indirectly coupled to the CM via a linking peptide. In some embodiments, the AM is indirectly coupled to the CM via one or more components of the activatable protein. [0012] In some embodiments, the isolated polypeptide further comprises a masking moiety (MM). In some embodiments, the MM has a dissociation constant for binding to the AM that is greater than a dissociation constant of the AM for binding to the target. In some embodiments, the MM does not interfere or compete with the AM for binding to the target in in the activated molecule (i.e., following cleavage of the CM by a protease). In some embodiments, the MM is 2 to 40 amino acids in length. In some embodiments, the MM does not bind the AM, but still interferes with AM’s binding to its binding partner through non- specific interactions. In some embodiments, the MM is a steric mask. In some embodiments, the MM is a protein. In some embodiments, the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM-CM-MM. In some embodiments, the MM is coupled directly to the CM. [0013] In some embodiments, the MM is coupled indirectly to the CM via a linking peptide. In some embodiments, the isolated polypeptide comprises a linking peptide (LP) and wherein the isolated polypeptide has a structural arrangement from N-terminus to C-terminus as follows: MM-LP-CM-AM or MM-CM-LP-AM. In some embodiments, the isolated polypeptide comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the isolated polypeptide has a structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM-LP2-AM or AM-LP2-CM-LP1-MM. In some embodiments, the LP1 and LP2 are not identical to each other. In some embodiments, the LP1 and LP2 are identical to each other. In some embodiments, each of LP1 and LP2 is a peptide of 1 to 20 amino acids in length. [0014] In general, in each embodiment herein, unless otherwise stated, a polypeptide may comprise one or more optional linkers between each of the elements listed, and such linkers
CYTX-083 may be 1 to 30, 6 to 29, 7 to 28, 8 to 27, 9 to 26, 10 to 25, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or 27 amino acids in length. [0015] In some embodiments, the CM is a substrate for a serine protease. In some embodiments, the kcat/KM of the CM by MT-SP1 cleavage is at least 1 × 102 M-1s-1. In some embodiments, the kcat/KM of the CM by MT-SP1 cleavage is at least 1 × 103 M-1s-1. In some embodiments, the kcat/KM of the CM by MT-SP1 cleavage is at least 1 × 104 M-1s-1. [0016] In some embodiments, the serine protease is TMPRSS11. In some embodiments, the kcat/KM of the CM by TMPRSS11 cleavage is at least 1 x 103 M-1s-1. In some embodiments, the kcat/KM of the CM by TMPRSS11cleavage is at least 1 x 104 M-1s-1. [0017] In some embodiments, the CM is resistant to cleavage in situ in human bone marrow tissue, e.g., bone marrow aspirate. [0018] In some embodiments, the CM is resistant to cleavage in vivo in human bone marrow tissue, e.g., bone marrow aspirate. [0019] In another aspect, the present disclosure provides an isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with one-amino acid or two-amino acid mutation(s) of any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. For example, the mutations may include substitution between any one of lysine, arginine, and histidine residues. In certain aspects, the present disclosure may include substitution of any arginine in the disclosed sequences with a lysine. In other aspects, the present disclosure also includes substitution of any arginine in the disclosed sequences with an amino acid that is not lysine. For example, the mutations may include substitution between any one of alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan residues. For example, the mutations may include substitution between any one of glycine, asparagine, glutamine, cysteine, serine, threonine, and tyrosine residues. For example, the mutations may include substitution between any one of arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine residues. For example, the mutations may include substitution between any one of alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine residues. For example, the mutations may include substitution between any one of serine and threonine residues. For example, the mutations may include substitution between any one of asparagine and glutamine residues. For example, the mutations may include substitution between any one of alanine, valine, leucine and isoleucine residues. For
CYTX-083 example, the mutations may include substitution between any one of phenylalanine, tryptophan, and tyrosine residues. [0020] In another aspect, the present disclosure provides a polypeptide complex comprising one or more of the isolated polypeptides comprising the CMs disclosed herein. In some aspects, the complex comprises one or more of the isolated polypeptides of the present disclosure bound to a second isolated polypeptide, e.g., via protein-protein affinity interactions, hydrophobic interactions, disulfide linkage(s), cross-link(s), covalent bond(s), chemical linkage(s), or any other type of binding between two polypeptides. [0021] In another aspect, the present disclosure provides a conjugated polypeptide comprising the isolated polypeptide herein conjugated to an agent. In some embodiments, the agent is conjugated to the AM via a conjugating linker. In some embodiments, the conjugating linker is cleavable. In some embodiments, the conjugating linker is non-cleavable. In some embodiments, the conjugating linker comprises an amino acid sequence selected from SEQ ID NOs: 1-74 and 160. In some embodiments, the agent is a toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof. [0022] In another aspect, the present disclosure provides a composition comprising the isolated polypeptide, the polypeptide complex, or the conjugated polypeptide herein, and a carrier. In some embodiments, the carrier is a pharmaceutically acceptable carrier. In some embodiments, the composition comprises an additional agent. In some embodiments, the additional agent is a therapeutic, imaging, or diagnostic agent. [0023] In each of the foregoing embodiments, and unless otherwise stated, the polypeptide may comprise, e.g., one or more optional linkers between each of the elements listed. In some embodiments, a linker is a peptide having a length of 5 to 30, 6 to 29, 7 to 28, 8 to 27, 9 to 26, 10 to 25, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 amino acids. In the disclosed structural arrangements in the foregoing paragraphs and throughout this disclosure, one or more linkers may optionally be present between the elements. Further, this disclosure also contemplates and includes activatable proteins in which any one or more of the disclosed elements optionally directly abut each other such that there are no linkers or other amino acid sequences between the elements. [0024] In another aspect, the present disclosure provides an isolated nucleic acid molecule encoding the isolated polypeptide herein.
CYTX-083 [0025] In another aspect, the present disclosure provides a vector comprising the isolated nucleic acid molecule herein. [0026] In another aspect, the present disclosure provides a cell comprising the isolated nucleic acid molecule or the vector herein. [0027] In another aspect, the present disclosure provides a method of manufacturing an activatable molecule that contains a cleavable moiety (CM), the method comprising expressing and recovering a polypeptide comprising the isolated polypeptide herein. [0028] In another aspect, the present disclosure provides a method of treating, alleviating a symptom of, or delaying the progression of a disease or disorder in a subject, comprising administering a therapeutically effective amount of the isolated polypeptide, the polypeptide complex, the conjugated polypeptide, or the composition herein to the subject. In some embodiments, the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. [0029] In another aspect, the present disclosure provides a method of detecting or diagnosing a disease or health condition in a subject, comprising: contacting the isolated polypeptide, the polypeptide complex, the conjugated polypeptide, or the composition herein with a sample from the subject; and measuring a level of cleavage of the isolated polypeptide, thereby detecting or diagnosing the disease or health condition in the subject. In some embodiments, the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. BRIEF DESCRIPTION OF THE DRAWINGS [0030] An understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention may be utilized, and the accompanying drawings of which: [0031] FIG. 1 is a graph showing the in vitro masking efficiency of an exemplary anti- EGFR activatable antibody of the present disclosure. These exemplary results show that the substrate affected the masking efficiency of the prodomain of the activatable antibody. [0032] FIG. 2A shows the effects of exemplary activatable antibodies on tumor regression in mice. The mean tumor volume ± SEM was plotted for each measured time point following administration of the exemplary activatable antibodies with cetuximab or
CYTX-083 immunoglobulin (IVIG) controls. FIG. 2B shows intra-tumoral activation of the activatable antibodies. [0033] FIG.3 shows in situ stability of exemplary activatable antibodies in human bone marrow aspirates. [0034] FIGs. 4A-4C show activation of exemplary activatable antibodies in patient- derived tumor samples (Head and Neck A in Fig.4A, Head and Neck B in Fig.4B, and TNBC in Fig.4C). DETAILED DESCRIPTION OF THE INVENTION [0035] Proteases play a critical role in the homeostasis of healthy tissues but are known to be dysregulated within diseases, including cancer and autoimmune disorders (Vasiljeva et al. “The multifaceted roles of tumor-associated proteases and harnessing their activity for prodrug activation,” Biol. Chem. 2019 Apr 22). This dysregulation of protease activity provides new opportunities for the development of protease-activatable therapeutic molecules, which are preferentially activated in the local tissue microenvironment. These therapeutics have demonstrated a greater therapeutic window and safety profile with less on- target toxicities occurring in healthy tissues. Hence, there is a need for identification of substrates that act as cleavage recognition sites for proteases that are found to be dysregulated in disease tissues. These substrates or cleavable moieties (CM) may have multiple cleavage sites for leveraging the activities of multiple disease-associated proteases. [0036] Understanding the substrate cleavage profile and using these substrates as tools for activation in a specific disease or cancer type will enable the development of new therapeutic protease-activatable molecules. Fine tuning the therapeutic-activatable molecules by using protease substrates with unique cleavage profiles will allow for treatment options for a broader spectrum of patients while offering an improved therapeutic index. For example, “omics” studies have demonstrated the distribution of numerous proteases across numerous cancer types and differences in the expression of the proteases compared to normal tissues (Gobin et al. “A pan-cancer perspective of matrix metalloproteases (MMP) gene expression profile and their diagnostic/prognostic potential,” BMC Cancer. 2019 Jun 14; 19(1):581), highlighting the need for appropriate cleavable moiety selection. For example, membrane type II transmembrane serine proteases, such as membrane type serine protease 1 (MT-SP1) shows great potential for protease-activatable antibody development (Howng, B. et al. “Novel
CYTX-083 Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies,” Pharmaceutics 2021, 13(9), 1390). The present inventors have recognized that transmembrane protease serine 11 (TMPRSS11), which are a family of serine proteases and promote cancer growth, also have great potential for the development of protease-activatable therapeutic and diagnostic molecules. [0037] The present disclosure provides polypeptides comprising a cleavable moiety (CM) that is a substrate for at least one protease, e.g., MT-SP1. In some embodiments, the CMs may be a substrate for a second protease such as a TMPRSS11 (e.g., TMPRSS11A, TMPRSS11B, TMPRSS11D, TMPRSS11E, or TMPRSS11F). In some examples, the CMs are substrates for MT-SP1 and a TMPRSS11D. In some aspects, the CMs herein are cleaved in a diseased tissue (e.g., tumor tissue) but less in a healthy tissue. These CMs are useful in a variety of therapeutic, diagnostic and prophylactic applications. In some embodiments, the CM-containing polypeptides are activatable molecules and further comprise an active moiety (AM) that specifically binds a target. For example, the AM may be a therapeutic protein, a therapeutic agent, an imaging agent, a diagnostic agent, an antibody or antigen-binding fragment, a cytokine, chimeric antigen receptor, or other molecules used in therapeutic and diagnostic applications. [0038] Also provided herein are related compositions, kits, nucleic acids, vectors, and recombinant cells, as well as related methods, including methods of using and methods of producing any of the CM-containing polypeptides described herein. DEFINITIONS [0039] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present disclosure; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. [0040] The terms “a” and “an” refer to one or more (i.e., at least one) of the grammatical object of the article. By way of example, “a cell” encompasses one or more cells.
CYTX-083 [0041] As used herein, the terms “about” and “approximately,” when used to modify an amount specified in a numeric value or range, indicate that the numeric value as well as reasonable deviations from the value known to the skilled person in the art. For example ± 20%, ± 10%, or ± 5%, are within the intended meaning of the recited value where appropriate. [0042] Concentrations, amounts, and other numerical data may be expressed or presented herein in a range format. It is to be understood that such a range format is used merely for convenience and brevity and thus should be interpreted flexibly to include not only the numerical values explicitly recited as the limits of the range, but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited. As an illustration, a numerical range of “about 0.01 to 2.0” should be interpreted to include not only the explicitly recited values of about 0.01 to about 2.0, but also include individual values and sub-ranges within the indicated range. Thus, included in this numerical range are individual values such as 0.5, 0.7, and 1.5, and sub-ranges such as from 0.5 to 1.7, 0.7 to 1.5, and from 1.0 to 1.5, etc. Furthermore, such an interpretation should apply regardless of the breadth of the range or the characteristics being described. Additionally, it is noted that all percentages are in weight, unless specified otherwise. [0043] In understanding the scope of the present disclosure, the terms “including” or “comprising” and their derivatives, as used herein, are intended to be open ended terms that specify the presence of the stated features, elements, components, groups, integers, and/or steps, but do not exclude the presence of other unstated features, elements, components, groups, integers and/or steps. The foregoing also applies to words having similar meanings such as the terms “including”, “having” and their derivatives. The term “consisting” and its derivatives, as used herein, are intended to be closed terms that specify the presence of the stated features, elements, components, groups, integers, and/or steps, but exclude the presence of other unstated features, elements, components, groups, integers and/or steps. The term “consisting essentially of,” as used herein, is intended to specify the presence of the stated features, elements, components, groups, integers, and/or steps as well as those that do not materially affect the basic and novel characteristic(s) of features, elements, components, groups, integers, and/or steps. It is understood that reference to any one of these transition terms (i.e. “comprising,” “consisting,” or “consisting essentially”) provides direct support for replacement to any of the other transition term not specifically used. For example, amending a term from “comprising” to “consisting essentially of” or “consisting of” would find direct
CYTX-083 support due to this definition for any elements disclosed throughout this disclosure. Based on this definition, any element disclosed herein or incorporated by reference may be included in or excluded from the claimed invention. [0044] As used herein, a plurality of compounds, elements, or steps may be presented in a common list for convenience. However, these lists should be construed as though each member of the list is individually identified as a separate and unique member. Thus, no individual member of such list should be construed as a de facto equivalent of any other member of the same list solely based on their presentation in a common group without indications to the contrary. [0045] The term “exemplary” is used herein to mean serving as an example, instance, or illustration. Any aspect or design described herein as “exemplary” is not necessarily to be construed as preferred or advantageous over other aspects or designs. Rather, use of the word exemplary is intended to present concepts in a more concrete fashion. [0046] Furthermore, certain molecules, constructs, compositions, elements, moieties, excipients, disorders, conditions, properties, steps, or the like may be discussed in the context of one specific embodiment or aspect or in a separate paragraph or section of this disclosure. It is understood that this is merely for convenience and brevity, and any such disclosure is equally applicable to and intended to be combined with any other embodiments or aspects found anywhere in the present disclosure and claims, which all form the application and claimed invention at the filing date. For example, a list of constructs, molecules, method steps, kits, or compositions described with respect to a construct, molecule, isolated polypeptide, activatable molecule, composition, or method is intended to and does find direct support for embodiments related to constructs, molecules, isolated polypeptides, activatable molecules, compositions, formulations, and methods described in any other part of this disclosure, even if those method steps, active agents, kits, or compositions are not re-listed in the context or section of that embodiment or aspect. [0047] The term “isolated polynucleotide” as used herein shall mean a polynucleotide of genomic, cDNA, RNA, mRNA, or synthetic origin or some combination thereof, which by virtue of its origin the “isolated polynucleotide” (1) is not associated with all or a portion of a polynucleotide in which the “isolated polynucleotide” is found in nature, (2) is operably linked to a polynucleotide which it is not linked to in nature, and/or (3) does not occur in nature as part of a larger sequence. In some embodiments, polynucleotides include the nucleic
CYTX-083 acid molecules encoding heavy chain immunoglobulin molecules, and nucleic acid molecules encoding light chain immunoglobulin molecules. [0048] The term “isolated polypeptide” as used herein refers a polypeptide that is present in a form other than that found in nature. An “isolated polypeptide” as used herein may be encoded by cDNA, recombinant RNA, messenger RNA, recombinant DNA, or a polynucleotide of synthetic origin or some combination thereof. By virtue of its origin, or source of derivation, the “isolated polypeptide” (1) is not in a naturally occurring organism (e.g., is not an endogenous polypeptide of a naturally occurring organism) and (2) is present in a form not found in nature. In some aspects, the “isolated polypeptide” is expressed by a cell from a different species. In some aspects, the “isolated polypeptide” is a therapeutic protein or a diagnostic protein and not a naturally occurring protein. For example, as used herein, the “isolated polypeptide” is not a plant protein or a protein naturally occurring in bacteria or other natural organisms. The term isolated polypeptide includes and provides support for activatable molecules including activatable macromolecules, activatable polypeptides, activatable antibodies, activatable cytokines, and the like. The term isolated polypeptide includes and provides support for activatable molecules in which cleavage of the CM activates the molecule. [0049] The term “polypeptide” is used herein as a generic term to refer to a native protein, fragments, or analogs of a polypeptide sequence. Hence, proteins, protein fragments, and analogs are species of the polypeptide genus. In some embodiments, polypeptides in accordance with the disclosure comprise the heavy chain immunoglobulin, and the light chain immunoglobulin molecules, as well as antibody molecules formed by combinations comprising the heavy chain immunoglobulin molecules with light chain immunoglobulin molecules, such as kappa light chain immunoglobulin molecules, and vice versa, as well as fragments and analogs thereof. [0050] As discussed herein, minor variations in the amino acid sequences of polypeptides are contemplated as being encompassed by the present disclosure, providing that the variations in the amino acid sequence maintain at least 75%, in some embodiments, at least 80%, at least 90%, at least 95%, and in some embodiments, at least 99% identity to the amino acid sequence that is not varied. In particular, conservative amino acid substitutions are contemplated. Conservative substitutions include those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids are
CYTX-083 generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. The hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine. The hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine. Other families of amino acids include (i) serine and threonine, which are the aliphatic- hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family. For example, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid will not have a major effect on the binding or properties of the resulting molecule, especially if the replacement does not involve an amino acid within a framework site. Whether an amino acid change results in a functional peptide can readily be determined by assaying the specific activity of the polypeptide derivative. Assays are described in detail herein. Fragments or analogs of antibodies or immunoglobulin molecules can be readily prepared by those of ordinary skill in the art. Suitable amino- and carboxyl- termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. In some embodiments, computerized comparison methods are used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known, e.g., as described in Bowie et al. Science 253:164 (1991). Thus, the foregoing examples demonstrate that those of skill in the art can recognize sequence motifs and structural conformations that may be used to define structural and functional domains in accordance with the disclosure. [0051] Suitable amino acid substitutions include those that: (1) alter susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (5) confer or modify other physicochemical or
CYTX-083 functional properties of such analogs. Analogs can include various muteins of a sequence other than the naturally-occurring peptide sequence. For example, single or multiple amino acid substitutions (for example, conservative amino acid substitutions) may be made in the naturally- occurring sequence (for example, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts. A conservative amino acid substitution should not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterizes the parent sequence). Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H. Freeman and Company, New York (1984)); Introduction to Protein Structure (C. Branden and J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and Thornton et at. Nature 354:105 (1991). [0052] The term “sample” is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term “sample,” therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph. [0053] The term “therapeutic macromolecule” refers to any protein or nucleic acid that may be administered to a subject and have a therapeutic effect. In some embodiments, the therapeutic macromolecule may be a therapeutic polynucleotide or therapeutic polypeptide, i.e., a polynucleotide or polynucleotide that may be used in therapy. [0054] As generally provided herein, an activatable molecule may comprise MM-CM construct(s), also referred to herein as a prodomain. Accordingly, as used herein, the term “prodomain” refers to a polypeptide domain comprising a masking moiety (MM) and a cleavable moiety (CM). In some embodiments, the MM and the CM are separated by a linker, referred to herein as LP1. In some embodiments, the prodomain comprises a linker (referred to herein as LP2) that links the CM of the prodomain to the active moiety (AM) in an activatable molecule. In some embodiments, the prodomain comprises a linker between the MM and the CM and a linker between the CM and the AM. In some embodiments, the MM and the CM are not separated by a linker. In certain embodiments, a prodomain comprises one of the following formulas (where the formulas below represent amino acid sequences in either N- to C-terminal direction or C- to N-terminal direction): MM-LP1-CM, MM-CM- LP2, MM-LP1-CM-LP2, or MM-CM. As used herein and unless otherwise stated, each dash
CYTX-083 (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linking peptides. CLEAVABLE MOIETIES [0055] Proteases are involved in the control of numerous physiological processes, and their dysregulation has been identified in a number of pathologies, such as, for example, oncological, cardiovascular, autoimmune, and neurodegenerative diseases. See, e.g., O. Vasiljeva, et al., “Monitoring protease activity in biological tissues using antibody prodrugs as sensing probes,” Scientific Reports, 10, 5894 (2020); O. Erster, et al., “Site-specific targeting of antibody activity in vivo mediated by disease-associated proteases,” J. Control Release, 161(3):804-812 (2012); and L. Desnoyers, et al., “Tumor-specific activation of an EGFR-targeting probody enhances therapeutic index,” Science Translational Medicine, 5(207):207ra144 (2013); B. Turk “Targeting proteases: successes, failures and future prospects” Nature Reviews Drug Discovery, 5 (2006). Protease-activated antibodies have been described in the literature that are activated by native proteases which are more prevalently active in, for example, tumor tissue, and the like, when compared to normal tissue. Id. These prodrugs have incorporated within their structure, a protease substrate that releases active drug following exposure to the appropriate protease and its subsequent cleavage. What appears evident, however, is that the profile of dysregulated protease activity in diseased tissue may differ from one type of disease tissue/disorder to another. Thus, it is desirable to have a collection of substrates that target a variety of different protease activity profiles. [0056] In some aspects, the present disclosure provides cleavable moieties that exhibit enhanced cleavability to membrane type serine protease 1 (MT-SP1). In certain aspects, the cleavable moieties are cleaved by a second protease, e.g., a TMPRSS11. In certain aspects, the cleavable moieties are selectively cleavable by certain proteases (e.g., MT-SP1 and/or TMPRSS11), but have reduced or no cleavability by another protease/s. For example, the cleavable moieties may be resistant or substantially resistant to cleavage in bone marrow tissue, e.g., bone marrow aspirate. In some aspects, resistance of cleavable moieties to protease cleavage in healthy tissue may reduce systemic toxicities by limiting binding of the activatable molecule to targets that also may be present in healthy tissues. Therefore, cleavable moieties with bone marrow tissue resistance have the potential to demonstrate a greater therapeutic window and safety profile with less on-target toxicities occurring in healthy tissues.
CYTX-083 [0057] In a specific aspect, the present disclosure provides polypeptides (e.g., isolated polypeptides) comprising a cleavable moiety (CM). A CM is a polypeptide that comprises a substrate for a sequence-specific protease. In some aspects, the present disclosure provides polypeptides and polypeptide complexes comprising a CM and an active moiety. [0058] In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 1. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 3. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 4. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 5. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 6. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 7. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 8. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 9. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 10. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 11. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 12. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 13. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 14. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 15. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 16. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 17. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 18. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 19. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 20. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 21. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 22. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 23. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 24. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 25. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 26. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 27. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 28. In some
CYTX-083 embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 29. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 30. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 31. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 32. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 33. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 34. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 35. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 36. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 37. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 38. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 39. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 40. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 41. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 42. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 43. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 44. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 45. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 46. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 47. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 48. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 49. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 50. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 51. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 52. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 53. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 54. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 55. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 56. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 57. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 58. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 59. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 60. In some
CYTX-083 embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 61. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 62. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 63. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 64. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 65. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 66. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 67. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 68. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 69. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 70. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 71. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 72. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 73. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 74. In some embodiments, the CM comprises the amino acid sequence of SEQ ID NO: 160. [0059] In some embodiments, the CM comprises a combination, a C-terminal truncation variant, a C-terminal extension variant, an N-terminal truncation variant, or an N-terminal extension variant of the amino acid sequences of any one of SEQ ID NOs: 1-74 and 160. Truncation variants of the aforementioned amino acid sequences that are suitable for use in a CM may be any that retain the recognition site for the corresponding protease. These include C-terminal and/or N-terminal truncation variants comprising at least 1, 2, 3, 4, 5, or more contiguous amino acids of the above-described amino acid sequences that retain a recognition site for a protease. In certain embodiments, the truncation variant comprises a C-terminal deletion and/or an N-terminal deletion of one amino acid residue from an amino acid sequence selected from the group consisting of SEQ ID NOs: 2-64. In other embodiments, the truncation variant comprises a C-terminal deletion and/or an N-terminal deletion of one amino acid residue from an amino acid sequence selected from the group consisting of SEQ ID Nos: 66-74. Extension variants of the aforementioned amino acid sequences that are suitable for use in a CM may be any that have one or more (e.g., 1, 2, 3, 4, 5 or more) additional amino acids and retain the recognition site for the corresponding protease. In some examples, the additional amino acids are coupled to the C-terminus of the aforementioned amino acid sequences. In some examples, the additional amino acids are coupled to the N-terminus of
CYTX-083 the aforementioned amino acid sequences. In some examples, the extension variants may comprise additional amino acids coupled to both the C-terminus and the N-terminus of the aforementioned amino acid sequences. In some instances, the C-terminus or N-terminus extension variants can have a C-terminal glycine or an N-terminal serine amino acid. [0060] In some embodiments, the CM comprises one, two, three, four, five, six or more amino acids in addition to the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. In some examples, the CM comprises one, two, three, four, five, six or more additional amino acids at the N-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. In some examples, the CM comprises one, two, three, four, five, six or more additional amino acids at the C-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. In some examples, the CM comprises one, two, three, four, five, six or more additional amino acids at the N-terminus, and one, two, three, four, five, six or more additional amino acids at the C-terminus of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. [0061] In some embodiments, the CM comprises a sequence with mutation(s) of one or more amino acid of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. For example, the CM comprises a sequence with one-amino acid, two-amino acid, three-amino acid, four-amino acid, or five-amino acid mutation(s) of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. In some embodiments, the CM comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-74 and 160 and having one conservative substitution. [0062] In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 1. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 2. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 3. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 4. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 5. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 6. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 7. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 8. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 9. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 10. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 11. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 12. In some
CYTX-083 embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 13. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 14. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 15. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 16. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 17. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 18. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 19. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 20. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 21. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 22. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 23. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 24. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 25. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 26. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 27. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 28. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 29. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 30. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 31. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 32. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 33. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 34. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 35. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 36. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 37. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 38. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 39. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 40. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 41. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 42. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 43. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 44. In some
CYTX-083 embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 45. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 46. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 47. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 48. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 49. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 50. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 51. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 52. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 53. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 54. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 55. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 56. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 57. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 58. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 59. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 60. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 61. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 62. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 63. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 64. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 65. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 66. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 67. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 68. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 69. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 70. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 71. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 72. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 73. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 74. In some embodiments, the CM consists of the amino acid sequence of SEQ ID NO: 160.
CYTX-083 [0063] In some embodiments, the CM consists of a sequence with mutation(s) of one or more amino acid of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. For example, the CM consists of a sequence with one-amino acid, two-amino acid, three-amino acid, four-amino acid, or five-amino acid mutation(s) of the amino acid sequence of any one of SEQ ID NOs: 1-74 and 160. [0064] In some embodiments, the CM comprises a total of 3 amino acids to 25 amino acids. For example, the CM may comprise a total of 3 to 25, 3 to 20, 3 to 15, 3 to 10, 3 to 5, 5 to 25, 5 to 20, 5 to 15, 5 to 10, 10 to 25, 10 to 20, 10 to 15, 15 to 25, 15 to 20, or 20 to 25 amino acids. In some embodiments, the CM consists of a total of 3 amino acids to 25 amino acids. For example, the CM may consist of a total of 3 to 25, 3 to 20, 3 to 15, 3 to 10, 3 to 5, 5 to 25, 5 to 20, 5 to 15, 5 to 10, 10 to 25, 10 to 20, 10 to 15, 15 to 25, 15 to 20, or 20 to 25 amino acids. [0065] The CM may be specifically cleaved by a protease (e.g., by MT-SP1) at a desired rate. The rate may be measured as substrate cleavage kinetics (kcat/KM) as disclosed in WO2016118629, which is incorporated by reference in its entirety. In brief, kcat is the turnover number and describes how many substrate molecules are transformed into products per unit time by a protease. The KM value describes the affinity of the substrate to the active site of the protease. The kcat/KM ratio provides a measurement of cleavability of the substrate by the protease. In general, the greater the ratio, the higher the rate of cleavability is; conversely, the lower the ratio, the slower the rate of cleavability is. The kcat/KM values may be determined with the following equation where C is product
concentration (M), which assumes that the substrate concentration is below the KM and in excess of the protease concentration. [0066] In some embodiments, the CM is cleaved by MT-SP1 at a rate that has a kcat/KM value from 1×10 to 1×106 M-1s-1, e.g., from 1×10 to 5×10, from 5×10 to 1×102, from 1×102 to 5×102, from 5×102 to 1×103, from 1×103 to 5×103, from 5×103 to 1×104, from 1×104 to 5×104, from 5×104 to 1×105, from 1×105 to 5×105, or from 5×105 to 1×106 M-1s-1. In some embodiments, the CM is cleaved by MT-SP1 at a rate that has a kcat/KM value of at least 1×10,
CYTX-083 at least 5×10, at least 1×102, at least 5×102, at least 1×103, 5×103, at least 1×104, at least 5×104, at least 1×105, at least 5×105, or at least 1×106. [0067] In some embodiments, the CM is cleaved by TMPRSS11 at a rate that has a kcat/KM value from 1×10 to 1×106 M-1s-1, e.g., from 1×10 to 5×10, from 5×10 to 1×102, from 1×102 to 5×102, from 5×102 to 1×103, from 1×103 to 5×103, from 5×103 to 1×104, from 1×104 to 5×104, from 5×104 to 1×105, from 1×105 to 5×105, or from 5×105 to 1×106 M-1s-1. In some embodiments, the CM is cleaved by TMPRSS11 at a rate that has a kcat/KM value of at least 1×10, at least 5×10, at least 1×102, at least 5×102, at least 1×103, 5×103, at least 1×104, at least
5×104, at least 1×105, at least 5×105, or at least 1×106. [0068] In some embodiments, the cleavability of the CMs are presented as the percentage of the fraction of cleaved CMs (or polypeptides comprising the CMs), e.g., as determined in a capillary electrophoresis assay described Example 2. In some examples, the cleavability of the CM by a protease is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%. In some examples, the cleavability of the CM by MT-SP1 is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% when 500nM activatable antibody c225 containing a prodomain with the CM being tested was incubated with 10 nM of MT-SP1 for 1.5 hours or 4 hours at 37ºC. In some examples, the cleavability of the CM by TMPRSS11 is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% when 500nM activatable antibody c225 containing a prodomain with the CM being tested was incubated with 10 nM of TMPRSS11 for 4 hours at 37ºC. [0069] In some embodiments, for specific cleavage by an enzyme, contact between the enzyme and CM is made. When a CM-containing polypeptide (e.g., activatable molecule comprising an AM coupled to a MM and a CM) is in the presence of target and sufficient protease activity, the CM can be cleaved. Sufficient protease activity refers to the ability of the protease to access the CM and effect cleavage. [0070] In some embodiments, a CM according to the present disclosure and a reference polypeptide can be cleaved by the same protease, but the CM according to the present disclosure has reduced cleavage or resistance to cleavage (e.g., by a different protease or proteases) in certain tissues in situ compared to a reference polypeptide. In some examples, a CM according to the present disclosure and a reference polypeptide can be cleaved by MT- SP1, but the CM according to the present disclosure has reduced cleavage or resistance to
CYTX-083 cleavage (e.g., by a different protease(s) than MT-SP1) in the bone marrow in situ compared to a reference polypeptide. For example, the cleavage (e.g., by a different protease than MT- SP1) in the bone marrow in situ of the CM may be less than 99%, less than 95%, less than 90%, less than 80%, less than 70%, less than 60%, less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% compared to the cleavage of the reference polypeptide. In some examples, such proteases different than an MT-SP1 may be other proteases in the bone marrow or other normal tissues, as well as other proteases involved in inflammation and wound healing. In some examples, the cleavage (e.g., by a different protease than MT-SP1) in the bone marrow in situ may be measured by increased activity of an activatable molecule comprising the CM or the reference polypeptide in the bone marrow, e.g., the method described in Example 6. A CM that is resistant to cleavage by a protease, or a sample or tissue comprising a protease, refers to (i) a CM in which no peptide bond is hydrolyzed by the protease, or no peptide bond is hydrolyzed when incubated in the sample or tissue comprising the protease or (ii) a CM in which a reduced level of peptide bond is hydrolyzed by the protease, or reduced level of peptide bond is hydrolyzed when incubated in the sample or tissue comprising the protease, compared to a reference CM. [0071] In some embodiments, the CM is cleavable by more than one proteases. For example, the CM may be cleaved by one or more type II transmembrane serine proteases (e.g., MT-SP1 and/or TMPRSS11) and by a second or multiple additional proteases. Examples of the additional protease could be any one or more of the following proteases: a disintegrin and metalloprotease (ADAM), an ADAM-like, or a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS, such as, for example, ADAM8, ADAM9, ADAM10, ADAM12, ADAM15, ADAM17/TACE, ADAMDEC1, ADAMTS1, ADAMTS4, ADAMTS5); an aspartate protease (such as, for example, BACE, Renin, and the like); an aspartic cathepsin (such as, for example, Cathepsin D, Cathepsin E, and the like); a caspase (such as, for example, Caspase 1, Caspase 2, Caspase 3, Caspase 4, Caspase 5, Caspase 6, Caspase 7, Caspase 8, Caspase 9, Caspase 10, Caspase 14, and the like); a cysteine cathepsin (such as, for example, Cathepsin B, Cathepsin C, Cathepsin K, Cathepsin L, Cathepsin S, Cathepsin V/L2, Cathepsin X/Z/P); a cysteine proteinase (such as, for example, Cruzipain, Legumain, Otubain-2, and the like); a kallikrein-related peptidase (KLK) (such as, for example, KLK4, KLK5, KLK6, KLK7, KLK8, KLK10, KLK11, KLK13, KLK14, and the like); a metalloproteinase (such as, for example, Meprin, Neprilysin, prostate-specific
CYTX-083 membrane antigen (PSMA), bone morphogenetic protein 1 (BMP-1), and the like); a matrix metalloproteinase (MMP, such as, for example, MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, MMP14, MMP15, MMP16, MMP17, MMP19, MMP20, MMP23, MMP24, MMP26, MMP27, and the like); a serine protease (such as, for example, activated protein C, Cathepsin A, Cathepsin G, Chymase, a coagulation factor protease (such as, for example, FVIIa, FIXa, FXa, FXIa, FXIIa, and the like); elastase, granzyme B, Guanidinobenzoatase, HtrA1, proteinase 3, neutrophil elastase, neutrophil serine protease 4 (NSP4), Lactoferrin, Marapsin, NS3/4A, PACE4, Plasmin, prostate-specific antigen (PSA), tissue plasminogen activator (tPA), Thrombin, Tryptase, urokinase-type plasminogen activator (uPA), a Type II transmembrane Serine Protease (TTSP) (such as, for example, DESC1, DPP-4, FAP, Hepsin, Matriptase-2, MT-SP1/Matriptase, TMPRSS2, TMPRSS3, TMPRSS4, TMPRSS5, TMPRSS6, TMPRSS7, TMPRSS8, TMPRSS9, TMPRSS10, TMPRSS11, and the like), and the like. Specific substrates are described, for example, in WO 2010/081173, WO 2015/048329, WO 2015/116933, and WO 2016/118629, each of which is incorporated herein by reference in its entirety. ACTIVATABLE MOLECULES [0072] In some embodiments, the polypeptide or polypeptide complex comprising a CM is an activatable molecule. The activatable molecule may comprise an active moiety (AM) that specifically binds a target. The AM may be coupled to the CM. In some embodiments, the activatable molecule comprises a masking moiety (MM) coupled with the AM via the CM. [0073] The coupling of two components in a polypeptide or polypeptide complex (e.g., an activatable molecule) may be direct or indirect. When the two components are coupled directly, the amino acid residue at the C-terminus of a component forms a peptide bond with the amino acid residue at the N-terminus of the other component. When the two components are coupled indirectly, there is a stretch of amino acids between the two components. In some examples, the two components of a polypeptide may be indirectly coupled via one or more other components in the polypeptide, i.e., the one or more other components are between the two coupled components. For indirectly coupling or linking via another component, the one or more other components may be a linker, AM(s), CM(s), MM(s), or any combination thereof.
CYTX-083 [0074] As used herein, the term “activatable molecule” refers to a molecule that comprises at least one set of MM, CM, and AM and which exhibits attenuated binding to a target as compared to the binding of a counterpart “activated” molecule comprising the same AM to the same target. The terms “activated molecule,” and “cleaved activatable molecule,” are used interchangeably herein to refer to the AM-containing cleavage product that is generated after exposure of the activatable molecule to a CM-specific protease (i.e., after cleavage of the CM by at least one protease). In some embodiments, a cleaved activatable molecule may lack a MM due to cleavage of the CM (e.g., by a protease), resulting in release of the MM. [0075] An AM may be any polypeptide that specifically binds a target. In some examples, the AM may be a therapeutic macromolecule. In some examples, the AM may be an antibody or an antigen-binding fragment. In some examples, the AM may be an antineoplastic macromolecule. In some examples, the AM may be a cytokine. In some examples, the AM may be a chimeric antigen receptor. [0076] In some examples, the AM may be a diagnostic macromolecule. For example, the diagnostic macromolecule may be a diagnostic polypeptide having 3 to 30, 5 to 25, 7 to 20, or 9 to 15 amino acids in length. Such diagnostic polypeptide may be used, in non-limiting aspects, e.g., for testing cleavage in tissues, and/or assessment of the tissue microenvironment. [0077] As used herein, the terms “specific binding” and “specifically binds” refer to the non-covalent interactions of the type that occur between an AM and its target, e.g., an immunoglobulin molecule and an antigen or a cytokine and its receptor, for which the AM is specific. The strength or affinity of binding interactions can be expressed in terms of the dissociation constant (Kd) of the interaction, wherein a smaller Kd represents a greater affinity. Unless indicated otherwise, as used herein, “affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of an AM and its target. Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology (e.g., BIACORE®) or biolayer interferometry (e.g., FORTEBIO®). Additional methods for determining the affinity for an AM and its target are known in the art. Immunological binding properties of selected polypeptides can be quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex
CYTX-083 formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions. Thus, both the “on rate constant” (Kon) and the “off rate constant” (Koff) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)). The ratio of Koff /Kon enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant Kd. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473). As used herein, a statement that an AM “specifically binds” to its target refers to an AM that binds its target with a dissociation constant (Kd) of less than 100 μM (e.g., less than 5 μM or 10 μM). In some examples, the AM specifically binds its target with a Kd of about 0.01 nM to about 500 nM. In some examples, an AM is said to specifically bind the target, when the equilibrium binding constant (Kd) is d1 PM, in some embodiments d 100 nM, in some embodiments d 10 nM, and in some embodiments d 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art. [0078] In general, an activatable molecule may be designed by selecting an AM of interest and constructing the remainder of the activatable molecule so that, when conformationally constrained, the MM provides for masking of the AM or reduction of binding of the AM to its target. Structural design criteria can be to be taken into account to provide for this functional feature. [0079] Activatable molecules may be provided in a variety of structural configurations. Exemplary formulas for activatable molecules are provided below. It is contemplated that the N- to C-terminal order of the AM, MM and CM may be reversed within an activatable molecule. For example, activatable molecules can be represented by the following formulas (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM-CM-AM AM-CM-MM As used herein and unless otherwise stated, each dash (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linkers. It should be noted that although MM and CM are indicated as distinct components in the formulas above, in all exemplary embodiments (including formulae) disclosed herein it is contemplated that the amino acid sequences of the MM and the CM may overlap, e.g., such that the CM is completely or partially contained within the MM. In addition, the
CYTX-083 formulas above provide for additional amino acid sequences that may be positioned N- terminal or C-terminal to the activatable molecules components. Examples include targeting moieties (e.g., a ligand for a receptor of a cell present in a target tissue) and half-life extending moieties. [0080] In some embodiments, MM, CM, and/or AM are coupled indirectly via one or more linkers (e.g., a linking peptide (LP)). For example, an activatable molecule may comprise one of the following formulae (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM-LP-CM-AM MM-CM-LP-AM MM-LP1-CM-LP2-AM AM-LP-CM-MM AM-CM-LP-MM AM-LP2-CM-LP1-MM wherein LP1 and LP2 are two linking peptides. In some examples, the LP1 and LP2 are identical to each other. In some examples, the LP1 and LP2 are not identical to each other. [0081] In some embodiments, the activatable molecule comprises a plurality of CMs, at least one of which comprises the sequence of any of SEQ ID NOs: 1-74 or 160. For example, the CM comprising the sequence of any of SEQ ID NOs: 1-74 or 160 may be engineered into a longer cleavage substrate that has a plurality of CMs. Examples of the additional CM(s) in the activatable molecule that are not the CM comprising the sequence of any of SEQ ID NOs: 1-74 or 160 include those described in WO 2010/081173, WO2021207669, WO2021207657, WO2021142029, WO2021061867, WO2020252349, WO2020252358, WO2020236679, WO2020176672, WO2020118109, WO2020092881, WO2020086665, WO2019213444, WO2019183218, WO2019173771, WO2019165143, WO2019075405, WO2019046652, WO2019018828, WO2019014586, WO2018222949, WO2018165619, WO2018085555, WO2017011580, WO2016179335, WO2016179285, WO2016179257, WO2016149201, WO2016014974, which are incorporated herein by reference in their entireties for all purposes. In some examples, one or more of the additional CMs may be cleavable by legumain. In some examples, the CM cleavable by legumain may comprise a sequence of any of SEQ ID NO: 1-74 or 160 and an Asparagine (Asn) residue at the N-terminus or C-terminus.
CYTX-083 [0082] In some embodiments, the substrate comprises CM1 cleavable by a first protease, and CM2 cleavable by a second protease. In some embodiments, the substrate comprises CM1 cleavable by a first protease, CM2 cleavable by a second protease, and CM3 cleavable by a third protease. In some embodiments, the substrate comprises CM1 cleavable by a first protease, CM2 cleavable by a second protease, CM3 cleavable by a third protease, and CM4 cleavable by a fourth protease. [0083] In some embodiments, the activatable molecule comprises a structural arrangement from N-terminus to C-terminus as follows: MM-CM1-CM2-AM, MM-CM2- CM1-AM, AM-CM1-CM2-MM, or AM-CM2-CM1-MM, MM-CM2-CM1-CM3-AM, MM- CM1-CM2-CM3-AM, MM-CM1-CM3-CM2-AM, MM-CM3-CM1-CM2-AM, or MM- CM3-CM2-CM1-AM. Likewise, a CM4 may be inserted any position between the MM and AM. [0084] In some embodiments, the activatable molecule comprises a linking peptide (LP) and wherein the activatable molecule has a structural arrangement from N-terminus to C- terminus as follows: MM-LP-CM1-CM2-AM, MM-CM1-CM2-LP-AM, MM-LP-CM2- CM1-AM, MM-CM2-CM1-LP-AM, MM-LP-CM2-CM1-CM3-AM, MM-LP-CM1-CM2- CM3-AM, MM-LP-CM1-CM3-CM2-AM, MM-LP-CM3-CM1-CM2-AM, MM-LP-CM3- CM2-CM1-AM, MM-CM2-CM1-CM3-LP-AM, MM-CM1-CM2-CM3-LP-AM, MM-CM1- CM3-CM2-LP-AM, MM-CM3-CM1-CM2-LP-AM, or MM-CM3-CM2-CM1-LP-AM. Likewise, a CM4 may be inserted any position between the MM and AM. [0085] In some embodiments, the activatable molecule comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the activatable molecule has a structural arrangement from N-terminus to C-terminus as follows: MM- LP1-CM1-CM2- LP2-AM, MM-LP1-CM2-CM1-LP2-AM, AM-LP2-CM1-CM2-LP1-MM, or AM-LP2- CM2-CM1-LP1-MM, MM-LP1-CM2-CM1-CM3-LP2-AM, MM-LP1-CM1-CM2-CM3- LP2-AM, MM-LP1-CM1-CM3-CM2-LP2-AM, MM-LP1-CM3-CM1-CM2-LP2-AM, MM- LP1-CM3-CM2-CM1-LP2-AM, MM-LP2-CM2-CM1-CM3-LP1-AM, MM-LP2-CM1- CM2-CM3-LP1-AM, MM-LP2-CM1-CM3-CM2-LP1-AM, MM-LP2-CM3-CM1-CM2- LP1-AM, or MM-LP2-CM3-CM2-CM1-LP1-AM. Likewise, a CM4 may be inserted any position between the MM and AM. [0086] In some embodiments, the activatable molecule comprises an additional linking peptide (LP3) and wherein the activatable molecule has a structural arrangement from N-
CYTX-083 terminus to C-terminus as follows: MM-LP-CM1-LP3-CM2-AM, MM-CM1-LP3-CM2-LP- AM, MM-LP-CM2-LP3-CM1-AM, MM-CM2-LP3-CM1-LP-AM, MM-LP-CM2-LP3- CM1-CM3-AM, MM-LP-CM1-LP3-CM2-CM3-AM, MM-LP-CM1-LP3-CM3-CM2-AM, MM-LP-CM3-LP3-CM1-CM2-AM, MM-LP-CM3-LP3-CM2-CM1-AM, MM-CM2-LP3- CM1-CM3-LP-AM, MM-CM1-LP3-CM2-CM3-LP-AM, MM-CM1-LP3-CM3-CM2-LP- AM, MM-CM3-LP3-CM1-CM2-LP-AM, MM-CM3-LP3-CM2-CM1-LP-AM, MM-LP- CM2-CM1-LP3-CM3-AM, MM-LP-CM1-CM2-LP3-CM3-AM, MM-LP-CM1-CM3-LP3- CM2-AM, MM-LP-CM3-CM1-LP3-CM2-AM, MM-LP-CM3-CM2-LP3-CM1-AM, MM- CM2-CM1-LP3-CM3-LP-AM, MM-CM1-CM2-LP3-CM3-LP-AM, MM-CM1-CM3-LP3- CM2-LP-AM, MM-CM3-CM1-LP3-CM2-LP-AM, MM-CM3-CM2-LP3-CM1-LP- AM,MM-LP1-CM1-LP3-CM2-LP2-AM, MM-LP1-CM2-LP3-CM1-LP2-AM, AM-LP1- CM1-LP3-CM2-LP2-MM, or AM-LP1-CM2-LP3-CM1-LP2-MM, MM-LP1-CM2-LP3- CM1-CM3-LP2-AM, MM-LP1-CM1-LP3-CM2-CM3-LP2-AM, MM-LP1-CM1-LP3- CM3-CM2-LP2-AM, MM-LP1-CM3-LP3-CM1-CM2-LP2-AM, MM-LP1-CM3-LP3- CM2-CM1-LP2-AM, MM-LP2-CM2-LP3-CM1-CM3-LP1-AM, MM-LP2-CM1-LP3- CM2-CM3-LP1-AM, MM-LP2-CM1-LP3-CM3-CM2-LP1-AM, MM-LP2-CM3-LP3- CM1-CM2-LP1-AM, or MM-LP2-CM3-LP3-CM2-CM1-LP1-AM. Likewise, a CM4 may be inserted any position between the MM and AM. [0087] In some embodiments, the activatable molecule has a structural arrangement from N-terminus to C-terminus as follows: MM-LP-CM2-LP3-CM1-LP4-CM3-AM, MM-LP- CM1-LP3-CM2-LP4-CM3-AM, MM-LP-CM1-LP3-CM3-LP4-CM2-AM, MM-LP-CM3- LP3-CM1-LP4-CM2-AM, MM-LP-CM3-LP3-CM2-LP4-CM1-AM, MM-CM2-LP3-CM1- LP4-CM3-LP-AM, MM-CM1-LP3-CM2-LP4-CM3-LP-AM, MM-CM1-LP3-CM3-LP4- CM2-LP-AM, MM-CM3-LP3-CM1-LP4-CM2-LP-AM, MM-CM3-LP3-CM2-LP4-CM1- LP-AM, MM-LP-CM2-LP4-CM1-LP3-CM3-AM, MM-LP-CM1-LP4-CM2-LP3-CM3-AM, MM-LP-CM1-LP4-CM3-LP3-CM2-AM, MM-LP-CM3-LP4-CM1-LP3-CM2-AM, MM- LP-CM3-LP4-CM2-LP3-CM1-AM, MM-CM2-LP4-CM1-LP3-CM3-LP-AM, MM-CM1- LP4-CM2-LP3-CM3-LP-AM, MM-CM1-LP4-CM3-LP3-CM2-LP-AM, MM-CM3-LP4- CM1-LP3-CM2-LP-AM, MM-CM3-LP4-CM2-LP3-CM1-LP-AM, MM-LP1-CM2-LP3- CM1-LP4-CM3-LP2-AM, MM-LP1-CM1-LP3-CM2-LP4-CM3-LP2-AM, MM-LP1-CM1- LP3-CM3-LP4-CM2-LP2-AM, MM-LP1-CM3-LP3-CM1-LP4-CM2-LP2-AM, MM-LP1- CM3-LP3-CM2-LP4-CM1-LP2-AM, MM-LP2-CM2-LP3-CM1-LP4-CM3-LP1-AM, MM-
CYTX-083 LP2-CM1-LP3-CM2-LP4-CM3-LP1-AM, MM-LP2-CM1-LP3-CM3-LP4-CM2-LP1-AM, MM-LP2-CM3-LP3-CM1-LP4-CM2-LP1-AM, or MM-LP2-CM3-LP3-CM2-LP4-CM1- LP1-AM. Likewise, a CM4 may be inserted any position between the MM and AM. [0088] In some embodiments, in the above structural arrangements, the CM1 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160. Alternatively or additionally, in some embodiments, in the above structural arrangements, the CM2 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160. Alternatively or additionally, in some embodiments, in the above structural arrangements, the CM3 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160. Alternatively or additionally, in some embodiments, in the above structural arrangements, the CM4 comprises a sequence of any one of SEQ ID NOs: 1-74 and 160. [0089] In some embodiments where the activatable molecule comprises a plurality of CMs, at least a portion of a first CM overlaps with at least a portion of a second CM in the substrate, such that one or more amino acids in the substrate belong to both CMs. For example, a substrate with the sequence X1X2X3X4X5X6 (each X is an amino acid), may comprise overlapping CM1 and CM2, in which CM1 is X1X2X3X4 and CM2 is X3X4X5X6. [0090] In some embodiments where the activatable molecule comprises a plurality of CMs, two CMs do not overlap in amino acid sequences such that no amino acid in the substrate belongs to both CMs. For example, a substrate with the sequence X1X2X3X4X5X6X7X8 (each X is an amino acid) may comprise non-overlapping CM1 and CM2, in which CM1 is X1X2X3X4 and CM2 is X5X6X7X8. In some embodiments, the non- overlapping CM1 and CM2 are coupled directly. In some embodiments, the non-overlapping CM1 and CM2 are coupled indirectly (e.g., via a linking peptide). [0091] In some embodiments, two CMs, e.g., CM1 and CM2, in a substrate have a structural arrangement from N-terminus to C-terminus as CM1-CM2. In some embodiments, two CMs, e.g., CM1 and the CM2 in a substrate have a structural arrangement from N- terminus to C-terminus as CM2-CM1. As used herein, the CM1 and CM2 in the formula CM1-CM2 or CM2-CM1 may be overlapping CM1 and CM2, non-overlapping CM1 and CM2 coupled directly, or non-overlapping CM1 and CM2 coupled indirectly (e.g., via a linking peptide). [0092] In some embodiments, two CMs, e.g., CM2 or CM4 and CM3 or CM4, in a substrate have a structural arrangement from N-terminus to C-terminus as CM2-CM3, CM2- CM4 or CM3-CM4. In some embodiments, two CMs, e.g., CM2 and the CM3 in a substrate
CYTX-083 have a structural arrangement from N-terminus to C-terminus as CM3-CM2 or CM4-CM2 or CM4-CM3. As used herein, the CM2 and CM3 in the formula CM2-CM3 or CM3-CM2 may be overlapping CM2 and CM3, non-overlapping CM2 and CM3 coupled directly, or non- overlapping CM2 and CM3 coupled indirectly (e.g., via a linking peptide). As used herein, the CM2 and CM4 in the formula CM2-CM4 or CM4-CM2 may be overlapping CM2 and CM4, non-overlapping CM2 and CM4 coupled directly, or non-overlapping CM2 and CM4 coupled indirectly (e.g., via a linking peptide). As used herein, the CM4 and CM3 in the formula CM4-CM3 or CM3-CM4 may be overlapping CM4 and CM3, non-overlapping CM4and CM3 coupled directly, or non-overlapping CM4 and CM3 coupled indirectly (e.g., via a linking peptide). Antibodies and Antigen-Binding Fragments [0093] In some embodiments, the AM is an antibody or antigen-binding fragment thereof. The term “antibody” is used herein in its broadest sense and includes certain types of immunoglobulin molecules that include one or more target-binding domains that specifically bind an antigen or epitope. Examples of antibodies include intact antibodies (e.g., intact immunoglobulins), antibody fragments, bispecific, and multi-specific antibodies. One example of a target-binding domain is formed by a VH -VL dimer. Additional examples of an antibody are described herein. Additional examples of an antibody are known in the art. [0094] A “light chain” includes one variable domain (VL) and one constant domain (CL). There are two different light chains termed kappa or lambda. A “heavy chain” consists of one variable domain (VH) and three constant region domains (CH1, CH2, CH3). There are five main heavy-chain classes or isotypes, some of which have several subtypes, and these determine the functional activity of an antibody molecule. The five major classes of immunoglobulin are immunoglobulin M (IgM), immunoglobulin D (IgD), immunoglobulin G (IgG), immunoglobulin A (IgA), and immunoglobulin E (IgE). IgG is by far the most abundant immunoglobulin and has several subclasses (IgG1, IgG2, IgG3, and IgG4 in humans). [0095] In some embodiments, the antigen-binding fragment is a Fab fragment, a F(ab')2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, or a single domain light chain antibody. Additional examples of the antigen-binding fragments include a VH domain, a VHH domain, a VNAR domain, and a single chain fragment variable (scFv), BiTE or a component thereof, a (scFv)2, a NANOBODY®, a nanobody-HSA, VHH-scAb, a VHH-
CYTX-083 Fab, a Dual scFab, a F(ab’)2, a diabody, a CROSSMAB®, a DAF (two-in-one), a DAE (four- in-one), a DUTAMAB®, a DT- IgG, a knobs-in-holes common light chain, a knobs-in-holes assembly, a charge pair, a Fab-arm exchange, a SEEDbody, a LUZ-Y, a FcAb, a kl-body, an orthogonal Fab, a DVD-IgG, a IgG(H)-scFv, a scFv-(H)IgG, IgG(L)-scFv, scFv-(L)IgG, IgG(L,H)-Fv, IgG(H)-V, V(H)-IgG, IgG(L)-V, V(L)-IgG, KIH IgG-scFab, 2scFv-IgG, IgG- 2scFv, scFv4-Ig, ZYBODY™, DVI-IgG, Diabody-CH3, a triple body, a miniantibody, a minibody, a TriBi minibody, scFv-CH3 KIH , Fab-scFv, a F(ab’)2-scFv2, a scFv-.,dz^^D^)DE- scFv-Fc, a tetravaient HCAb, a scDiabody-Fc, a Diabody-Fc, a tandem scFv-Fc, a VHH-Fc, a tandem VHH-)F^^ D^ /^dz+-Fc KiH, a Fab- VHH-Fc, an Intrabody, a dock and lock, an ImmTAC® (immune-mobilizing monoclonal TCRs (T cell receptors) against cancer), an IgG- IgG conjugate, a Cov-X-Body, a scFvl- PEG-scFv2, an Adnectin, a DARPin®, a fibronectin, an IgG, an IgM, an IgA, an IgE, an IgD, a DEP conjugate, TMEAbodyTM, SAFEbody®, TRITAC® , or SHIELD antibody. [0096] A “fragment antigen binding” (Fab) includes a complete light chain paired with the VH domain and the CH1 domain of a heavy chain. $^)^DEƍ^2 fragment is formed when an antibody is cleaved by pepsin (or otherwise truncated) below the hinge region, in which case the two fragment target-binding domains (Fabs) of the antibody molecule remain linked. A )^DEƍ^2 fragment contains two complete light chains paired with the two VH and CH1 domains of the heavy chains joined together by the hinge region. A “fragment crystallizable” (Fc) fragment (also referred to herein as FC domain) corresponds to the paired CH2 and CH3 domains and is the part of the antibody molecule that interacts with effector molecules and cells. The functional differences between heavy-chain isotypes lie mainly in the Fc fragment. A “single chain fragment variable” (scFv) contains only the variable domain of a light chain (VL) linked by a stretch of peptide to a variable domain of a heavy chain (VH). The name single-chain Fv is derived from Fragment variable. A “hinge region” or “interdomain” is flexible amino acid stretch that joins or links the Fab fragment to the Fc domain. A “synthetic hinge region” is an amino acid sequence that joins or links a Fab fragment to an Fc domain. [0097] An “Fv” fragment includes a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain. A “dual variable domain immunoglobulin G” or “DVD-IgG” refers to multivalent and multispecific target-binding proteins as described, e.g., in DiGiammarino et al., Methods Mol. Biol. 899:145-156, 2012, Jakob et al., MABs 5:358-363, 2013; and U.S, Patent Nos.7,612,181; 8,258,268; 8,586,714;
CYTX-083 8,716,450; 8,722,855; 8,735,546; and 8,822,645, each of which is incorporated by reference in its entirety. Examples of DARTs are described in, e.g., Garber, Nature Reviews Drug Discovery 13:799-801, 2014. [0098] A VHH domain is a single monomeric variable antibody domain that can be found in camelids. A VNAR domain is a single monomeric variable antibody domain that can be found in cartilaginous fish. Non-limiting aspects of VHH domains and VNAR domains are described in, e.g., Cromie et al., Curr. Top. Med. Chem.15:2543-2557, 2016; De Genst et al. Dev. Comp. Immunol. 30:187-198, 2006; De Meyer et al, Trends Biotechnol 32:263-270, 2014; Kijanka et al., Nanomedicine 10:161-174, 2015; Kovaleva et al., Expert. Opin. Biol. Ther.14: 1527-1539, 2014; Krah et al., Immunopharmacol. Immunotoxicol.38:21-28, 2016; Mujic-Delic et al., Trends Pharmacol. Sci. 35:247-255, 2014; Muyldermans, J. Biotechnol. 74:277-302, 2001, Muyldermans et al., Trends Biocheni. Sci. 26:230-235, 2001; Muyldermans, Ann. Rev. Biochem.82:775-797, 2013; Rahbarizadeh et al., Immunol, invest. 40:299-338, 2011; Van Audenhove et al., EBioMedicine 8:40-48, 2016; Van Bockstaele et al., Curr. Opin. Investig. Drugs 10:1212-1224, 2009; Vincke et al. Methods Mol, Biol, 911:15-26, 2012; and Wesolowski et al. Med. Microbiol. Immunol.198:157-174, 2009, each of which is incorporated by reference herein in its entirety. [0099] In some embodiments, the AM may be a mouse, rat, rabbit, goat, camel, donkey, primate, human, or humanized or chimeric polypeptide. In one example, the AM may be a human polypeptide. In one example, the AM may be a humanized (e.g., fully humanized) polypeptide. [0100] The term “humanized” refer to an AM having an amino acid sequence that includes VH and VL region sequences from a reference protein raised in a non-human species (e.g., a mouse), but also includes modifications in those sequences relative to the reference protein intended to render them more “human-like,” i.e., more similar to human germline variable sequences. In some embodiments, a “humanized” AM is one that immunospecifically binds an antigen of interest and that has a framework (FR) region having substantially the amino acid sequence as that of a human protein, and a complementary determining region (CDR) having substantially the amino acid sequence as that of a non- human protein contains humanized VH and VL regions. [0101] The term “human polypeptide” is intended to include AMs having variable and constant regions generated, assembled, or derived from human immunoglobulin sequences.
CYTX-083 In some embodiments, an AM may be considered to be “human” even though its amino acid sequence include residues or elements not encoded by human germline immunoglobulin sequences (e.g., include sequence variations, for example that may (originally) have been introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), e.g., in one or more CDRs. [0102] Examples of antibodies and antigen-binding fragments include those binding to cell surface receptors and secreted binding proteins (e.g., growth factors), soluble enzymes, structural proteins (e.g. collagen, fibronectin) and the like, or an extracellular target (e.g., an extracellular protein target). In some embodiments, antibodies and antigen-binding fragments are designed for cellular uptake and are activatable inside a cell. [0103] Examples of antibodies and antigen-binding fragments include those in Example 1, e.g., those comprising a light chain comprising the sequence of SEQ ID NOs: 83, 85, 87, 89, 90, 92, or 93, and a heavy chain comprising the sequence of SEQ ID NOs: 84, 86, 88, or 91. Multispecific Activatable Antibodies [0104] In some embodiments, the activatable antibodies are multispecific activatable antibodies. In some examples, the multispecific activatable antibodies herein recognize two or more different antigens or epitopes and that include at least one masking moiety (MM) linked to at least one antigen- or epitope-binding domain of the multispecific antibody such that coupling of the MM reduces the ability of the antigen- or epitope-binding domain to bind its target. In some embodiments, the MM is coupled to the antigen- or epitope-binding domain of the multispecific antibody via a cleavable moiety (CM) that functions as a substrate for at least one protease, e.g., MT-SP1. The activatable multispecific antibodies provided herein are stable in circulation, activated at intended sites of therapy and/or diagnosis but not in normal, i.e., healthy tissue, and, when activated, exhibit binding to a target that is at least comparable to the corresponding, unmodified multispecific antibody. [0105] The multispecific activatable molecules may be used to target a first and a second target tissues. In one embodiment, the first and second target tissues are spatially separated, for example, at different sites in the organism. In one embodiment, the first and second target tissues are the same tissue temporally separated, for example the same tissue at two different points in time, for example the first time point is when the tissue is an early stage tumor, and the second time point is when the tissue is a late stage tumor.
CYTX-083 [0106] In some embodiments, the multispecific activatable antibody includes a first antibody or antigen-binding fragment thereof (AB1) that binds a first target, where the AB1 is coupled to a masking moiety (MM1) such that coupling of the MM1 reduces the ability of the AB1 to bind the first target, and the multispecific activatable antibody includes a second antibody or antigen-binding fragment thereof (AB2) that binds a second target, where the AB2 is coupled to a masking moiety (MM2) such that coupling of the MM2 reduces the ability of the AB2 to bind the second target. In some embodiments, AB1 is coupled to MM1 via CM1, and AB2 is coupled to MM2 via CM2. In some embodiments, there are linking peptides between AB1 and CM1, between CM1 and MM1, between AB2 and CM2, and/or between CM2 and MM2. In some embodiments, AB1 is directly coupled to CM1, CM1 is directly coupled to MM1, AB2 is directly coupled to CM2, and/or CM2 is directly coupled to MM2. [0107] For example, the multispecific activatable antibodies can be represented by the following formulas (in order from an amino (N) terminal region to carboxyl (C) terminal region): MM1-CM1-AB1 : MM2-CM2-AB2 AB1-CM1-MM1 : MM2-CM2-AB2 AB1-CM1-MM1 : AB2-CM2-MM2 wherein “:” separates two polypeptides, which may be two independent polypeptides on two different molecules, or two polypeptides on the same molecule (e.g., two polypeptide chains of the same protein). As used herein and unless otherwise stated, each dash (-) between the components of the activatable molecule represents either a direct linkage or indirect linkage via one or more linking peptides. [0108] In some embodiments, the multispecific activatable antibodies are designed to engage immune effector cells, also referred to herein as immune-effector cell engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies are designed to engage leukocytes, also referred to herein as leukocyte engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies are designed to engage T cells, also referred to herein as T-cell engaging multispecific activatable antibodies. In some embodiments, the multispecific activatable antibodies engage a surface antigen on a leukocyte, such as on a T cell, on a natural killer (NK) cell, on a myeloid mononuclear cell, on a macrophage, and/or on another immune
CYTX-083 effector cell. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is a NK cell. In some embodiments, the immune effector cell is a mononuclear cell, such as a myeloid mononuclear cell. In some embodiments, the multispecific activatable antibodies are designed to bind or otherwise interact with more than one target and/or more than one epitope, also referred to herein as multi-antigen targeting activatable antibodies. As used herein, the terms “target” and “antigen” are used interchangeably. [0109] In some embodiments, immune effector cell engaging multispecific activatable antibodies of the disclosure include a targeting antibody or antigen-binding fragment thereof and an immune effector cell engaging antibody or antigen-binding portion thereof, where at least one of the targeting antibody or antigen-binding fragment thereof and/or the immune effector cell engaging antibody or antigen-binding portion thereof is masked. [0110] In some embodiments, the non-immune effector cell engaging antibody is a cancer targeting antibody. In some embodiments the non-immune cell effector antibody is an IgG. In some embodiments the immune effector cell engaging antibody is a scFv. In some embodiments the targeting antibody (e.g., non-immune cell effector antibody) is an IgG and the immune effector cell engaging antibody is a scFv. In some embodiments, the immune effector cell is a leukocyte. In some embodiments, the immune effector cell is a T cell. In some embodiments, the immune effector cell is a NK cell. In some embodiments, the immune effector cell is a myeloid mononuclear cell. [0111] In some embodiments of an immune effector cell engaging multispecific activatable antibody, one antigen is typically an antigen present on the surface of a tumor cell or other cell type associated with disease, and another antigen is typically a stimulatory or inhibitory receptor present on the surface of a T-cell, natural killer (NK) cell, myeloid mononuclear cell, macrophage, and/or other immune effector cell. [0112] One embodiment of the disclosure is a multispecific activatable antibody that is activatable in a cancer microenvironment and that includes an antibody, for example an IgG or scFv, directed to a tumor target and an agonist antibody, for example an IgG or scFv, directed to a co-stimulatory receptor expressed on the surface of an activated T cell or NK cell, wherein at least one of the cancer target antibody and/or agonist antibody is masked. In this embodiment, the multispecific activatable antibody, once activated by tumor-associated proteases, effectively crosslinks and activates the T cell or NK cell expressed co-stimulatory
CYTX-083 receptors in a tumor-dependent manner to enhance the activity of T cells that are responding to any tumor antigen via their endogenous T cell antigen or NK-activating receptors. The activation-dependent nature of these T cell or NK cell costimulatory receptors focuses the activity of the activated multispecific activatable antibody to tumor-specific T cells, without activating all T cells independent of their antigen specificity. In one embodiment, at least the co-stimulatory receptor antibody of the multispecific activatable antibody is masked to prevent activation of auto-reactive T cells that may be present in tissues that also express the antigen recognized by the tumor target-directed antibody in the multispecific activatable antibody, but whose activity is restricted by lack of co-receptor engagement. [0113] One embodiment of the disclosure is a multispecific activatable antibody that is activatable in a disease characterized by T cell overstimulation, such as an autoimmune disease or inflammatory disease microenvironment. Such a multispecific activatable antibody includes an antibody, for example an IgG or scFv, directed to a target comprising a surface antigen expressed in a tissue targeted by a T cell in autoimmune or inflammatory disease and an antibody, for example an IgG or scFv, directed to an inhibitory receptor expressed on the surface of a T cell or NK cell, wherein at least one of the disease tissue target antibody and/or T cell inhibitory receptor antibody is masked. Examples of a tissue antigen targeted by T cells in autoimmune disease include a surface antigen expressed on myelin or nerve cells in multiple sclerosis or a surface antigen expressed on pancreatic islet cells in Type 1 diabetes. In this embodiment, the multispecific activatable antibody when localized in the tissue under autoimmune attack or inflammation is activated and co-engages the T cell or NK cell inhibitory receptor to suppress the activity of autoreactive T cells responding to any disease tissue-targeted antigens via their endogenous TCR or activating receptors. In one embodiment, at least one or multiple antibodies are masked to prevent suppression of T cell responses in non-disease tissues where the target antigen may also be expressed. [0114] In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies include at least a first antibody or antigen-binding fragment thereof that binds a first target and/or first epitope and a second antibody or antigen-binding fragment thereof that binds a second target and/or a second epitope. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different targets. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind two or more different
CYTX-083 epitopes on the same target. In some embodiments, the multi-antigen targeting antibodies and/or multi-antigen targeting activatable antibodies bind a combination of two or more different targets and two or more different epitopes on the same target. Masking Moieties (MMs) [0115] The activatable molecules herein may comprise one or more masking moieties (MMs) capable of interfering with the binding of the AMs to the target. A masking moiety in an activatable molecule “masks” or reduces or otherwise inhibits the binding of the activatable molecule to its target. In some embodiments, the coupling of an AM (e.g., an antibody or fragment thereof, or other therapeutic or diagnostic protein) with an MM may inhibit the ability of the AM to specifically bind its target by means of inhibition known in the art (e.g., structural change, competition for antigen-binding domain, and the like). In some embodiments, the coupling of an AM with an MM may effect a structural change that reduces or inhibits the ability of the AM to specifically bind its target. In some embodiments, the coupling of a protein comprising an AM with an MM sterically blocks, reduces or inhibits the ability of the AM to specifically bind its target and or epitope. In some embodiments, when an activatable molecule is not activated, the MM prevents the AM from target binding; but when the activatable molecule is activated (when the CM is cleaved by a protease), the MM does not substantially or significantly interfere with the AM’s binding to the target. [0116] An MM may be coupled to an AM (e.g., an antibody or fragment thereof, or other therapeutic or diagnostic protein) via the CM described herein, either directly or indirectly (e.g., via one or more linkers described herein). Alternatively, an MM interfering with the target binding of an AM may be coupled, either directly or indirectly, to a component of the activatable molecule that is not the AM. For example, the MM may be coupled, either directly or indirectly, to a different AM. In another example, the MM may be coupled, either directly or indirectly, with a half-life extending moiety (EM). In either case, in the tertiary or quaternary structure of the activatable structure, the MM may be in a position (e.g., proximal to the AM to be masked) that allows the MM to mask the AM. [0117] In some embodiments, an MM interacts with the AM, thus reducing or inhibiting the interaction between the AM and its binding partner. In some embodiments, the MM comprises at least a partial or complete amino acid sequence of a naturally occurring binding partner of the AM. The term “naturally occurring” as used herein as applied to an object refers to the fact that an object can be found in nature. For example, a polypeptide or polynucleotide
CYTX-083 sequence that is present in an organism (including viruses or bacteria) that can be isolated from a source in nature and that has not been intentionally modified by man in the laboratory or otherwise is naturally occurring. [0118] For example, the MM may be a fragment of a naturally occurring binding partner. The fragment may retain at least 95%, at least 90%, at least 80%, at least 75%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 25%, or at least 20% nucleic acid or amino acid sequence homology to the naturally occurring binding partner. In some embodiments, the MM is a cognate peptide of the AM. For example, the MM may comprise a sequence of the AM’s epitope or a fragment thereof. [0119] In some embodiments, the MM comprises an amino acid sequence that is not naturally occurring or does not contain the amino acid sequence of a naturally occurring binding partner or target protein. In certain embodiments, the MM is not a natural binding partner of the AM. In some embodiments, the MM does not comprise a subsequence of more than 4, 5, 6, 7, 8, 9 or 10 consecutive amino acid residues of a natural binding partner of the AM. The MM may be a modified binding partner for the AM which contains amino acid changes that decrease affinity and/or avidity of binding to the AM. In some embodiments, the MM contains no or substantially no nucleic acid or amino acid homology to the AM’s natural binding partner. In other embodiments the MM has no more than 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, or 80% homology to the natural binding partner of the AM. [0120] In some embodiments, the MM is a polypeptide that binds to the AM. In some examples, the MM may be an antibody or antibody fragment (e.g., a Fab fragment, a F(ab’)2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, and a single domain light chain antibody) that binds to the AM such that interrupts the AM’s binding to its target. In some examples, the MM may be a ligand, a receptor, a fragment thereof (e.g., an extracellular domain of a receptor) of the AM that binds to the AM and interrupts the AM’s binding to its target. In some examples, when the AM is an antibody or antibody fragment thereof, the MM may be an anti-idiotypic antibody or fragment thereof (e.g., scFv) that binds to the idiotype of the AM. In some examples, the MM may be a cytokine or a receptor for a cytokine. In some examples, the MM may have an amino acid sequence that is at least 85% identical to a cytokine or to a receptor for a cytokine.
CYTX-083 [0121] In some embodiments, the MM does not bind the AM, but still interferes with AM’s binding to its binding partner through non-specific interactions such as steric hindrance. For example, the MM may be positioned in the activatable molecule such that the tertiary or quaternary structure of the activatable molecule allows the MM to mask the AM through charge-based interaction, thereby holding the MM in place to interfere with binding partner access to the AM. Examples of such MMs include an albumin, e.g., human serum albumin (HSA), a fragment crystallizable (Fc) domain, an antibody constant domain (e.g., CH domains), a polymer (e.g., branched or multi-armed polyethylene glycol (PEG)), a latency associated protein (LAP), and any polypeptide or other moieties that sterically interfere AM- target interactions. In some examples, the MM may recruit a large protein binding partner that sterically interfere AM-target interactions. For example, the MM may be an antibody or a fragment thereof that binds to serum albumin. [0122] Examples of suitable masking moieties include the full-length or a AM-binding fragment or mutein of a cognate receptor of the AM, and AM-binding antibodies and fragment thereof, e.g., a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody a single chain variable fragment (scFv), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL), a variable domain of camelid-type nanobody (VHH), a dAb and the like. Other exemplary antigen-binding domain that bind the AM can also be used as an MM include non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds. As another example, a peptide that is modified by conjugation to a water-soluble polymer, such as PEG, can sterically inhibit or prevent binding of the cytokine to its receptor. Antibodies and antigen-binding domains that bind to, for example, a protein with a long serum half- life such as HSA, immunoglobulin or transferrin, or to a receptor that is recycled to the plasma membrane, such as FcRn or transferrin receptor, can also inhibit the cytokine, particularly when bound to their antigen. In some embodiments, the MMs (e.g., those sterically interfere with the AM-target interaction) can also function as half-life extending elements. [0123] In some embodiments, the MM may have a dissociation constant for binding to the AM that is no more than the dissociation constant of the AM to the target. In some
CYTX-083 embodiments, the MM does not interfere or compete with the AM for binding to the target in in the activated molecule (i.e., following cleavage of the CM by a protease). [0124] The structural properties of the MMs may be selected according to factors such as the minimum amino acid sequence required for interference with the AM binding to target, the target protein-protein binding pair of interest, the size of the AM, the presence or absence of linkers, and the like. [0125] In some embodiments, the MM may be unique for the coupled AM. Examples of MMs include MMs that were specifically screened to bind a binding domain of the AM or fragment thereof (e.g., affinity masks). Methods for screening MMs to obtain MMs unique for the AM and those that specifically and/or selectively bind a binding domain of a binding partner/target are provided herein and can include protein display methods. [0126] As used herein, the term “masking efficiency” refers to the activity (e.g., EC50) of the activatable molecule divided by the activity of a control molecule, wherein the control molecule may be either cleavage product of the activatable molecule (i.e., the activated molecule) or the AM used in the activatable molecule. An activatable molecule having a reduced level of an AM activity may have a masking efficiency that is greater than 10. In some embodiments, the activatable molecules described herein have a masking efficiency that is greater than 10, 100, 1000, or 5000. [0127] In some embodiments, the MM is a polypeptide of about 2 to 50 amino acids in length. For example, the MM may be a polypeptide of from 2 to 40, from 2 to 30, from 2 to 20, from 2 to 10, from 5 to 15, from 10 to 20, from 15 to 25, from 20 to 30, from 25 to 35, from 30 to 40, from 35 to 45, from 40 to 50 amino acids in length. For example, the MM may be a polypeptide with 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids in length. In some examples, the MM may be a polypeptide of more than 50 amino acids in length, e.g., 100, 200, 300, 400, 500, 600, 700, 800, or more amino acids. In some embodiments, the MM is a steric mask. [0128] In some embodiments, in an activatable molecule with an AM and an interfering MM, in the presence of the target of an AM, there is no binding or substantially no binding of the AM to the target, or no more than 0.001%, 0.01%, 0.1%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, or 50% binding of the AM to its target, as compared to the binding of an counterpart molecule without the interfering MM, for at
CYTX-083 least 0.1, 0.5, 1, 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months when measured in vitro immunoabsorbant assay, e.g., as described in US20200308243A1. [0129] The binding affinity of the AM towards the target or binding partner with an interfering MM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 times lower than the binding affinity of the AM towards its binding partner without an interfering MM, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100- 1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000- 100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000- 10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of the AM towards its binding partner when there is no interfering MM. [0130] The dissociation constant (Kd) of the MM towards the AM it masks, may be greater than the dissociation constant of the AM towards the target. The dissociation constant of the MM towards the masked AM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times greater than the dissociation constant of the AM towards the target. Conversely, the binding affinity of the MM towards the masked AM may be lower than the binding affinity of the AM towards the target. The binding affinity of MM towards the AM may be at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 100,000, 1,000,000 or even 10,000,000 times lower than the binding affinity of the AM towards the target. [0131] In some embodiments, the Kd of the activatable molecule comprising an MM and a CM towards the AM’s target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000, 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100-1,000,000, 100-10,000,000, 1,000-10,000, 1,000- 100,000, 1,000-1,000,000, 1000-10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000- 10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times greater than the Kd of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the MM or CM towards the AM’s target. Conversely, the binding affinity of the activatable molecule comprising an MM and a CM towards the AM’s target is at least 5, 10, 25, 50, 100, 250, 500, 1,000, 2,500, 5,000, 10,000, 50,000, 100,000, 500,000, 1,000,000,
CYTX-083 5,000,000, 10,000,000, 50,000,000 or greater, or between 5-10, 10-100, 10-1,000, 10-10,000, 10-100,000, 10-1,000,000, 10-10,000,000, 100-1,000, 100-10,000, 100-100,000, 100- 1,000,000, 100-10,000,000, 1,000-10,000, 1,000-100,000, 1,000-1,000,000, 1000- 10,000,000, 10,000-100,000, 10,000-1,000,000, 10,000-10,000,000, 100,000-1,000,000, or 100,000-10,000,000 times lower than the binding affinity of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the MM or CM towards the AM’s target. [0132] In some embodiments, when the AM is coupled with an MM and is in the presence of the target, the specific binding of the AM to its target is reduced or inhibited, as compared to the specific binding of the AM not coupled with the MM. When compared to the binding of the AM not coupled with the MM to the target, the target-binding ability of the AM coupled with the MM may be reduced by at least 50%, 60%, 70%, 80%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% for at least 2, 4, 6, 8, 12, 28, 24, 30, 36, 48, 60, 72, 84, or 96 hours, or 5, 10, 15, 30, 45, 60, 90, 120, 150, or 180 days, or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or more when measured in vivo or in an in vitro assay. [0133] In some embodiments, the MM comprises a non-binding steric moiety (NB) that does not bind the AM but is able to interfere the binding between the AM and its target via steric hindrance. In some embodiments, the MM comprises a binding partner (BP) for a NB, where the BP recruits or otherwise attracts the NB to the activatable molecule. [0134] In some embodiments, the MM contains genetically encoded or genetically non- encoded amino acid(s). Examples of genetically non-encoded amino acids include D-amino DFLGV^^ȕ-DPLQR^DFLGV^^DQG^Ȗ-amino acids. In specific embodiments, the MMs contain no more than 50%, 40%, 30%, 20%, 15%, 10%, 5% or 1% of genetically non-encoded amino acids. [0135] In some embodiments, once released from the activatable molecule and in a free state, the MM may have a biological activity or a therapeutic effect, such as binding capability. For example, the free peptide may bind with the same or a different binding partner. In certain embodiments, the free MM may exert a therapeutic effect, providing a secondary function to the compositions disclosed herein. In some embodiments, once uncoupled from the activatable molecule and in a free state, the MM may advantageously not exhibit biological activity. For example, in some embodiments the MM after cleavage from the activatable molecule does not elicit an immune response in the subject.
CYTX-083 [0136] Suitable MMs may be identified and/or further optimized through a screening procedure from a library of candidate activatable molecule having variable MMs. For example, an AM and a CM may be selected to provide for a desired enzyme/target combination, and the amino acid sequence of the MM can be identified by the screening procedure described below to identify an MM that provides for an activatable phenotype. For example, a random peptide library (e.g., of peptides comprising 2 to 40 amino acids or more) may be used in the screening methods disclosed herein to identify a suitable MM. [0137] In some embodiments, MMs with specific binding affinity for an AM may be identified through a screening procedure that includes providing a library of peptide scaffolds comprising candidate MMs wherein each scaffold is made up of a transmembrane protein and the candidate MM. The library may then be contacted with an entire or portion of a protein such as a full length protein, a naturally occurring protein fragment, or a non-naturally occurring fragment containing a protein (also capable of binding the binding partner of interest), and identifying one or more candidate MMs having detectably bound protein. The screening may be performed by one more rounds of magnetic-activated sorting (MACS) or fluorescence-activated sorting (FACS), as well as determination of the binding affinity of MM towards the AM and subsequent determination of the masking efficiency, e.g., as described in WO2009025846 and US20200308243A1, which are incorporated herein by reference in their entireties. [0138] Examples of suitable MMs are disclosed in WO2021207657, WO2021142029, WO2021061867, WO2020252349, WO2020252358, WO2020236679, WO2020176672, WO2020118109, WO2020092881, WO2020086665, WO2019213444, WO2019183218, WO2019173771, WO2019165143, WO2019075405, WO2019046652, WO2019018828, WO2019014586, WO2018222949, WO2018165619, WO2018085555, WO2017011580, WO2016179335, WO2016179285, WO2016179257, WO2016149201, and WO2016014974, which are incorporated herein by reference in their entireties. [0139] In some embodiments, the AM in an activatable molecule is an antibody or antigen-binding fragment that specifically binds EGFR. In some examples, such an activatable molecule comprises an MM that comprises the amino acid sequence of SEQ ID NO: 81. In some examples, such an activatable molecule comprises an MM that comprises the amino acid sequence of SEQ ID NO: 82. In some examples, such an activatable molecule comprises an MM that consists of the amino acid sequence of SEQ ID NO: 81. In some
CYTX-083 examples, such an activatable molecule comprises an MM that consists of the amino acid sequence of SEQ ID NO: 82. [0140] In some aspects, the present disclosure includes an activatable antibody comprising an anti-EGFR antibody coupled directly or indirectly to a CM, wherein the CM is directly or indirectly coupled to an MM that comprises or consists of the amino acid sequence of SEQ ID NO: 82. Linkers [0141] The activatable molecules may comprise one or more linkers. The linkers may be linking peptides that comprise a stretch of amino acid sequence that link two components in the activatable molecule. The linkers may be non-cleavable by any protease. In some embodiments, one or more linkers may be introduced into the activatable molecule to provide flexibility at one or more of the junctions between domains, between moieties, between moieties and domains, or at any other junctions where a linker would be beneficial. In some embodiments, where the activatable molecule is provided as a conformationally constrained construct, a flexible linker may be inserted to facilitate formation and maintenance of a structure in the activatable molecule. Any of the linkers described herein may provide the desired flexibility to facilitate the inhibition of the binding of a target, or to facilitate cleavage of a CM by a protease. In some embodiments, linkers included in the activatable molecule may be all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable molecule. Some linkers may include cysteine residues, which may form disulfide bonds and reduce flexibility of the construct. [0142] In some embodiments, a linker coupled to an MM may have a length that allows the MM to be in a position in the tertiary or quaternary to effectively mask an AM, (e.g., proximal to the AM to be masked) that allows the MM to mask the AM. [0143] In most instances, the linker’s length may be determined by counting, in a N- to C- direction, the number of amino acids from the N-terminus of the linker adjacent to the C- terminal amino acid of the preceding component, to the C-terminus of the linker adjacent to the N-terminal amino acid of the following component (i.e., where the linker length does not include either the C-terminal amino acid of the preceding component or the N-terminal amino acid of the following component).
CYTX-083 [0144] In some embodiments, a linker may include a total of 1 to 50, 1 to 40, 1 to 30, 1 to 25 (e.g., 1 to 24, 1 to 22, 1 to 20, 1 to 18, 1 to 16, 1 to 15, 1 to 14, 1 to 12, 1 to 10, 1 to 8, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 25, 2 to 24, 2 to 22, 2 to 20, 2 to 18, 2 to 16, 2 to 15, 2 to 14, 2 to 12, 2 to 10, 2 to 8, 2 to 6, 2 to 5, 2 to 4, 2 to 3, 4 to 25, 4 to 24, 4 to 22, 4 to 20, 4 to 18, 4 to 16, 4 to 15, 4 to 14, 4 to 12, 4 to 10, 4 to 8, 4 to 6, 4 to 5, 5 to 25, 5 to 24, 5 to 22, 5 to 20, 5 to 18, 5 to 16, 5 to 15, 5 to 14, 5 to 12, 5 to 10, 5 to 8, 5 to 6, 6 to 25, 6 to 24, 6 to 22, 6 to 20, 6 to 18, 6 to 16, 6 to 15, 6 to 14, 6 to 12, 6 to 10, 6 to 8, 8 to 25, 8 to 24, 8 to 22, 8 to 20, 8 to 18, 8 to 16, 8 to 15, 8 to 14, 8 to 12, 8 to 10, 10 to 25, 10 to 24, 10 to 22, 10 to 20, 10 to 18, 10 to 16, 10 to 15, 10 to 14, 10 to 12, 12 to 25, 12 to 24, 12 to 22, 12 to 20, 12 to 18, 12 to 16, 12 to 15, 12 to 14, 14 to 25, 14 to 24, 14 to 22, 14 to 20, 14 to 18, 14 to 16, 14 to 15, 15 to 25, 15 to 24, 15 to 22, 15 to 20, 15 to 18, 15 to 16, 16 to 25, 16 to 24, 16 to 22, 16 to 20, 16 to 18, 18 to 25, 18 to 24, 18 to 22, 18 to 20, 20 to 25, 20 to 24, 20 to 22, 22 to 25, 22 to 24, or 24 to 25 amino acids). In some embodiments, the linker may include a total of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids. [0145] In some embodiments, a linker may be rich in glycine (Gly or G) residues. In some embodiments, the linker may be rich in serine (Ser or S) residues. In some embodiments, the linker may be rich in glycine and serine residues. In some embodiments, the linker may have one or more glycine-serine residue pairs (GS) (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GS pairs). [0146] In some embodiments, the linker may have one or more Gly-Gly-Gly-Ser (GGGS) (SEQ ID NO: 102) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGS (SEQ ID NO: 102) sequences). In some embodiments, the linker may have one or more Gly-Gly-Gly-Gly- Ser (GGGGS) (SEQ ID NO: 108) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGGGS (SEQ ID NO: 108) sequences). In some embodiments, the linker may have one or more Gly-Gly-Ser-Gly (GGSG) (SEQ ID NO: 95) sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more GGSG (SEQ ID NO: 95) sequences). Examples of the linkers may include glycine polymers (G)n, glycine-serine polymers (including, for example, (GS)n, (GGS)n, (GSGGS)n (SEQ ID NO: 159) and (GGGS)n (SEQ ID NO: 102), where n is an integer of at least one), glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. Glycine and glycine-serine polymers may be relatively unstructured, and therefore may be able to serve as a neutral link between components. Glycine accesses significantly more phi-psi space than even alanine, and is much less restricted than residues with longer side
CYTX-083 chains (see Scheraga, Rev. Computational Chem. 11173-142 (1992)). Exemplary flexible linkers include one of or a combination of one or more of: GGSG (SEQ ID NO: 95), GGSGG (SEQ ID NO: 96), GSGSG (SEQ ID NO: 97), GSGGG (SEQ ID NO: 98), GGGSG (SEQ ID NO: 99), GSSSG (SEQ ID NO: 100), GSSGGSGGSGG (SEQ ID NO: 101), GGGS (SEQ ID NO: 102), GGGSGGGS (SEQ ID NO: 103), GGGSGGGSGGGS (SEQ ID NO: 104), GGGGSGGGGSGGGGS (SEQ ID NO: 105), GGGGSGGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 106), GGGGSGGGGS (SEQ ID NO: 107), GGGGS (SEQ ID NO: 108), GS, GGGGSGS (SEQ ID NO: 109), GGGGSGGGGSGGGGSGS (SEQ ID NO: 110), GGSLDPKGGGGS (SEQ ID NO: 111), PKSCDKTHTCPPCPAPELLG (SEQ ID NO: 112), SKYGPPCPPCPAPEFLG (SEQ ID NO: 113), GKSSGSGSESKS (SEQ ID NO: 114), GSTSGSGKSSEGKG (SEQ ID NO: 115), GSTSGSGKSSEGSGSTKG (SEQ ID NO: 116), GSTSGSGKPGSGEGSTKG (SEQ ID NO: 117), GSTSGSGKPGSSEGST (SEQ ID NO: 118), GGGSSGGS (SEQ ID NO: 119), GGGGSGGGGSS (SEQ ID NO: 120), GGGSSGGSGGSSGGS (SEQ ID NO: 121), and GSTSGSGKPGSSEGST (SEQ ID NO: 122). [0147] Examples of linkers may further include a sequence that is at least 70% identical (e.g., at least 72%, at least 74%, at least 75%, at least 76%, at least 78%, at least 80%, at least 82%, at least 84%, at least 85%, at least 86%, at least 88%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the example linkers described herein. An ordinarily skilled artisan will recognize that design of an activatable molecules can include linkers that are all or partially flexible, such that the linker can include a flexible linker as well as one or more portions that confer less flexible structure to provide for a desired activatable molecules structure. [0148] In some embodiments, an activatable molecule may include one, two, three, four, five, six, seven, eight, nine, or ten linker sequence(s) (e.g., the same or different linker sequences of any of the exemplary linker sequences described herein or known in the art). In some embodiments, a linker may comprise sulfo-SIAB, SMPB, and sulfo-SMPB, wherein the linkers react with primary amines sulfhydryls. Half-life extending moieties (EMs) [0149] The activatable molecule may further comprise a half-life extending moiety (EM). In some examples, the half-life extending moiety may be a serum half-life extending moiety, i.e., capable of extending the serum half-life of the molecule attached to the EM.
CYTX-083 [0150] In some examples, the EM may comprise a fragment crystallizable region (Fc domain) of an antibody. For example, the EM may be the Fc domain of an IgG (e.g., IgG1, IgG2, IgG3, or IgG4). In some examples, the EM may comprise a dimer formed by two Fc domains. The Fc domain may be a wild type peptide or a mutant. For example, the EM may comprise a dimer formed by two Fc domain mutants. In such cases, the two Fc domain mutants may be a Fc domain hole mutant and a Fc domain knob mutant. The knob and hole mutants may interact with each other to facilitate the dimerization of the two Fc domains. In some embodiments, the knob and hole mutants may comprise one or more amino acid modifications within the interface between two Fc domains (e.g., in the CH3 domain). In one example, the modifications comprise amino acid substitution T366W and optionally the amino acid substitution S354C in one IgG Fc domain and the amino acid substitutions T366S, L368A, Y407V and optionally Y349C in the other IgG Fc domain (numbering according to EU numbering system). Example of Fc mutants also include SEQ ID NOs: 123-124. [0151] Examples of the Fc domain mutants also include those described in U.S. Pat. Nos. 7,695,936, which is incorporated herein by reference in its entirety. In one example, the modifications comprise amino acid substitution T366Y in one IgG Fc domain, and the amino acid substitutions Y407T in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution T366W in one IgG Fc domain, and the amino acid substitutions Y407A in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405A in one IgG Fc domain, and the amino acid substitutions T394W in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution T366Y and F405A in one IgG Fc domain, and the amino acid substitutions T394W and Y407T in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution T366W and F405W in one IgG Fc domain, and the amino acid substitutions T394S and Y407A in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405W and Y407A in one IgG Fc domain, and the amino acid substitutions T366W and T394S in the other IgG Fc domain. In one example, the modifications comprise amino acid substitution F405W in one IgG Fc domain, and the amino acid substitutions T394S in the other IgG Fc domain. The mutation positions in the Fc domains are numbered according to EU numbering system. The IgG Fc domain may be comprise a sequence of SEQ ID NOs: 125-128 (IgG1, IgG2, IgG3 or IgG4). In these sequences, amino acids 1-107 correspond to EU numbering 341-447.
CYTX-083 [0152] In some examples, the Fc domains mutants may have reduced effector function. Examples of such Fc domains include those disclosed in in US20190135943, which incorporated herein by reference in its entirety. [0153] Further examples of EMs include immunoglobulin (e.g., IgG), serum albumin (e.g., human serum albumin (HSA), hexa-hat GST (glutathione S-transferase) glutathione affinity, Calmodulin-binding peptide (CBP), Strep-tag, Cellulose Binding Domain, Maltose Binding Protein, S-Peptide Tag, Chitin Binding Tag, Immuno-reactive Epitopes, Epitope Tags, E2Tag, HA Epitope Tag, Myc Epitope, FLAG Epitope, AU1 and AU5 Epitopes, Glu- Glu Epitope, KT3 Epitope, IRS Epitope, Btag Epitope, Protein Kinase-C Epitope, and VSV Epitope. [0154] In some embodiments, the serum half-life of an activatable molecule comprising an EM is longer than that of a counterpart molecule that is substantially the same as the activatable molecule but does not comprise the EM, e.g., the pK of the activatable molecule is longer than that of the reference molecule. In some examples, the activatable molecule with an EM may have a serum half-life that is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 2-fold, 4-fold, 6-fold, 8-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold longer than the serum half-life of the reference counterpart molecule. In some embodiments, the serum half-life of the activatable molecule with an EM may be at least 15 days, 12 days, 11 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, 1 day, 20 hours, 18 hours, 16 hours, 14 hours, 12 hours, 10 hours, 8 hours, 6 hours, 4 hours, 3 hours, 2 hours, or 1 hour when administered to an organism. Conjugation Agents [0155] In some aspects, the present disclosure provides conjugated polypeptides. In some embodiments, a conjugated polypeptide comprises a CM-containing polypeptide herein conjugated to one or more agent, e.g., a targeting moiety to facilitate delivery to a cell or tissue of interest, a therapeutic agent (e.g., an antineoplastic agent such as chemotherapeutic or anti-neoplastic agent), a toxin, or a fragment thereof. The agents may be conjugated to a component of the activatable molecules. In some embodiments, the conjugated polypeptide is an antibody-drug conjugate (ADC), which comprises an antibody or antigen-binding fragment thereof conjugated with a drug. In some examples, the antibody or antigen-binding fragment thereof may be conjugated with the drug via a CM disclosed herein. In some examples, the antibody or antigen-binding fragment thereof may be an activatable antibody
CYTX-083 or antigen-binding fragment thereof (e.g., coupled with a MM via a CM), which is further conjugated with a drug (e.g., via a cleavable or non-cleavable conjugating linker). [0156] The term “agent” is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials. Examples of the agent include toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof. [0157] In some embodiments, the activatable molecule is conjugated to a cytotoxic agent, e.g., a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof) or a radioactive isotope. [0158] Examples of cytotoxic agents include that can be conjugated to the activatable molecules dolastatins and derivatives thereof (e.g., auristatin E, AFP, monomethyl auristatin D (MMAD), monomethyl auristatin F (MMAF), monomethyl auristatin E (MMAE), desmethyl auristatin E (DMAE), auristatin F, desmethyl auristatin F (DMAF), dolastatin 16 (DmJ), dolastatin 16 (Dpv), auristatin derivatives (e.g., auristatin tyramine, auristatin quinolone), maytansinoids (e.g., DM-1, DM-4), maytansinoid derivatives, duocarmycin, alpha-amanitin, turbostatin, phenstatin, hydroxyphenstatin, spongistatin 5, spongistatin 7, halistatin 1, halistatin 2, halistatin 3, halocomstatin, pyrrolobenzimidazoles (PBI), cibrostatin6, doxaliform, cemadotin analogue (CemCH2-SH), Pseudomonas toxin A (PES8) variant, Pseudomonase toxin A (ZZ-PE38) variant, ZJ-101, anthracycline, doxorubicin, daunorubicin, bryostatin, camptothecin, 7-substituted campothecin, 11- difluoromethylenedioxycamptothecin, combretastatins, debromoaplysiatoxin, KahaMide-F, discodermolide, and Ecteinascidins. In some embodiments, the agent is DM1 or DM4. In some embodiments, the agent is a duocarmycin or derivative thereof. In some embodiments, the agent is a calicheamicin or derivative thereof. In some embodiments, the agent is a pyrrolobenzodiazepine. [0159] Examples of enzymatically active toxins that can be conjugated to the activatable molecules include diphtheria toxin, exotoxin A chain from Pseudomonas aeruginosa, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleuriies fordii proteins, dianfhin proteins, Phytolaca Americana proteins (e.g., PAPI, PAPII, and PAP-8), momordica charantia inhibitor, curcin, crotirs, sapaonaria officinalis inhibitor, geionin, mitogeliin, restrictocin, phenomycin, neomycin, and tricothecenes. A variety of radionuclides are available for the
CYTX-083 production of radioconjugated molecules. Examples of radionuclides include 212Bi, 131I, 131In, 90Y, and 186Re. [0160] Examples of anti-neoplastics that can be conjugated to the activatable molecules include: adriamycin, cerubidine, bleomycin, alkeran, velban, oncovin, fluorouracil, methotrexate, thiotepa, bisantrene, novantrone, thioguanine, procarabizine, and cytarabine. [0161] Examples of antivirals that can be conjugated to the activatable molecules include acyclovir, vira A, and symmetrel. Examples of antifungals that can be conjugated to the activatable molecules include: nystatin. Examples of detection reagents that can be conjugated to the activatable molecules include: fluorescein and derivatives thereof, fluorescein isothiocyanate (FITC). Examples of antibacterials that can be conjugated to the activatable molecules include: aminoglycosides, streptomycin, neomycin, kanamycin, amikacin, gentamicin, and tobramycin. Examples of 3beta,16beta,17alpha-trihydroxycholest- 5-en-22-one 16-O-(2-O-4-methoxybenzoyl-beta-D-xylopyranosyl)-(1-->3)-(2-O-acetyl- alpha-L-arabinopyranoside) (OSW-1) that can be conjugated to the activatable molecules include: s-nitrobenzyloxycarbonyl derivatives of O6-benzylguanine, toposisomerase inhibitors, hemiasterlin, cephalotaxine, homoharringionine, pyrrol obenzodiazepine dimers (PBDs), functionalized pyrrolobenzodiazepenes, calcicheamicins, podophyiitoxins, taxanes, and vinca alkoids. Examples of radiopharmaceuticals that can be conjugated to the activatable molecules include: 123I , 89Zr, 125I, 131I, 201T1, 62Cu, 18F, 68Ga, 13N, 15O, 38K, 82Rb, 111In, 133Xe, 11C, and 99mTc (Technetium). Examples of heavy metals that can be conjugated to the activatable molecules include: barium, gold, and platinum. Examples of anti-mycoplasmals that can be conjugated to the activatable molecules include: tylosine, spectinomycin, streptomycin B, ampicillin, sulfanilamide, polymyxin, and chloramphenicol. [0162] In some embodiments, the agent is a nucleic acid damaging agent, such as a DNA alkylator or DNA intercalator, or other DNA damaging agent. [0163] Additional examples of the agents that can be conjugated include those in Table 1 below. Table 1: Exemplary Pharmaceutical Agents for Conjugation CYTOTOXIC AGENTS
CYTX-083 Desmethyl auristatin E (DMAE) Spongistatin 7 Auristatin F Halistatin 1 M hl i i F MMAF Hli i 2
CYTX-083 Velban 11C Oncovin 62Cu Fl il 18F
[0164] In some embodiments, the activatable molecule comprises a signal peptide. If comprising multiple polypeptides, the activatable molecule may comprise multiple signal peptides, e.g., one signal peptide for each of the multiple polypeptides. A signal peptide may be a peptide (e.g., 10-30 amino acids long) present at a terminus (e.g., the N-terminus or C- terminus) of a newly synthesized proteins that are destined toward the secretory pathway. In some embodiments, the signal peptide may be conjugated to the activatable molecule via a spacer. In some embodiments, the spacer may be conjugated to the activatable molecule in the absence of a signal peptide. [0165] Those of ordinary skill in the art will recognize that a large variety of possible agents may be conjugated to any of the activatable molecules described herein. The agents may be conjugated to another component of the activatable molecule by a conjugating linker. Conjugation may include any chemical reaction that binds the two molecules so long as the activatable molecule and the other moiety retain their respective activities. Conjugation may
CYTX-083 include many chemical mechanisms, e.g., covalent binding, affinity binding, intercalation, coordinate binding, and complexation. In some embodiments, the binding may be covalent binding. Covalent binding may be achieved either by direct condensation of existing side chains or by the incorporation of external bridging molecules. Many bivalent or polyvalent linking agents may be useful in conjugating any of the activatable molecules described herein. For example, conjugation may include organic compounds, such as thioesters, carbodiimides, succinimide esters, glutaraldehyde, diazobenzenes, and hexamethylene diamines. In some embodiments, the activatable molecules may include, or otherwise introduce, one or more non-natural amino acid residues to provide suitable sites for conjugation. [0166] In some embodiments, an agent is attached by disulfide bonds (e.g., disulfide bonds on a cysteine molecule) to the activatable molecule. Since many cancers naturally release high levels of glutathione, a reducing agent, glutathione present in the cancerous tissue microenvironment can reduce the disulfide bonds, and subsequently release the agent at the site of delivery. [0167] In some embodiments, when the agent binds its target in the presence of complement within the target site (e.g., diseased tissue (e.g., cancerous tissue)), the amide or ester bond attaching the agent to the linker is cleaved, resulting in the release of the agent in its activated form. These agents when administered to a subject, may accomplish delivery and release of the agent at the target site (e.g., diseased tissue (e.g., cancerous tissue)). These agents may be effective for the in vivo delivery of any of the agents described herein. [0168] In some embodiments, the one or more agents is conjugated to a component of the activatable molecule (e.g., AM) via a conjugating linker. The conjugating linker may be a peptide or chemical moiety linking the agent and the activatable molecule. In some examples, the conjugating linker may be cleavable (e.g., by an enzyme such as a protease). In some examples, the conjugating linker may be non-cleavable (e.g., cannot be cleaved by an enzyme such as a protease). In some embodiments, the conjugating linker may be non-cleavable by enzymes of the complement system. In some embodiments, two or more conjugating linkers are present. The two or more conjugating linkers may be the same, i.e., cleavable or non- cleavable. The two or more conjugating linkers may be different, i.e., at least one cleavable and at least one non-cleavable. For example, the agent may be released without complement activation since complement activation ultimately lyses the target cell. In such embodiments, the conjugate and/or agent is to be delivered to the target cell (e.g., hormones, enzymes,
CYTX-083 corticosteroids, neurotransmitters, or genes). Furthermore, the conjugating linker may be mildly susceptible to cleavage by serum proteases, and the conjugate and/or agent is released slowly at the target site. [0169] In some embodiments, the agent is conjugated to a component of the activatable molecule via a maleimide caproyl-valine-citrulline linker or a maleimide PEG-valine- citrulline linker. In some embodiments, the agent is conjugated to a component of the activatable molecule via a maleimide caproyl-valine-citrulline linker. In some embodiments, the agent is conjugated to a component of the activatable molecule via a maleimide PEG- valine-citrulline linker. In some embodiments, the agent is monomethyl auristatin D (MMAD) conjugated to a component of the activatable molecule via a maleimide PEG- valine-citrulline-para-aminobenzyloxycarbonyl linker, and this linker payload construct is vc- MMAD. In some embodiments, the agent is monomethyl auristatin E (MMAE) conjugated to a component of the activatable molecule via a maleimide PEG-valine-citrulline-para- aminobenzyloxycarbonyl linker, and this linker payload construct is vc-MMAE. [0170] In some embodiments, the agent may be designed such that the agent is delivered to the target site (e.g., disease tissue (e.g., cancerous tissue)) but the conjugate and/or agent is not released. [0171] In some embodiments, the agent may be attached to an AM either directly or via amino acids (e.g., D-amino acids), peptides, thiol-containing moieties, or other organic compounds that may be modified to include functional groups that can subsequently be utilized in attachment to AM by methods described herein. [0172] In some embodiments, an activatable molecule includes at least one point of conjugation for an agent. In some embodiments, all possible points of conjugation are available for conjugation to an agent. In some embodiments, the one or more points of conjugation may include sulfur atoms involved in disulfide bonds, sulfur atoms involved in interchain disulfide bonds, sulfur atoms involved in interchain sulfide bonds but not sulfur atoms involved in intrachain disulfide bonds, and/or sulfur atoms of cysteine or other amino acid residues containing a sulfur atom. In such cases, residues may occur naturally in the protein construct structure or may be incorporated into the protein construct using methods including site-directed mutagenesis, chemical conversion, or mis-incorporation of non- natural amino acids.
CYTX-083 [0173] The present disclosure also provides methods and materials for preparing an activatable molecule with one or more conjugated agents. In some embodiments, an activatable molecule may be modified to include one or more interchain disulfide bonds. For example, disulfide bonds may undergo reduction following exposure to a reducing agent such DV^^ZLWKRXW^OLPLWDWLRQ^^7&(3^^'77^^RU^ȕ-mercaptoethanol. In some cases, the reduction of the disulfide bonds may be only partial. As used herein, the term partial reduction refers to situations where an activatable molecule is contacted with a reducing agent and a fraction of all possible sites of conjugation undergo reduction (e.g., not all disulfide bonds are reduced). In some embodiments, an activatable molecule may be partially reduced following contact with a reducing agent if less than 99%, (e.g., less than 98%, 97%, 96%, 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or 5%) of all possible sites of conjugation are reduced. In some embodiments, the activatable molecule having a reduction in one or more interchain disulfide bonds may be conjugated to a drug reactive with free thiols. [0174] The present disclosure also provides methods and materials for conjugating a therapeutic agent to a particular location on an activatable molecule. In some embodiments, an activatable molecule may be modified so that the therapeutic agents can be conjugated to the activatable molecule at particular locations on the activatable molecule. For example, an activatable molecule may be partially reduced in a manner that facilitates conjugation to the activatable molecule. In such cases, partial reduction of the activatable molecule may occur in a manner that conjugation sites in the activatable molecule are not reduced. In some embodiments, the conjugation site(s) on the activatable molecule may be selected to facilitate conjugation of an agent at a particular location on the protein construct. Various factors can influence the “level of reduction” of the activatable molecule upon treatment with a reducing agent. For example, without limitation, the ratio of reducing agent to activatable molecule, length of incubation, incubation temperature, and/or pH of the reducing reaction solution can require optimization in order to achieve partial reduction of the activatable molecule with the methods and materials described herein. Any appropriate combination of factors (e.g., ratio of reducing agent to activatable molecule, the length and temperature of incubation with reducing agent, and/or pH of reducing agent) may be used to achieve partial reduction of the activatable molecule (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites).
CYTX-083 [0175] An effective ratio of reducing agent to activatable molecule can be any ratio that at least partially (i.e., partially or fully) reduces the activatable molecule in a manner that allows conjugation to an agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites). In some embodiments, the ratio of reducing agent to activatable molecule may be in a range from about 20:1 to 1:1, from 10:1 to 1:1, from 9:1 to 1:1, from 8:1 to 1:1, from 7:1 to 1:1, from 6:1 to 1:1, from 5:1 to 1:1, from 4:1 to 1:1, from 3:1 to 1:1, from 2:1 to 1:1, from 20:1 to 1:1.5, from 10:1 to 1:1.5, from 9:1 to 1:1.5, from 8:1 to 1:1.5, from 7:1 to 1:1.5, from 6:1 to 1:1.5, from 5:1 to 1:1.5, from 4:1 to 1:1.5, from 3:1 to 1:1.5, from 2:1 to 1:1.5, from 1.5:1 to 1:1.5, or from 1:1 to 1:1.5. [0176] An effective incubation time and temperature for treating an activatable molecule with a reducing agent may be any time and temperature that at least partially reduces the activatable molecule in a manner that allows conjugation of an agent to an activatable molecule (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites). In some embodiments, the incubation time and temperature for treating an activatable molecule may be in a range from about 1 hour at 37 °C to about 12 hours at 37 °C (or any subranges therein). [0177] An effective pH for a reduction reaction for treating an activatable molecule with a reducing agent can be any pH that at least partially reduces the activatable molecule in a manner that allows conjugation of the activatable molecule to an agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites). [0178] When a partially-reduced activatable molecule is contacted with an agent containing thiols, the agent may conjugate to the interchain thiols in the activatable molecule. An agent can be modified in a manner to include thiols using a thiol-containing reagent (e.g., cysteine or N-acetyl cysteine). For example, the activatable molecule can be partially reduced following incubation with reducing agent (e.g., TEPC) for about 1 hour at about 37 °C at a desired ratio of reducing agent to activatable molecule. An effective ratio of reducing agent to activatable molecule may be any ratio that partially reduces at least two interchain disulfide bonds located in the activatable molecule in a manner that allows conjugation of a thiol- containing agent (e.g., general reduction of possible conjugation sites or reduction at specific conjugation sites). [0179] In some embodiments, an activatable molecule may be reduced by a reducing agent in a manner that avoids reducing any intrachain disulfide bonds. In some embodiments
CYTX-083 of, an activatable molecule may be reduced by a reducing agent in a manner that avoids reducing any intrachain disulfide bonds and reduces at least one interchain disulfide bond. [0180] In some embodiments, the agent may be a detectable moiety such as, for example, a label or other marker. For example, the agent may be or include a radiolabeled amino acid, one or more biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or calorimetric methods), one or more radioisotopes or radionuclides, one or more fluorescent labels, one or more enzymatic labels, and/or one or more chemiluminescent agents. In some embodiments, detectable moieties may be attached by spacer molecules. In some embodiments, the detectable label may include an imaging agent, a contrasting agent, an enzyme, a fluorescent label, a chromophore, a dye, one or more metal ions, or a ligand-based label. In some embodiments, the imaging agent may comprise a radioisotope. In some embodiments, the radioisotope may be indium or technetium. In some embodiments, the contrasting agent may comprise iodine, gadolinium or iron oxide. In some embodiments, the HQ]\PH^PD\^FRPSULVH^KRUVHUDGLVK^SHUR[LGDVH^^DONDOLQH^SKRVSKDWDVH^^RU^ȕ-galactosidase. In some embodiments, the fluorescent label may comprise yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), green fluorescent protein (GFP), modified red fluorescent protein (mRFP), red fluorescent protein tdimer2 (RFP tdimer2), HCRED, or a europium derivative. In some embodiments, the luminescent label may comprise an N- methylacrydium derivative. In some embodiments, the label may comprise an Alexa Fluor® label, such as Alex Fluor® 680 or Alexa Fluor® 750. In some embodiments, the ligand-based label may comprise biotin, avidin, streptavidin or one or more haptens. [0181] Further examples of detectable labels also include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline SKRVSKDWDVH^^ȕ-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125I, 131I, 35S or 3H.
CYTX-083 [0182] In some embodiments, the agent may be conjugated to the activatable molecule using a carbohydrate moiety, sulfhydryl group, amino group, or carboxylate group. In some embodiments, the agent may be conjugated to the activatable molecule via a linker and/or a CM described herein. In some embodiments, the agent may be conjugated to a cysteine or a lysine in the activatable molecule. In some embodiments, the agent may be conjugated to another residue of the activatable molecule, such as those residues disclosed herein. [0183] In some embodiments, a variety of bifunctional protein-coupling agents may be used to conjugate the agent to the activatable molecule including N-succinimidyl-3-(2- pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (e.g., dimethyl adipimidate HCL), active esters (e.g., disuccinimidyl suberate), aldehydes (e.g., glutareldehyde), bis-azido compounds (e.g., bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (e.g., bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (e.g., tolyene 2,6-diisocyanate), and bis-active fluorine compounds (e.g., 1,5-difluoro-2,4- dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238: 1098 (1987). In some embodiments, a carbon-14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) chelating agent can be used to conjugate a radionucleotide to the activatable molecule. (See, e.g., WO94/11026). [0184] Suitable conjugating linkers also include those described in the literature. (See, for example, Ramakrishnan, S. et al., Cancer Res.44:201-208 (1984) describing use of MBS (M- maleimidobenzoyl-N-hydroxysuccinimide ester). See also, U.S. Patent No. 5,030,719, describing use of halogenated acetyl hydrazide derivative coupled to an activatable molecule by way of an oligopeptide. In some embodiments, suitable conjugating linkers include: (i) EDC (1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride; (ii) SMPT (4- succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene (Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6 [3-(2-pyridyldithio) propionamido] hexanoate (Pierce Chem. Co., Cat #21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6 [3-(2- pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat. #2165-G); and (v) sulfo- NHS (N-hydroxysulfo-succinimide: Pierce Chem. Co., Cat. #24510) conjugated to EDC. Additional example agents include SMCC, sulfo-SMCC, SPDB, and sulfo-SPDB. [0185] Exemplary conjugating linkers for attachment to reduced activatable molecules include those having certain reactive groups capable of reaction with a sulfhydryl group of a
CYTX-083 reduced antibody or fragment. Such reactive groups include reactive haloalkyl groups (including, for example, haloacetyl groups), p-mercuribenzoate groups and groups capable of Michael-type addition reactions (including, for example, maleimides and groups of the type described by Mitra and Lawton, 1979, J. Amer. Chem. Soc.101: 3097-3110). [0186] Exemplary conjugating linkers for attachment to neither oxidized nor reduced activatable molecules include those having certain functional groups capable of reaction with the primary amino groups present in unmodified lysine residues in the activatable molecules. Such reactive groups include NHS carboxylic or carbonic esters, sulfo-NHS carboxylic or carbonic esters, 4-nitrophenyl carboxylic or carbonic esters, pentafluorophenyl carboxylic or carbonic esters, acyl imidazoles, isocyanates, and isothiocyanates, and other dehydrating agents utilized for carboxamide formation. In these instances, the functional groups present in the suitable conjugating linkers include primary and secondary amines, hydrazines, hydroxylamines, and hydrazides. [0187] The agent may be attached to the conjugating linker before or after the conjugating linker is attached to the activatable molecule. In certain applications it may be desirable to first produce an activatable molecule-conjugating linker intermediate in which the conjugating linker is free of an associated agent. Depending upon the particular application, a specific agent may then be covalently attached to the conjugating linker. In some embodiments, the AM is first attached to the MM, CM and associated linking peptides and then attached to the conjugating linker for conjugation purposes. [0188] In specific embodiments, branched conjugating linkers that have multiple sites for attachment of agents are utilized. For multiple site conjugating linkers, a single covalent attachment to an activatable molecule may result in an activatable molecule-linker intermediate capable of binding an agent at a number of sites. The sites may be aldehyde or sulfhydryl groups or any chemical site to which agents can be attached. [0189] In some embodiments, higher specific activity (or higher ratio of agents to activatable molecule) can be achieved by attachment of a single site conjugating linker at a plurality of sites on the activatable molecule. This plurality of sites may be introduced into the activatable molecule by either of two methods. First, one may generate multiple aldehyde groups and/or sulfhydryl groups in the same activatable molecule. Second, one may attach to an aldehyde or sulfhydryl of the activatable molecule a branched conjugating linker having multiple functional sites for subsequent attachment to conjugating linkers. The functional
CYTX-083 sites of the branched conjugating linker or multiple site conjugating linker may be aldehyde or sulfhydryl groups, or may be any chemical site to which conjugating linkers may be attached. Still higher specific activities may be obtained by combining these two approaches, that is, attaching multiple site conjugating linkers at several sites on the activatable molecule. [0190] Peptide conjugating linkers that are susceptible to cleavage by enzymes of the complement system, such as but not limited to u-plasminogen activator, tissue plasminogen activator, trypsin, plasmin, or another enzyme having proteolytic activity may be used in one embodiment of the present disclosure. According to one method of the present disclosure, an agent is attached via a conjugating linker susceptible to cleavage by complement. The antibody is selected from a class that can activate complement. The antibody-agent conjugate, thus, activates the complement cascade and releases the agent at the target site. According to another method of the present disclosure, an agent is attached via a conjugating linker susceptible to cleavage by enzymes having a proteolytic activity such as a u-plasminogen activator, a tissue plasminogen activator, plasmin, or trypsin. These cleavable conjugating linkers are useful in conjugated activatable molecules that include an extracellular toxin, e.g., by way of non-limiting example, any of the extracellular toxins shown in Table 1. [0191] Non-limiting examples of cleavable linker sequences include any cleavable sequence disclosed herein or incorporated herein by reference as well as the exemplary sequences provided in Table 2. Table 2: Exemplary Conjugating Linker Sequences for Conjugation Types of Cleavable Sequences Amino Acid Sequence
CYTX-083 &DOI^VNLQ^FROODJHQ^^Į^^,^^FKDLQ^ GPQGIAGQ (SEQ ID NO: 139) &DOI^VNLQ^FROODJHQ^^Į^^,^^FKDLQ^ GPQGLLGA (SEQ ID NO: 140) RYL H^FD L D H^FR D H ^^ ^^ ^^FKDL ^ IA E ID 141
, g y p , e disulfide bonds on a cysteine molecule) to the activatable molecule. Since many tumors naturally release high levels of glutathione (a reducing agent) this can reduce the disulfide bonds with subsequent release of the agent at the site of delivery. In some embodiments, the reducing agent that would modify a CM would also modify the conjugating linker of the conjugated activatable molecule. [0193] In some embodiments, it may be necessary to construct the conjugating linker in such a way as to optimize the spacing between the agent and the activatable molecule. This may be accomplished by use of a conjugating linker of the general structure: W – (CH2)n – Q wherein W is either -NH-CH2- or -CH2-; Q is an amino acid, a polypeptide having between 2 to 20 amino acids; and n is an integer from 0 to 20. [0194] In some embodiments, the conjugating linker may comprise a spacer element and a cleavable element. The spacer element serves to position the cleavable element away from the core of the activatable molecule such that the cleavable element is more accessible to the
CYTX-083 enzyme responsible for cleavage. Certain of the branched linkers described above may serve as spacer elements. [0195] Throughout this discussion, it should be understood that attachment of the conjugating linker to the agent (or of spacer element to cleavable element, or cleavable element to agent) need not be by a particular mode of attachment or reaction. Any reaction providing a product of suitable stability and biological compatibility is acceptable. [0196] In some embodiments, when release of an agent is desired, an activatable molecule that is an antibody of a class that can activate complement is used. The resulting conjugate retains both the ability to bind antigen and activate the complement cascade. Thus, according to this embodiment of the present disclosure, an agent is joined to one end of the cleavable conjugating linker or cleavable element and the other end of the conjugating linker group is attached to a specific site on the activatable molecule. For example, if the agent has a hydroxyl group or an amino group, it may be attached to the carboxyl terminus of a peptide, amino acid or other suitably chosen conjugating linker via an ester or amide bond, respectively. For example, such agents may be attached to the linker peptide via a carbodimide reaction. If the agent contains functional groups that would interfere with attachment to the conjugating linker, these interfering functional groups can be blocked before attachment and deblocked once the product conjugate or intermediate is made. The opposite or amino terminus of the linker is then used either directly or after further modification for binding to an activatable molecule that is capable of activating complement. [0197] Conjugating linkers (or spacer elements of conjugating linkers) may be of any desired length, one end of which can be covalently attached to specific sites on the activatable molecule. The other end of the conjugating linker or spacer element may be attached to an amino acid or peptide conjugating linker. [0198] Thus when these conjugates bind antigen in the presence of complement the amide or ester bond that attaches the agent to the linker will be cleaved, resulting in release of the agent in its active form. These conjugates, when administered to a subject, will accomplish delivery and release of the agent at the target site, and are particularly effective for the in vivo delivery of pharmaceutical agents, antibiotics, antimetabolites, antiproliferative agents and the like. [0199] In some embodiments, release of the agent without complement activation is desired since activation of the complement cascade will ultimately lyse the target cell. Hence,
CYTX-083 this approach is useful when delivery and release of the agent should be accomplished without killing the target cell. Such is the goal when delivery of cell mediators such as hormones, enzymes, corticosteroids, neurotransmitters, genes or enzymes to target cells is desired. These conjugates may be prepared by attaching the agent to an activatable molecule that is not capable of activating complement via a linker that is mildly susceptible to cleavage by serum proteases. When this conjugate is administered to an individual, antigen-antibody complexes will form quickly whereas cleavage of the agent will occur slowly, thus resulting in release of the compound at the target site. [0200] In some embodiments, the activatable molecule may be conjugated to one or more therapeutic agents using certain biochemical cross-linkers. Cross-linking reagents form molecular bridges that tie together functional groups of two different molecules. To link two different proteins in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation. [0201] Peptidyl conjugating linkers cleavable by lysosomal proteases are also useful, for example, Val-Cit, Val-Ala or other dipeptides. In addition, acid-labile conjugating linkers cleavable in the low-pH environment of the lysosome may be used, for example: bis-sialyl ether. Other suitable conjugating linkers include cathepsin-labile substrates, particularly those that show optimal function at an acidic pH. [0202] Exemplary hetero-bifunctional cross-linkers are referenced in Table 3. Table 3: Exemplary Hetero-Bifunctional Cross-Linkers HETERO-BIFUNCTIONAL CROSS-LINKERS Spacer Arm Length after Advantages and cross-linking Linker Reactive Toward Applications (Angstroms) SMPT Primary amines Greater stability 11.2 Å Sulfhydryls SPDP Primary amines Thiolation 6.8 Å Sulfhydryls Cleavable cross-linking LC-SPDP Primary amines Extended spacer arm 15.6 Å Sulfhydryls Sulfo-LC-SPDP Primary amines Extender spacer arm 15.6 Å Sulfhydryls Water-soluble
CYTX-083 SMCC Primary amines Stable maleimide reactive 11.6 Å group Sulfhydryls Enzyme-antibody conjugation Hapten-carrier protein conjugation Sulfo-SMCC Primary amines Stable maleimide reactive 11.6 Å group Sulfhydryls Water-soluble Enzyme-antibody conjugation MBS Primary amines Enzyme-antibody 9.9 Å conjugation Sulfhydryls Hapten-carrier protein conjugation Sulfo-MBS Primary amines Water-soluble 9.9 Å Sulfhydryls SIAB Primary amines Enzyme-antibody 10.6 Å conjugation Sulfhydryls Sulfo-SIAB Primary amines Water-soluble 10.6 Å Sulfhydryls SMPB Primary amines Extended spacer arm 14.5 Å Sulfhydryls Enzyme-antibody conjugation Sulfo-SMPB Primary amines Extended spacer arm 14.5 Å Sulfhydryls Water-soluble EDE/Sulfo- Primary amines Hapten-Carrier conjugation 0 NHS Carboxyl groups ABH Carbohydrates Reacts with sugar groups 11.9 Å Nonselective [0203] In some embodiments, the agent may be designed so that the agent is delivered to the target but not released. This may be accomplished by attaching an agent to an activatable molecule either directly or via a non-cleavable conjugating linker. [0204] These non-cleavable conjugating linkers may include amino acids, peptides, D- amino acids or other organic compounds that may be modified to include functional groups that can subsequently be utilized in attachment to activatable molecules by the methods described herein. [0205] In some embodiments, a compound may be attached to activatable molecules that do not activate complement. When using activatable molecules that are incapable of
CYTX-083 complement activation, this attachment may be accomplished using conjugating linkers that are susceptible to cleavage by activated complement or using linkers that are not susceptible to cleavage by activated complement. [0206] The CM-containing polypeptides disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos.4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556. Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. A component of an activatable molecule can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction. [0207] The agents described above may contain components that have different attributes, thus leading to conjugates with differing physio-chemical properties. For example, sulfo- NHS esters of alkyl carboxylates are more stable than sulfo-NHS esters of aromatic carboxylates. NHS-ester containing linkers are less soluble than sulfo-NHS esters. Further, the SMPT contains a sterically-hindered disulfide bond, and can form conjugates with increased stability. Disulfide linkages, are in general, less stable than other linkages because the disulfide linkage is cleaved in vitro, resulting in less conjugate available. Sulfo-NHS, in particular, can enhance the stability of carbodimide couplings. Carbodimide couplings (such as EDC) when used in conjunction with sulfo-NHS, forms esters that are more resistant to hydrolysis than the carbodimide coupling reaction alone. [0208] Those of ordinary skill in the art will recognize that a large variety of possible agents can be conjugated to the activatable molecule of the disclosure. (See, for example, “Conjugate Vaccines”, Contributions to Microbiology and Immunology, J. M. Cruse and R. E. Lewis, Jr (eds), Carger Press, New York, (1989), the entire contents of which are incorporated herein by reference). In general, an effective conjugation of an agent (e.g., cytotoxic agent) to an activatable molecule can be accomplished by any chemical reaction that will bind the agent to the activatable molecule while also allowing the agent and the activatable molecule to retain functionality.
CYTX-083 NUCLEIC ACIDS AND VECTORS [0209] In some aspects, the present disclosure further provides nucleic acids comprising sequences that encode the CM-containing polypeptides and polypeptide complexes (e.g., activatable molecules) herein, or components or fragment thereof. The nucleic acids may comprise coding sequences for the CMs. The nucleic acids may further comprise coding sequences for other components in an activatable molecule, e.g., the AMs, the MMs, the EM and/or the linker(s). In cases where the activatable molecule comprises multiple polypeptides, the nucleic acids may comprise coding sequences for the multiple polypeptides. In some examples, the coding sequence for one of the polypeptides is comprised in a nucleic acid molecule, and the coding sequence for another one of the polypeptides is comprised in another nucleic acid molecule. In some examples, the coding sequences for two or more of the multiple polypeptides are comprised in the same nucleic acid molecule. [0210] Unless otherwise specified, a “nucleic acid sequence encoding a protein” includes all nucleotide sequences that are degenerate versions of each other and thus encode the same amino acid sequence. The term “nucleic acid” refers to a deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), or a combination thereof, in either a single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses complementary sequences as well as the sequence explicitly indicated. In some embodiments, the nucleic acid is DNA. In some embodiments, the nucleic acid is RNA. [0211] Modifications may be introduced into a nucleotide sequence by standard techniques known in the art, such as site-directed mutagenesis and polymerase chain reaction (PCR)-mediated mutagenesis. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include: amino acids with acidic side chains (e.g., aspartate and glutamate), amino acids with basic side chains (e.g., lysine, arginine, and histidine), non-polar amino acids (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan), uncharged polar amino acids (e.g., glycine, asparagine, glutamine, cysteine, serine, threonine and tyrosine), hydrophilic amino acids (e.g., arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine), hydrophobic amino acids (e.g., alanine,
CYTX-083 cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine, and valine). Other families of amino acids include: aliphatic-hydroxy amino acids (e.g., serine and threonine), amide family (e.g., asparagine and glutamine), alphatic family (e.g., alanine, valine, leucine and isoleucine), and aromatic family (e.g., phenylalanine, tryptophan, and tyrosine). [0212] The present disclosure further provides vectors and sets of vectors comprising any of the nucleic acids described herein. One skilled in the art will be capable of selecting suitable vectors or sets of vectors (e.g., expression vectors) for making any of the activatable molecules described herein, and using the vectors or sets of vectors to express any of the activatable molecules described herein. For example, in selecting a vector or a set of vectors, the type of cell may be selected such that the vector(s) may need to be able to integrate into a chromosome of the cell and/or replicate in it. Example vectors that can be used to produce an activatable molecule are also described herein. As used herein, the term “vector” refers to a polynucleotide capable of inducing the expression of a recombinant protein (e.g., a first or second monomer) in a cell (e.g., any of the cells described herein). A “vector” is able to deliver nucleic acids and fragments thereof into a host cell, and includes regulatory sequences (e.g., promoter, enhancer, poly(A) signal). Exogenous polynucleotides may be inserted into the expression vector in order to be expressed. The term “vector” also includes artificial chromosomes, plasmids, retroviruses, and baculovirus vectors. [0213] Methods for constructing suitable vectors that comprise any of the nucleic acids described herein, and suitable for transforming cells (e.g., mammalian cells) are well-known in the art. See, e.g., Sambrook et al., Eds. “Molecular Cloning: A Laboratory Manual,” 2nd Ed., Cold Spring Harbor Press, 1989 and Ausubel et al., Eds. “Current Protocols in Molecular Biology,” Current Protocols, 1993. [0214] Examples of vectors include plasmids, transposons, cosmids, and viral vectors (e.g., any adenoviral vectors (e.g., pSV or pCMV vectors), adeno-associated virus (AAV) vectors, lentivirus vectors, and retroviral vectors), and any Gateway® vectors. A vector may, for example, include sufficient cis-acting elements for expression; other elements for expression may be supplied by the host mammalian cell or in an in vitro expression system. Skilled practitioners will be capable of selecting suitable vectors and mammalian cells for making any activatable molecule described herein.
CYTX-083 [0215] In some embodiments, the CM-containing polypeptides may be made biosynthetically using recombinant DNA technology and expression in eukaryotic or prokaryotic species. CELLS [0216] In some aspects, the present disclosure provides recombinant host cells comprising any of the vectors or nucleic acids described herein. The cells may be used to produce the CM-containing polypeptides (e.g., activatable molecules) described herein. In some embodiments, the cell may be an animal cell, a mammalian cell (e.g., a human cell), a rodent cell (e.g., a mouse cell, a rat cell, a hamster cell, or a guinea pig cell), a non-human primate cell, an insect cell, a bacterial cell, a fungal cell, or a plant cell. In some embodiments, the cell may be a eukaryotic cell. As used herein, the term “eukaryotic cell” refers to a cell having a distinct, membrane-bound nucleus. Such cells may include, for example, mammalian (e.g., rodent, non-human primate, or human), insect, fungal, or plant cells. In some embodiments, the eukaryotic cell is a yeast cell, such as Saccharomyces cerevisiae. In some embodiments, the eukaryotic cell is a higher eukaryote, such as mammalian, avian, plant, or insect cells. Non-limiting examples of mammalian cells include Chinese hamster ovary (CHO) cells and human embryonic kidney cells (e.g., HEK293 cells). In some embodiments, the cell may be a prokaryotic cell, e.g., an E coli cell. [0217] Methods of introducing nucleic acids and vectors (e.g., any of the vectors or any of the sets of vectors described herein) into a cell are known in the art. Examples of methods that can be used to introducing a nucleic acid into a cell include: lipofection, transfection, calcium phosphate transfection, cationic polymer transfection, viral transduction (e.g., adenoviral transduction, lentiviral transduction), nanoparticle transfection, and electroporation. [0218] In some embodiments, the introducing step includes introducing into a cell a vector (e.g., any of the vectors or sets of vectors described herein) including a nucleic acid encoding the monomers that make up any activatable molecule described herein. COMPOSITIONS AND KITS [0219] The present disclosure also provides compositions and kits comprising the CM- containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein. The compositions and kits may further comprise one or more excipients, carriers, reagents, instructions needed for the use of the activatable molecules.
CYTX-083 [0220] In some embodiments, the compositions may be pharmaceutical compositions, which comprise the CM-containing polypeptides, derivatives, fragments, analogs and homologs thereof. The pharmaceutical compositions may comprise the CM-containing and a pharmaceutically acceptable carrier. As used herein, the term “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington’s Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Suitable examples of such carriers or diluents include water, saline, ringer’s solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions. [0221] A pharmaceutical composition may be formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (e.g., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application may include one or more of the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH may be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. In some, any of the activatable molecules described herein are prepared with carriers that protect against rapid elimination from the body, e.g., sustained and controlled release formulations, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, e.g., ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen,
CYTX-083 polyorthoesters, polylactic-co-glycolic acid, and polylactic acid. Methods for preparation of such pharmaceutical compositions and formulations are apparent to those skilled in the art. For example, the activatable molecules may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions. [0222] Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the CM-containing polypeptides, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides, copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers (e.g., injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-^í^-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. [0223] In some embodiments, pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor® EL (CAS No. 61791-12-6) (BASF, Parsippany, N.J.), which is a mixture of polyoxyethylated triglycerides, by reacting castor oil with ethylene oxide in a molar ratio of 1 : 35, that acts as a nonionic surfactant, or phosphate buffered saline (PBS). The composition may be sterile and should be fluid and of a viscosity that facilitates easy syringeability. It may be stable under the conditions of manufacture and storage and preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier may be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. For dispersed particulate compositions, the proper fluidity can be maintained, for
CYTX-083 example, by the use of a coating on the particles such as lecithin, and by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In some embodiments, the pharmaceutical compositions may further comprise one or more antibacterial and/or antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In some embodiments, isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, and the like, as well as salts, such as, for example, sodium chloride and the like may be included in the composition. Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin. [0224] In some embodiments, the pharmaceutical composition may comprise a sterile injectable solution. Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions may be prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. [0225] In some embodiments, the pharmaceutical composition may comprise an oral composition. Oral compositions may include an inert diluent or an edible carrier. They may be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound may be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions may also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials may be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primojel®(sodium starch glycolate), or corn starch; a lubricant such as magnesium stearate; a
CYTX-083 glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. [0226] In some embodiments, the pharmaceutical composition may be formulized for administration by inhalation. For example, the compounds may be delivered in the form of an aerosol spray from pressured container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer. [0227] In some embodiments, the pharmaceutical composition may be formulized for systemic administration. For example, systemic administration may be by intravenous, as well by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated may be used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration may be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds may be formulated into ointments, salves, gels, or creams as generally known in the art. [0228] In some embodiments, the pharmaceutical composition may be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery. [0229] In one embodiment, the pharmaceutical composition may be prepared with carriers that protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers may be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic-co-glycolic acid and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. [0230] It may be advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the disclosure may be dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic
CYTX-083 effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals. [0231] In some embodiments, the compositions (e.g., pharmaceutical compositions) may be included in a container, vial, syringe, injector pen, pack, or dispenser, optionally together with instructions for administration. [0232] Also provided herein are kits that include any of the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein, any of the compositions that include any of the polypeptides described herein, or any of the pharmaceutical compositions that include any of the polypeptides described herein. Also provided are kits that include one or more second therapeutic agent(s) in addition to a polypeptide described herein. The second therapeutic agent(s) may be provided in a dosage administration form that is separate from the polypeptides herein. Alternatively, the second therapeutic agent(s) may be formulated together with the polypeptides herein. [0233] Any of the kits described herein can include instructions for using any of the compositions (e.g., pharmaceutical compositions) and/or any of the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein. In some embodiments, the kits can include instructions for performing any of the methods described herein. In some embodiments, the kits can include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein. In some embodiments, the kits can provide a syringe for administering any of the pharmaceutical compositions described herein. [0234] Also provided herein are CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) produced by any of the methods described herein. Also provided are compositions (e.g., pharmaceutical compositions) that comprise any of the polypeptides produced by any of the methods described herein. Also provided herein are kits that include at least one dose of any of the compositions (e.g., pharmaceutical compositions) described herein. METHODS OF PRODUCING CM-CONTAINING POLYPEPTIDES [0235] Provided herein are methods of producing the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein that include: (a) culturing any of the recombinant host cells described herein in a liquid culture medium under conditions
CYTX-083 sufficient to produce the CM-containing polypeptides; and (b) recovering the CM-containing polypeptides from the host cell and/or the liquid culture medium. [0236] Methods of culturing cells are well known in the art. In some embodiments, cells may be maintained in vitro under conditions that favor cell proliferation, cell differentiation and cell growth. For example, the recombinant cells may be cultured by contacting a cell (e.g., any of the cells described herein) with a cell culture medium that includes the necessary growth factors and supplements sufficient to support cell viability and growth. [0237] In some embodiments, the method may further include isolating the recovered CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides). The isolation of the CM-containing polypeptides may be performed using any separation or purification technique for separating protein species, e.g., affinity tag-based protein purification (e.g., polyhistidine (His) tag, glutathione-S-transferase tag, and the like), ammonium sulfate precipitation, polyethylene glycol precipitation, size exclusion chromatography, ligand-affinity chromatography (e.g., Protein A chromatography), ion- exchange chromatography (e.g., anion or cation), hydrophobic interaction chromatography, and the like. [0238] Compositions and methods described herein may involve use of non-reducing or partially-reducing conditions that allow disulfide bonds to form between the MM and the AM of the activatable molecules. [0239] In some embodiments, the method further includes formulating the isolated polypeptides into a pharmaceutical composition. Various formulations are known in the art and are described herein. Any isolated polypeptides described herein can be formulated for any route of administration (e.g., intravenous, intratumoral, subcutaneous, intradermal, oral (e.g., inhalation), transdermal (e.g., topical), transmucosal, or intramuscular). METHODS OF USING CM-CONTAINING POLYPEPTIDES [0240] In some aspects, the present disclosure further provides methods of using the CM- containing polypeptides herein. In some embodiments, the present disclosure provides methods of the treating a disease (e.g., a cancer (e.g., any of the cancers described herein)) in a subject including administering a therapeutically effective amount of any of the polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein to the subject. In some embodiments, the disclosure provides methods of preventing, delaying the progression of, treating, alleviating a symptom of, or otherwise ameliorating disease in a
CYTX-083 subject by administering a therapeutically effective amount of an polypeptides (e.g., activatable molecules or conjugated polypeptides) described herein to a subject in need thereof. The term “treatment” refers to ameliorating at least one symptom of a disorder. In some embodiments, the disorder being treated may be a cancer or autoimmune disease or to ameliorate at least one symptom of a cancer or autoimmune disease. As used herein, the term “subject” refers to any mammal. In some embodiments, the subject is a feline (e.g., a cat), a canine (e.g., a dog), an equine (e.g., a horse), a rabbit, a pig, a rodent (e.g., a mouse, a rat, a hamster or a guinea pig), a non-human primate (e.g., a simian (e.g., a monkey (e.g., a baboon, a marmoset), or an ape (e.g., a chimpanzee, a gorilla, an orangutan, or a gibbon)), or a human. In some embodiments, the subject is a human. The terms subject and patient are used interchangeably herein. In some embodiments, the subject has been previously identified or diagnosed as having the disease (e.g., cancer (e.g., any of the cancers described herein)). [0241] A therapeutically effective amount of a CM-containing polypeptide (e.g., activatable molecule or conjugated polypeptide) of the disclosure relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the AM and its target that, in certain cases, interferes with the functioning of the targets. The amount required to be administered will furthermore depend on the binding affinity of the polypeptides for its specific target, and will also depend on the rate at which an administered polypeptide is depleted from the free volume other subject to which it is administered. Common ranges for therapeutically effective dosing of a polypeptides of the disclosure may be, by way of non-limiting example, from about 0.001, 0.01, 0.1, 0.3, 0.5, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, or 50 mg/kg body weight or higher. The structure of the polypeptides of the present disclosure makes it possible to reduce the dosage of the polypeptide that is administered to a subject compared to conventional activatable molecules and compared to conventional antibodies. For example, the administered dose on a unit dosage basis or total dosage over a dosage regimen period may be reduced by 10, 20, 30, 40, or 50% compared to the corresponding dose of a corresponding conventional therapeutic molecules. [0242] Common dosing frequencies may range, for example, from once or twice daily, weekly, biweekly, or monthly. [0243] Efficaciousness of treatment is determined in association with any known method for diagnosing or treating the particular disorder. Methods for the screening of polypeptides
CYTX-083 that possess the desired specificity include, but are not limited to, enzyme linked immunosorbent assay (ELISA) and other immunologically mediated techniques known within the art. [0244] In another embodiment, a polypeptide directed two or more targets are used in methods known within the art relating to the localization and/or quantitation of the targets (e.g., for use in measuring levels of one or more of the targets within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). In a given embodiment, a polypeptide directed two or more targets, or a derivative, fragment, analog or homolog thereof, that contain the antibody derived antigen binding domain, are utilized as pharmacologically active compounds (referred to hereinafter as “Therapeutics”). [0245] The CM-containing polypeptides used in any of the embodiments of these methods and uses may be administered at any stage of the disease. For example, such a polypeptide may be administered to a patient suffering cancer of any stage, from early to metastatic. In some embodiments, the CM-containing polypeptides and formulations thereof may be administered to a subject suffering from or susceptible to a disease or disorder associated with aberrant target expression and/or activity. [0246] A subject suffering from or susceptible to a disease or disorder associated with aberrant target expression and/or activity may be identified using any of a variety of methods known in the art. For example, subjects suffering from cancer or other neoplastic condition may be identified using any of a variety of clinical and/or laboratory tests such as, physical examination and blood, urine and/or stool analysis to evaluate health status. For example, subjects suffering from inflammation and/or an inflammatory disorder may be identified using any of a variety of clinical and/or laboratory tests such as physical examination and/or bodily fluid analysis, e.g., blood, urine and/or stool analysis, to evaluate health status. [0247] In some embodiments, administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression and/or activity may be considered successful if any of a variety of laboratory or clinical objectives is achieved. For example, administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression and/or activity may be considered successful if one or more of the symptoms associated with the disease or disorder is alleviated, reduced, inhibited or does not progress to a further, i.e., worse, state. Administration of a polypeptide to a patient suffering from a disease or disorder associated with aberrant target expression
CYTX-083 and/or activity may be considered successful if the disease or disorder enters remission or does not progress to a further, i.e., worse, state. [0248] As used herein, the term “treat” includes reducing the severity, frequency or the number of one or more (e.g., 1, 2, 3, 4, or 5) symptoms or signs of a disease (e.g., a cancer (e.g., any of the cancers described herein)) in the subject (e.g., any of the subjects described herein). In some embodiments where the disease is cancer, treating results in reducing cancer growth, inhibiting cancer progression, inhibiting cancer metastasis, or reducing the risk of cancer recurrence in a subject having cancer. [0249] In some embodiments, the CM comprises a substrate for a protease that is active, e.g., upregulated or otherwise unregulated, in a disease condition or diseased tissue. Exemplary disease conditions include, for example, a cancer (e.g., where the diseased tissue is a tumor tissue) and an inflammatory or autoimmune condition (e.g., where the diseased tissue is inflamed tissue). In some embodiments, the CM comprises a substrate for an extracellular protease. In some embodiments, the CM comprises a substrate for an intracellular protease. In some embodiments, the CM is a substrate for an intracellular protease and an extracellular protease. In some embodiments, the disease may be a cancer. In some embodiments, the subject may have been identified or diagnosed as having a cancer. Examples of cancer include: solid tumor, hematological tumor, sarcoma, a leukemia (e.g., hairy cell leukemia, chronic lymphocytic leukemia (CLL), acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL)), , stomach cancer, urothelial carcinoma, lung cancer, renal cell carcinoma, gastric and esophageal cancer, pancreatic cancer, prostate cancer, brain cancer, colon cancer, bone cancer, lung cancer, breast cancer, colorectal cancer, ovarian cancer, non-small cell lung carcinoma (NSCLC), squamous cell head and neck carcinoma, endometrial cancer, bladder cancer, cervical cancer, and liver cancer. Metastases of the aforementioned cancers may also be treated or prevented in accordance with the methods described herein. [0250] In some embodiments, the disease may be an autoimmune disease or condition. In some embodiments, the subject may have been identified or diagnosed as having an autoimmune disease or condition or is at heightened risk of developing an autoimmune disease or condition. Examples of autoimmune diseases include Type 1 diabetes, Rheumatoid arthritis (RA), Psoriasis/psoriatic arthritis, Multiple sclerosis, Systemic lupus erythematosus, Inflammatory bowel disease (e.g., Crohn’s disease, ulcerative colitis), chronic inflammation,
CYTX-083 or transplant rejection (e.g., in kidney, liver, or heart transplantation), autoimmune diseases, infectious disease, chronic inflammation, or transplant rejection. In some embodiments, the disease is a cardiovascular disorder. In some embodiments, the disease is a neurodegenerative disorder. [0251] In some embodiments, the methods herein may result in a reduction in the number, severity, or frequency of one or more symptoms of the cancer in the subject (e.g., as compared to the number, severity, or frequency of the one or more symptoms of the cancer in the subject prior to treatment). [0252] The methods may further comprise administering to a subject one or more additional agents. In some embodiments, the CM-containing polypeptides (e.g., activatable molecules or conjugated polypeptides) may be administered during and/or after treatment in combination with one or more additional agents. In some embodiments, the polypeptide may be formulated into a single therapeutic composition, and the polypeptide and additional agent(s) may be administered simultaneously. Alternatively, the polypeptide and additional agent(s) may be separate from each other, e.g., each is formulated into a separate therapeutic composition, and the polypeptide and the additional agent are administered simultaneously, or the polypeptide and the additional agent are administered at different times during a treatment regimen. For example, the polypeptide may be administered prior to the administration of the additional agent, subsequent to the administration of the additional agent, or in an alternating fashion. The polypeptide and additional agent(s) may be administered in single doses or in multiple doses. [0253] One of more of the polypeptides herein may be co-formulated with, and/or co- administered with, one or more anti-inflammatory drugs, immunosuppressants, or metabolic or enzymatic inhibitors. In some embodiments, one or more polypeptides herein may be combined with one or more polypeptides of other types. [0254] The present disclosure also provides methods of detecting presence or absence of a cleaving agent and/or the target in a subject or a sample. Such methods may comprise (i) contacting a subject or biological sample with an activatable molecule, wherein the activatable molecule includes a detectable label that is positioned on a portion of the activatable molecule that is released following cleavage of the CM and (ii) measuring a level of activated molecule in the subject or biological sample, wherein a detectable level of activated molecule in the subject or biological sample indicates that the cleaving agent, the
CYTX-083 target or both the cleaving agent and the target are absent and/or not sufficiently present in the subject or biological sample, such that the target binding and/or protease cleavage of the activatable molecule cannot be detected in the subject or biological sample, and wherein a reduced detectable level of activated molecule in the subject or biological sample indicates that the cleaving agent and the target are present in the subject or biological sample. [0255] Such detection methods may be adapted to also provide for detection of the presence or absence of a target that is capable of binding the AM of the activatable molecules when cleaved. Thus, the assays can be adapted to assess the presence or absence of a cleaving agent and the presence or absence of a target of interest. The presence or absence of the cleaving agent can be detected by the presence of and/or an increase in detectable label of the activatable molecules as described above, and the presence or absence of the target can be detected by detection of a target-AM complex e.g., by use of a detectably labeled anti-target antibody. [0256] In some embodiments, activatable molecules are also useful in in situ imaging for the validation of activatable molecule activation, e.g., by protease cleavage, and binding to a particular target. In situ imaging is a technique that enables localization of proteolytic activity and target in biological samples such as cell cultures or tissue sections. Using this technique, it is possible to confirm both binding to a given target and proteolytic activity based on the presence of a detectable label (e.g., a fluorescent label). [0257] These techniques are useful with any frozen cells or tissue derived from a disease site (e.g. tumor tissue) or healthy tissues. These techniques are also useful with fresh cell or tissue samples. [0258] In these techniques, an activatable molecule may be labeled with a detectable label. The detectable label may be a fluorescent dye, (e.g. a fluorophore, Fluorescein Isothiocyanate (FITC), Rhodamine Isothiocyanate (TRITC), an Alexa Fluor® label), a near infrared (NIR) dye (e.g., Qdot® nanocrystals), a colloidal metal, a hapten, a radioactive marker, biotin and an amplification reagent such as streptavidin, or an enzyme (e.g. horseradish peroxidase or alkaline phosphatase). [0259] Detection of the label in a sample that has been incubated with the labeled, activatable molecule indicates that the sample contains the target and contains a protease that is specific for the CM of the activatable molecule. In some embodiments, the presence of the protease can be confirmed using broad spectrum protease inhibitors such as those described
CYTX-083 herein, and/or by using an agent that is specific for the protease, for example, an antibody such as A11, which is specific for the protease matriptase and inhibits the proteolytic activity of matriptase; see e.g., International Publication Number WO 2010/129609, published 11 November 2010. The same approach of using broad spectrum protease inhibitors such as those described herein, and/or by using a more selective inhibitory agent can be used to identify a protease that is specific for the CM of the activatable molecule. In some embodiments, the presence of the target can be confirmed using an agent that is specific for the target, e.g., another antibody, or the detectable label can be competed with unlabeled target. In some embodiments, unlabeled activatable molecule may be used, with detection by a labeled secondary antibody or more complex detection system. [0260] Similar techniques are also useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the activatable molecule. [0261] These techniques are also useful in kits and/or as reagents for the detection, identification or characterization of protease activity in a variety of cells, tissues, and organisms based on the protease-specific CM in the activatable molecule. [0262] A reduced level of detectable label may be, for example, a reduction of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or a reduction of substantially 100%. In some embodiments, the detectable label may be conjugated to a component of the polypeptide, e.g., the AM. In some embodiments, measuring the level of polypeptide in the subject or sample may be accomplished using a secondary reagent that specifically binds the activated protein, wherein the reagent comprises a detectable label. The secondary reagent may be an antibody comprising a detectable label. [0263] In some embodiments, the CM-containing polypeptides may also be useful in the detection of the target in patient samples and accordingly are useful as diagnostics. For example, the polypeptides may be used in in vitro assays, e.g., ELISA, to detect target levels in a patient sample. For example, a polypeptide may be immobilized on a solid support (e.g., the well(s) of a microtiter plate). The immobilized polypeptide may serve as a capture protein for any target that may be present in a test sample. Prior to contacting the immobilized
CYTX-083 polypeptide with a patient sample, the solid support may be rinsed and treated with a blocking agent such as milk protein or albumin to prevent nonspecific adsorption of the analyte. [0264] In some embodiments, based on the results obtained using the polypeptides in an in vitro diagnostic assay, the stage of a disease in a subject may be determined based on expression levels of the target protein (e.g., antigen). For a given disease, samples of blood may be taken from subjects diagnosed as being at various stages in the progression of the disease, and/or at various points in the therapeutic treatment of the disease. Using a population of samples that provides statistically significant results for each stage of progression or therapy, a range of concentrations of the target protein (e.g., antigen) that may be considered characteristic of each stage is designated. [0265] Polypeptides herein may also be used in diagnostic and/or imaging methods. In some embodiments, such methods may be in vitro methods. In some embodiments, such methods may be in vivo methods. In some embodiments, such methods may be in situ methods. In some embodiments, such methods may be ex vivo methods. For example, polypeptides having a CM may be used to detect the presence or absence of an enzyme capable of cleaving the CM. Such polypeptides may be used in diagnostics, which can include in vivo detection (e.g., qualitative or quantitative) of enzyme activity (or, in some embodiments, an environment of increased reduction potential such as that which can provide for reduction of a disulfide bond) through measured accumulation of activated antibodies (i.e., antibodies resulting from cleavage of a polypeptide) in a given cell or tissue of a given host organism. Such accumulation of activated proteins indicates not only that the tissue expresses enzymatic activity (or an increased reduction potential depending on the nature of the CM) but also that the tissue expresses target to which the activated protein binds. In some examples, the polypeptides may be used for detecting protease activity with an assay that does not rely on target binding, e.g., a quantitative ex vivo zymography (QZ) assay as described in Howng et al., “Novel Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies,” Pharmaceutics. 2021 Sep 2; 13(9):1390, which is incorporated by reference herein in its entirety. [0266] For example, the CM may be selected to be a protease substrate for a protease found at the site of a tumor, at the site of a viral or bacterial infection at a biologically confined site (e.g., such as in an abscess, in an organ, and the like), and the like. The AM may be one that binds a target protein (e.g., antigen). Using methods familiar to one skilled in the art, a
CYTX-083 detectable label (e.g., a fluorescent label or radioactive label or radiotracer) may be conjugated to an AM or other region of a polypeptide. Suitable detectable labels may be discussed in the context of the above screening methods and additional specific examples are provided below. Using an AM specific to a protein or peptide of the disease state, along with a protease whose activity is elevated in the disease tissue of interest, polypeptides may exhibit an increased rate of binding to disease tissue relative to tissues where the CM specific enzyme is not present at a detectable level or is present at a lower level than in disease tissue or is inactive (e.g., in zymogen form or in complex with an inhibitor). Since small proteins and peptides are rapidly cleared from the blood by the renal filtration system, and because the enzyme specific for the CM is not present at a detectable level (or is present at lower levels in non-disease tissues or is present in inactive conformation), accumulation of activated protein in the disease tissue may be enhanced relative to non-disease tissues. [0267] In some embodiments, the CM-containing polypeptides may be useful for in vivo imaging where detection of the fluorescent signal in a subject, e.g., a mammal, including a human, indicates that the disease site contains the target and contains a protease that is specific for the CM of the polypeptide. The in vivo imaging may be used to identify or otherwise refine a patient population suitable for treatment with a polypeptide of the disclosure. For example, patients that test positive for both the target and a protease that cleaves the substrate in the CM of the polypeptide being tested (e.g., accumulate activated proteins at the disease site) are identified as suitable candidates for treatment with such a polypeptide comprising such a CM. Likewise, patients that test negative may be identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the polypeptide being tested). In some embodiments, such patients that test negative with respect to a first polypeptide can be tested with other polypeptides comprising different CMs until a suitable polypeptide for treatment is identified (e.g., a polypeptide comprising a CM that is cleaved by the patient at the site of disease). [0268] In some embodiments, in situ imaging may be useful in methods to identify which patients to treat. For example, in in situ imaging, the polypeptides may be used to screen patient samples to identify those patients having the appropriate protease(s) and target(s) at the appropriate location, e.g., at a tumor site. In some embodiments, in situ imaging is used to identify or otherwise refine a patient population suitable for treatment with a polypeptide of the disclosure. For example, patients that test positive for both the target and a protease
CYTX-083 that cleaves the substrate in the CM of the polypeptide being tested (e.g., accumulate activated antibodies at the disease site) are identified as suitable candidates for treatment with such a polypeptide comprising such a CM. Likewise, patients that test negative for either or both of the target and the protease that cleaves the CM used in the polypeptide being tested using these methods are identified as suitable candidates for another form of therapy (i.e., not suitable for treatment with the polypeptide being tested). In some embodiments, such patients that test negative with respect to a first polypeptide can be tested with other polypeptides comprising different CMs until a suitable polypeptide for treatment is identified (e.g., a polypeptide comprising a CM that is cleaved by the patient at the site of disease). [0269] The present application also provides aspects and embodiments as set forth in the following numbered Statements: [0270] Statement 1. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence selected from HQSRS (SEQ ID NO: 2), HQSR (SEQ ID NO: 1), AQSRS (SEQ ID NO: 160), or HQSKS (SEQ ID NO: 66), wherein the CM is a substrate for a protease. According to the present disclosures, the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule. In some aspects of the present disclosure, cleavage of the CM by a protease activates the molecule. In some aspects, the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin. According to the present disclosures, the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo. According to embodiments of the present disclosures, the isolated polypeptide is a molecule comprising a CM that has a
CYTX-083 kcat/KM (M-1s-1) of greater than 2.5 x 104 M-1 s-1. According to embodiments of the present disclosures, the isolated polypeptide is a molecule comprising a CM that has a kcat/KM (M-1s- 1) of greater than 1 x 104 M-1 s-1. [0271] Statement 2. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence HQSRSG (SEQ ID NO: 3). [0272] Statement 3. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence SHQSRS (SEQ ID NO: 4). [0273] Statement 4. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence HQSRSA (SEQ ID NO: 5). [0274] Statement 5. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence DHQSRS (SEQ ID NO: 6). [0275] Statement 6. The isolated polypeptide of Statement 1, wherein the CM comprises the amino acid sequence SDHQSRS (SEQ ID NO: 7). [0276] Statement 7. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence selected from SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. According to the present disclosures, the isolated polypeptide is a molecule in which cleavage of the CM by a protease results in a part or component of the molecule being separated from the remainder of the molecule. In some aspects of the present disclosure, cleavage of the CM by a protease activates the molecule. In some aspects, the isolated polypeptide is a molecule in which multiple proteases cleave the CM. In some aspects, the isolated polypeptide is a molecule in which MT-SP1 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which plasmin cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which TMPRSS11 cleaves the CM. In some aspects, the isolated polypeptide is a molecule in which two or all of TMPRSS11, MT-SP1, and plasmin cleave the CM. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is at least 50% in the presence of MT-SP1 (see Example 2). In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the
CYTX-083 CM is at least 70% and up to 100% in the presence of MT-SP1. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is up to 100% in the presence of TMPRSS11. In some aspects, the isolated polypeptide is a molecule in which the % cleavability of the CM is improved by 3x, 5x, 7x, 8x, or 10x or more over the % cleavability of SEQ ID NO: 78 (see, e.g., Example 2). According to the present disclosures, the isolated polypeptide is a molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo. According to embodiments of the present disclosures, the isolated polypeptide is a molecule comprising a CM that has a kcat/KM (M-1s-1) of greater than 2.5 x 104 M-1 s-1. [0277] Statement 8. The isolated of any one of Statements 1-7, wherein the
isolated polypeptide is an and further comprises an active moiety (AM) that specifically binds a target. According to the present disclosures, the isolated polypeptide may be an activatable molecule that has high in vivo stability such that it is not cleaved in plasma as demonstrated by less than 25% in vivo activation following 7 days of administration in vivo. According to the present disclosures, the isolated polypeptide may be an activatable molecule that has masking efficiency of 25x, 40x, 41x, 50x, 75x, 100x, 150x, 200x, or higher. According to the present disclosures, the activatable molecule may be activated by one, two, or all of TMPRSS11, MT-SP1, and plasmin. According to the present disclosures, the activatable molecule may be activated to an extent of having a cleavability percentage of at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100%, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95%, or 100% cleavable by any one of TMPRSS11, MT-SP1, and plasmin or any two of TMPRSS11, MT-SP1, and plasmin or each of TMPRSS11, MT-SP1, and plasmin. In some aspects, the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is at least 70% and up to 100% in the presence of MT-SP1. In some aspects, the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is up to 100% in the presence of TMPRSS11. In some aspects, the isolated polypeptide is an activatable molecule in which the % cleavability of the CM is improved by 3x, 5x, 7x, 8x, or 10x or more over the % cleavability of SEQ ID NO: 78 (see Example 2). According to the present disclosures, the activatable molecule exhibits attenuated binding to a target as compared to the binding of a counterpart “activated” molecule comprising the same active moiety (AM) to the same target.
CYTX-083 [0278] Statement 9. The isolated polypeptide of Statement 8, wherein the AM is an antibody or antigen-binding fragment thereof. [0279] Statement 10. The isolated polypeptide of Statement 9, wherein the antigen- binding fragment is selected from the group consisting of a Fab fragment, a F(ab’)2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, and a single domain light chain antibody. [0280] Statement 11. The isolated polypeptide of Statement 8, wherein the AM is a therapeutic macromolecule. [0281] Statement 12. The isolated polypeptide of Statement 8, wherein the AM is a cytokine. [0282] Statement 13. The isolated polypeptide of Statement 8, wherein the AM is a chimeric antigen receptor. [0283] Statement 14. The isolated polypeptide of any one or combination of Statements 8-13, wherein the AM is coupled to the CM. [0284] Statement 15. The isolated polypeptide of Statement 14, wherein the AM is directly coupled to the CM. [0285] Statement 16. The isolated polypeptide of Statement 14, wherein the AM is indirectly coupled to the CM via a linking peptide. [0286] Statement 17. The isolated polypeptide of any one or combination of Statements 8-16, further comprising a masking moiety (MM). [0287] Statement 18. The isolated polypeptide of Statement 17, wherein the MM has a dissociation constant for binding to the AM that is greater than a dissociation constant of the AM for binding to the target. [0288] Statement 19. The isolated polypeptide of Statement 17 or 18, wherein the MM is 2 to 40 amino acids in length. [0289] Statement 20. The isolated polypeptide of Statement 16, wherein the MM interferes with AM’s binding to its binding partner through non-specific interactions such as steric hindrance, optionally wherein the MM is positioned in the activatable molecule such that the tertiary or quaternary structure of the activatable molecule allows the MM to mask the AM through charge-based interaction, optionally wherein the MM is an albumin, e.g., human serum albumin (HSA), a fragment crystallizable (Fc) domain, an antibody constant domain (e.g., CH domains), a polymer (e.g., branched or multi-armed polyethylene glycol
CYTX-083 (PEG)), a latency associated protein (LAP), and any polypeptide or other moieties that sterically interfere AM-target interactions, optionally wherein the MM may recruit a large protein binding partner that sterically interfere AM-target interactions, optionally wherein the MM is an antibody or a fragment thereof that binds to an albumin, optionally wherein the MM comprises a full-length or a AM-binding fragment or mutein of a cognate receptor of the AM, and AM-binding antibodies and fragment thereof, e.g., a polyclonal antibody, a recombinant antibody, a human antibody, a humanized antibody a single chain variable fragment (scFv), single-domain antibody such as a heavy chain variable domain (VH), a light chain variable domain (VL), a variable domain of camelid-type nanobody (VHH), or a dAb, optionally wherein the MM is a non-immunoglobulin proteins that mimic antibody binding and/or structure such as, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, DARPins, fynomers, kunitz domain peptides, monobodies, and binding domains based on other engineered scaffolds such as SpA, GroEL, fibronectin, lipocallin and CTLA4 scaffolds, optionally wherein the MM is a peptide that is modified by conjugation to a water-soluble polymer, such as a polyalkylene glycol, e.g., a polyethylene glycol (PEG), optionally wherein the MM is an antibody or antigen-binding domain that binds to a protein with a long serum half- life such as HSA, immunoglobulin or transferrin, or to a receptor that is recycled to the plasma membrane, such as FcRn or a transferrin receptor. [0290] Statement 21. The isolated polypeptide of any one or combination of Statements 17-20, wherein the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM- CM-MM. [0291] Statement 22. The isolated polypeptide of Statement 21, wherein the MM is coupled directly to the CM. [0292] Statement 23. The isolated polypeptide of Statement 21, wherein the MM is coupled indirectly to the CM via a linking peptide. [0293] Statement 24. The isolated polypeptide of any one or combination of Statements 17-23, wherein the isolated polypeptide comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the isolated polypeptide has a structural arrangement from N-terminus to C-terminus as follows: MM-LP1-CM- AM, MM- CM-LP1-AM, MM-LP1- CM-LP2-AM or AM-LP2-CM-LP1-MM.
CYTX-083 [0294] Statement 25. The isolated polypeptide of Statement 24, wherein the LP1 and LP2 are not identical to each other. [0295] Statement 26. The isolated polypeptide of Statement 24, wherein the LP1 and LP2 are identical to each other. [0296] Statement 27. The isolated polypeptide of any one of Statements 24-26, wherein each of LP1 and LP2 is a peptide of 1 to 20 amino acids in length. [0297] Statement 28. The isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for a serine protease, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1 and TMPRSS11, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for plasmin and TMPRSS11, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1 and plasmin, optionally wherein the isolated polypeptide of any one or combination of Statements 1-27, wherein the CM is a substrate for MT-SP1, plasmin, and TMPRSS11. [0298] Statement 29. The isolated polypeptide of Statement 28, wherein the serine protease is membrane type serine protease 1 (MT-SP1). [0299] Statement 30. The isolated polypeptide of Statement 29, wherein the kcat/KM of the CM by MT-SP1 cleavage is at least 1 x 103 M-1s-1, optionally where kcat/KM of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20. [0300] Statement 31. The isolated polypeptide of Statement 29, wherein the kcat/KM of the CM by MT-SP1 cleavage is at least 1 x 104 M-1s-1, optionally where kcat/KM of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20. [0301] Statement 32. The isolated polypeptide of Statement 28, wherein the serine protease is a transmembrane protease serine 11 (TMPRSS11). [0302] Statement 33. The isolated polypeptide of Statement 32, wherein the kcat/KM of the CM by TMPRSS11 cleavage is at least 1 x 103 M-1s-1, optionally where kcat/KM of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20. [0303] Statement 34. The isolated polypeptide of Statement 32, wherein the kcat/KM of the CM by TMPRSS11cleavage is at least 1 x 104 M-1s-1, optionally where kcat/KM of the CM is measured at 37°C in 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20.
CYTX-083 [0304] Statement 35. The isolated polypeptide of Statement 32, wherein the cleavability of the CM by a TMPRSS11 is at least 90%. [0305] Statement 36. The isolated polypeptide of any one or combination of Statements 1-35, wherein the CM is resistant to cleavage in situ in human bone marrow, optionally wherein the CM has lower cleavage in situ in human bone marrow than SEQ ID NO: 78. [0306] Statement 37. The isolated polypeptide of any one or combination of Statements 1-36, wherein the CM is resistant to cleavage in vivo in human bone marrow, optionally wherein the CM has lower cleavage in situ in human bone marrow than SEQ ID NO: 78. [0307] Statement 38. The isolated polypeptide of any one or combination of Statements 17-39, wherein the AM is an antibody or antigen-binding fragment that binds EGFR and the MM comprises the amino acid sequence of SEQ ID NO: 82. [0308] Statement 39. An isolated polypeptide comprising an antibody or antigen-binding fragment thereof that binds EGFR (AB), a masking moiety (MM) comprising the SEQ ID NO: 82, and a cleavable moiety (CM), wherein AB is coupled with the MM via the CM. [0309] Statement 40. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with one-amino acid mutation in any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. [0310] Statement 41. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with two-amino acid mutations in any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. [0311] Statement 42. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with three-amino acid mutations in any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. [0312] Statement 43. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with four-amino acid mutations of any one of SEQ ID NOs: 1-74 and 160, wherein the CM is a substrate for a protease. [0313] Statement 44. The isolated polypeptide of any one or combination of Statements 1-43, further comprising one or more additional CMs, optionally wherein at least a portion of a first CM overlaps with at least a portion of a second CM in the substrate, such that one or more amino acids belong to both CMs. [0314] Statement 45. A polypeptide complex comprising one or more of the isolated polypeptide of any one or combination of Statements 1-46.
CYTX-083 [0315] Statement 46. A conjugated polypeptide comprising the isolated polypeptide of any one or combination of Statements 1-45 conjugated to an agent. [0316] Statement 47. The conjugated polypeptide of Statement 46, wherein the agent is conjugated to the isolated polypeptide via a conjugating linker. [0317] Statement 48. The conjugated polypeptide of Statement 47, wherein the conjugating linker is cleavable. [0318] Statement 49. The conjugated polypeptide of Statement 47, wherein the conjugating linker is non-cleavable. [0319] Statement 50. The conjugated polypeptide of Statement 48, wherein the conjugating linker comprises an amino acid sequence selected from SEQ ID NOs: 1-74 and 160. [0320] Statement 51. The conjugated polypeptide of any one or combination of Statements 46-50, wherein the agent is a toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof. [0321] Statement 52. A composition comprising the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, or the conjugated polypeptide of any one or combination of Statements 46-51, and a carrier. [0322] Statement 53. The composition of Statement 52, wherein the carrier is a pharmaceutically acceptable carrier. [0323] Statement 54. The composition of Statement 52 or 53, comprising an additional agent. [0324] Statement 55. The composition of Statement 54, wherein the additional agent is a therapeutic agent. [0325] Statement 56. An isolated nucleic acid molecule encoding the isolated polypeptide of any one or combination of Statements 1-44. [0326] Statement 57. A vector comprising the isolated nucleic acid molecule of Statement 58. [0327] Statement 58. A cell comprising the isolated polypeptide of any one or combination of Statements 1-44 or the isolated nucleic acid molecule of Statement 56 or the vector of Statement 57.
CYTX-083 [0328] Statement 59. A method of manufacturing an isolated polypeptide or an activatable molecule that contains a cleavable moiety (CM), the method comprising expressing and recovering a polypeptide comprising the isolated polypeptide of any one or combination of Statements 1-44, optionally wherein the polypeptide is an activatable molecule. [0329] Statement 60. A method of treating, alleviating a symptom of, or delaying the progression of a disease or disorder in a subject, comprising administering a therapeutically effective amount of the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 to the subject. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for use as a medicament or for use in therapy, optionally for treating a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder, optionally with an additional agent which is optionally a therapeutic agent. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating a cancer. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating an infection. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating an inflammatory disorder. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or
CYTX-083 combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating a cardiovascular disorder. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52-55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating a neurodegenerative disorder. The isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, the composition of any one of Statements 52- 55, the nucleic acid molecule of Statement 56, the vector of Statement 57, or the cell of Statement 58 for treating an autoimmune disorder [0330] Statement 61. The method of Statement 60, wherein the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. [0331] Statement 62. A kit comprising the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52- 55. [0332] Statement 63. The use of the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52-55 for the manufacture of a medicament for the treatment of a disease or disorder. [0333] Statement 64. The use of Statement 63, wherein the disease or disorder is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. [0334] Statement 65. A method of detecting or diagnosing a disease or health condition in a subject, comprising: contacting the isolated polypeptide of any one or combination of Statements 1-44, the polypeptide complex of Statement 45, the conjugated polypeptide of any one or combination of Statements 46-51, or the composition of any one of Statements 52-55 with a sample from the subject; and measuring a level of cleavage of the isolated polypeptide, thereby detecting or diagnosing the disease or health condition in the subject.
CYTX-083 [0335] Statement 66. The method of Statement 65, wherein the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. EXAMPLES EXAMPLE 1: Activatable Antibodies and Matriptase (MT-SP1) Cleavable Moieties [0336] The studies provided herein describe exemplary CMs that are matriptase (MT- SP1) substrates and exemplary activatable antibodies that include the exemplary CMs. [0337] Exemplary activatable antibodies were constructed such that each one includes one of the CMs listed in Table 4. The exemplary activatable antibodies, the sequences of which are listed in Table 5, include an antibody or antigen binding fragment thereof (AB) that is based on a mouse/human chimeric monoclonal antibody that specifically binds epidermal growth factor receptor (EGFR). The exemplary activatable antibodies also include a prodomain coupled to the N-terminus of the light chain of the AB. Each prodomain includes a masking moiety (MM) and a cleavable moiety (CM), and the CM includes at least one MT- SP1 substrate sequence of Table 4. Table 4: Exemplary CMs with Matriptase (MT-SP1) Substrates Name Sequence SEQ ID NO: 6001 HQSRS 2
Table 5: Exemplary Activatable Antibodies Molecule Light chain Light chain CM Protein description N m EGFR M k (Li ht h in / H y
CYTX-083 CX-229 CISPRGCLDGPYVMY 3001 C225v539543001 (SEQ ID NO: 82) (SEQ ID NO: 79) (SEQ ID NO: 89/ SEQ ID NO 84
EXAMPLE 2: In Vitro Cleavability of Activatable Antibodies with Exemplary CMs [0338] The studies provided herein evaluate the in vitro cleavability of activatable antibodies containing exemplary CMs cleavable by a matriptase (MT-SP1). [0339] The cleavability of the activatable antibodies having the CMs of the present disclosure, along with control CMs 2001 (WO2016/118629) and 0001 (WO2010/081173) was measured in the presence of MT-SP1, plasmin and TMPRSS11. Each activatable antibody (500 nM) was incubated with 10 nM of a single protease for 1.5 or 4 hours at 37ºC. Human recombinant MT-SP1 (Catalog No: 3946-SEB) and TMPRSS11D (Catalog No: 2695- SE) were purchased from R&D Systems. Purified human plasmin (Catalog No: CPM-0140) was purchased from Hematologic Technologies, Inc. Protease concentrations were determined by active site titration. Activity assays were performed in the following buffer 50 mM TRIS-HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20. Following incubation, the presence of cleavage product was determined by capillary electrophoresis for each protease enzyme using a LabChip GXII Touch system (Perkin Elmer), or by capillary electrophoresis immunoassay for each protease enzyme using the WesTM Western Blot instrument (Protein Simple). For capillary electrophoresis assays, the HT Protein Express 100 protocol (Perkin Elmer) was used. LabChip GXII Touch HT Chips (Perkin Elmer #760499) were set up using the protocol of the Protein Express Assay Reagent Kit (Perkin Elmer #CLS960008). The fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the LabChip GX Reviewer software (Perkin Elmer). For capillary electrophoresis immunoassays, the A110UK goat anti-human IgG antibody (American Qualex) and an anti-goat secondary
CYTX-083 antibody (Jackson ImmunoResearch) were used. The fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the Compass software (Protein Simple). The fraction of activatable antibody, and hence the CM that is cleaved by each particular protease, is presented as a “cleavability percentage” in Tables 6A and 6B. The results in Table 6A indicate that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) were each substantially cleaved by MT-SP1 (as compared to control CM 2001). CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) exhibited a cleavability percentage of greater than 30 percent for MT-SP1. The cleavability percentage for CM 6001 (SEQ ID NO: 2) by MT-SP1 in this study was greater than 50 percent. [0340] Notably, in a second study, the cleavability with matriptase, TMPRSS11 and plasmin was determined. As shown in Table 6B, CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) were cleaved by matriptase, plasmin, and TMPRSS11 to a greater extent than the control CM 2001. The study protocols were validated to confirm that they provided consistent results. [0341] In addition, an exemplary study was performed to determine the cleavability kinetics (i.e., kcat/KM (M-1 s-1)) of the indicated CMs with the indicated protease. The results of this in vitro study are summarized in Table 6C. [0342] The exemplary results of Table 6C indicate that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) had a kcat/KM (M-1 s-1) of greater than 1 x 103 M-1 s-1 for in vitro cleavability with MT-SP1.
[0343] These exemplary results of Table 6C also show that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) had a kcat/KM (M-1 s-1) of greater than 1 x 104 M-1s-1 for in vitro cleavability with MT-SP1. [0344] These exemplary results of Table 6C also show that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) had a kcat/KM (M-1 s-1) of greater than 1 x 103 M-1s-1 for in vitro cleavability with TMPRSS11. [0345] These exemplary results of Table 6C also show that CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) had a kcat/KM (M-1 s-1) of greater than 1 x 104 M-1s-1 for in vitro cleavability with TMPRSS11.
CYTX-083 [0346] The kcat/KM (M-1 s-1) results demonstrate that the exemplary CM 6006 (SEQ ID NO: 7) and CM 6001 (SEQ ID NO: 2) had higher cleavability by at least MT-SP1 than control CMs 2001 (SEQ ID NO: 78) and 0001 (SEQ ID NO: 77). Table 6A: In Vitro Activation of Activatable Antibodies with Exemplary CMs Cleavability (%) CM of Activatable Antibody CM MT-SP1 lary CMs
CM of Cleavability (%) Activatable CM MT-SP1 Plasmin TMPRSS11
Table 6C: In Vitro Activation of Activatable Antibodies with Exemplary CMs CM of kcat/KM (M-1 s-1) kcat/KM (M-1 s-1) Activatable CM
CYTX-083 EXAMPLE 3: In Vivo Stability of Activatable Antibodies with Exemplary CMs [0347] The study provided herein evaluates the in vivo stability of activatable antibodies of the present disclosure with the exemplary CMs 6006 (SEQ ID NO: 7) and 6001 (SEQ ID NO: 2). [0348] This exemplary study measured the stability of activatable antibodies containing the exemplary CMs by administering a dose of the activatable antibodies to mice, and then measuring the cleaved activatable antibody in the plasma by capillary electrophoresis immunoassay. The stability was compared to the activatable antibody with control CM 2001 (SEQ ID NO: 78). [0349] In this study, nu/nu mice of about 7-8 weeks of age were administered intraperitoneally with the indicated test article at a dosage of 10 mg/kg. After 7 days following the administration, terminal blood was collected by cardiac puncture and processed to plasma within 1 hour of collection. The collected sample was diluted 1:50 in phosphate-buffered saline solution and denatured. The sample was analyzed using the WesTM Western Blot instrument (Protein Simple) with the A110UK goat anti-human IgG antibody (American Qualex) and an anti-goat secondary antibody (Jackson ImmunoResearch). The fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the Compass software (Protein Simple). The results of these exemplary assays are summarized in Table 7. [0350] These exemplary results showed that activatable antibodies with CMs 6001 (SEQ ID NO: 2) and 6006 (SEQ ID NO: 7) demonstrated a higher in vivo stability than the activatable antibody with the control CM 2001 (SEQ ID NO: 78). Table 7: In Vivo Stability of Activatable Antibodies with Exemplary CMs CM of In Vivo A ti t bl CM % A ti ti n
CYTX-083 EXAMPLE 4: Masking Efficiency of Activatable Antibodies with Exemplary CMs [0351] The study provided herein evaluates the in vitro masking efficiency of activatable antibodies of the present disclosure with the CM 6006 (SEQ ID NO: 7). [0352] In this study, a solid-phase binding assay (ELISA) was used to demonstrate the binding affinity of anti-EGFR activatable antibodies that include CMs of the present disclosure to recombinant EGFR. The binding affinity to EGFR of the activatable antibodies with the indicated CM of the present disclosure was measured and compared to the unmasked control c225v5 antibody (SEQ ID NOs: 157 and 158). A summary of these exemplary results is shown in FIG.1 and Table 8. [0353] These exemplary results showed that CM 6006 (SEQ ID NO: 7) had an effect by increasing the apparent masking efficiency of the masking moiety in the activatable antibody compared to the activatable antibody with the control CM 2001 (SEQ ID NO: 78). Table 8. In Vitro Binding Activity and Masking Efficiency of Activatable Antibodies Test Article KD in nM Masking Efficiency C2256006 17.63 200x
5: n Vivo cacy o nt - G ct vatab e nt bod es w t xemp ary CMs [0354] The study provided herein evaluates the in vivo efficacy of activatable antibodies of the present disclosure with CM 6006 (SEQ ID NO: 7) using a mouse H292 (human lung cancer cell line) xenograft model. [0355] In this study, H292 (human lung cancer-derived cell line) subcutaneous xenograft tumors in female nu/nu mice of 6-8 weeks of age were grown to an average volume of 117- 215 mm3. The H292 cell line is responsive to the anti-EGFR antibody cetuximab. The mice were then randomized into groups of 8 mice each and each group was dosed intraperitoneally on day 1 with 9 mg/kg of the indicated test article. The mean tumor volume ± SEM was plotted for each time point following administration of the test article, as shown in FIG. 2A. Each mouse was treated with activated antibodies with either CM 6006 (SEQ ID NO: 7) or the control CM 2001 (SEQ ID NO: 78), or with cetuximab or immunoglobulin (IVIG) control.
CYTX-083 [0356] An intra-tumoral activation assay was performed using the indicated activatable antibodies as shown in FIG. 2B. Tumors were collected from the mice 7 days after dosing. The tumor tissue was lysed with immunoprecipitation buffer (Pierce) containing HALT protease inhibitor cocktail (Thermo Fisher) and EDTA and lysed using the Barocycler (Pressure Bioscience). The sample was analyzed using the WesTM Western Blot instrument (Protein Simple) with the A110UK goat anti-human IgG antibody (American Qualex) and an anti-goat secondary antibody (Jackson ImmunoResearch). The fraction of cleaved activatable antibody was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody. The results of these exemplary assays are summarized in FIG.2B. [0357] As shown in FIG.2A, the activatable antibody comprising CM 6006 (SEQ ID NO: 7) demonstrated an in vivo efficacy that is comparable with the activatable antibody with the control CM 2001 (SEQ ID NO: 78) and similar to cetuximab, which lacks a prodomain. [0358] As shown in FIG. 2B, the activatable antibody with CM 6006 (SEQ ID NO: 7) was cleaved by proteases present in the tumor resulting in activation of the antibody. EXAMPLE 6: In situ Stability of Anti-EGFR Activatable Antibodies in Human Bone Marrow Aspirates [0359] The study provided herein evaluates the in situ stability of activatable antibodies of the present disclosure with the CM 6006 (SEQ ID NO: 7) by human bone marrow aspirates. Fresh human bone marrow aspirates from healthy donors were purchased from Stemcell Technology Inc. (Catalog No.70502) and AllCells Inc. and were processed to lyse red blood cells and washed 5 times with buffer or serum-free media. The cells were plated at a density of 250,000 cells per well in serum-free RPMI media and incubated for 30 min at room temperature with an equal volume of 80 μg/mL unmasked control c225v5 antibody prepared in serum-free RPMI media. An equal volume of AF647-labeled c225 activatable antibodies prepared at 40 μg/mL in serum-free RPMI media were then added to form a mixture and incubated at a final concentration of 20 μg/mL at 37oC for 21 or 24 hours. Cells were pelleted through centrifugation for 5 min at 300 x g. Supernatants were collected from each incubated mixture and transferred into a well of a 96-well PCR plate for assay by capillary electrophoresis. Each supernatant sample was mixed with Pico Sample Buffer (Perkin Elmer) containing 2-beta-mercaptoethanol at four parts sample and one part of Pico Sample Buffer
CYTX-083 and then heated at 95°C for 10 minutes. Substrate cleavage was measured by capillary electrophoresis using a LabChip® GXII TouchTM system (Perkin Elmer) with the HT Pico Protein Express 100 protocol (Perkin Elmer). Protein Express Assay LabChips (Perkin Elmer #760499) were set up using the protocol of the Protein Pico Assay Reagent Kit (Perkin Elmer #760498). The fraction of cleaved activatable antibody in bone marrow cell supernatants was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the LabChip® GX Reviewer software (Perkin Elmer). Data was averaged from N=2 donors and normalized to the CM 2001 cleavage measured by each donor. [0360] As shown in FIG. 3, the activatable antibody with CM 6006 (SEQ ID NO: 7) demonstrated a resistance to cleavage in situ in the bone marrow as compared to activatable antibodies with control CMs 2001 (SEQ ID NO: 78), 5007 (APRSALAHGLF; SEQ ID NO: 80)(WO2020118109) and 3001 (AVGLLAPPGGLSGRSDNH, SEQ ID NO: 79)(WO2016118629). EXAMPLE 7: Evaluation of Protease Activity in Patient-Derived Tumor Samples [0361] Protease activities in patient-derived tumor samples were evaluated using the quantitative zymography (QZ) assay. See Howng, B. et al. “Novel Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies,” Pharmaceutics 2021, 13(9), 1390. Tumor tissue samples from two head and neck cancer patients and one triple negative breast cancer (TNBC) patient were analyzed utilizing activatable antibodies of the present disclosure with the CM 6006 (SEQ ID NO: 7). [0362] The protease activity in the tumor sections of 12 μm thickness was assessed. A hydrophobic barrier was drawn around the tissue sample to maintain liquid on the tissue using an ImmEdge Hydrophobic Barrier Pen (Vector Laboratories), and the slides were then incubated with 40 μg/mL unmasked control c225v5 antibody in buffer consisting of 150 mM Tris HCl pH 7.4, 5 mM CaCl2100 μM ZnCl2, and 0.005% Tween-20 (QZ assay buffer) for 30 minutes at room temperature. An equal volume of AF647-labeled c225 activatable antibodies prepared at 40 μg/mL in QZ buffer were then added directly onto the tissue containing the buffer to form a mixture and incubated at a final concentration of 20 μg/mL in a humidified chamber at 37°C for 48 hours. [0363] Following 48 hours of incubation, supernatants were collected from each incubated mixture and transferred into a well of a 96-well PCR plate for assay by capillary
CYTX-083 electrophoresis. Each supernatant sample was mixed with Pico Sample Buffer (Perkin Elmer) containing 2-beta-mercaptoethanol at four parts sample and one part of Pico Sample Buffer and then heated at 95°C for 10 minutes. The composition of each supernatant sample was then assessed using the LabChip GXII Touch (Perkin Elmer) with the HT Pico Protein Express 100 protocol (Perkin Elmer). Protein Express Assay LabChips (Perkin Elmer #760499) were set up using the protocol of the Protein Pico Assay Reagent Kit (Perkin Elmer #760498). The fraction of cleaved activatable antibody in the tumor tissue supernatants was determined by quantifying the fraction of the higher mobility polypeptide corresponding to the cleaved activatable antibody using the LabChip GX Reviewer software (Perkin Elmer). [0364] As shown in FIGs. 4A-4C, increased light chain (LC) activation is observed in the activatable antibody with CM 6006 (SEQ ID NO: 7) compared to the activatable antibody with the control CM 2001 (SEQ ID NO: 78) in both head and neck tumors and the TNBC tumor. Increased LC activation is observed in the activatable antibody with CM 6006 (SEQ ID NO: 7) compared to the activatable antibody with the control CM 3001 (SEQ ID NO: 79) in head and neck tumor A and the TNBC tumor. Comparable levels of LC activation are observed for activatable antibodies with CM 6006 and control CM 5007 (SEQ ID NO: 80) across the three tumor tissues. EXAMPLE 8: In Vitro Cleavability of Exemplary CMs in a Peptide Probe Cleavage Assay [0365] The study provided herein evaluated the cleavability kinetics (i.e., pM/s and kcat/KM (M-1s-1)) of CMs with membrane type serine protease 1 (MT-SP1). The CMs listed in Table 9 below were presented in an internally quenched peptide probe format, rather than included in an activatable antibody format. In the internally quenched probes, the CM sequence was positioned between a 7-methoxycoumarin-4-acetyl (MCA) fluorophore and a 2,4-dinitrophenyl (DNP) quencher such that cleavage of the CM sequence produced a fluorescence signal. The probes were of the following designs: (MCA)-Gly-Ser-His-Gln-Ser- X1-X2-Gly-Ser-Lys(DNP)-D-Arg (SEQ ID NO: 161) where X1 is Arg or Lys and X2 is Ser, and (MCA)-Gly-Ser-His-Gln-Ser-X1-Gly-Gly-Ser-Lys(DNP)-D-Arg (SEQ ID NO: 162) where X1 is Arg, as indicated in Table 9. The cleavage rates (pM/s) were measured using 20 μM internally quenched peptide probe and 20 nM MT-SP1. Cleavability kinetics (i.e., pM/s and kcat/KM (M-1s-1)) were determined in 96- or 384-well plate format at 37ºC in 50 mM TRIS- HCl (pH 7.4), 150 mM NaCl, 0.05% Tween 20 on an Infinite 200 PRO (Tecan) multimode
CYTX-083 plate reader using a fluorescence excitation wavelength of 320 nm and an emission wavelength of 405 nm. Table 9. CMs tested in peptide format Sequence SEQ ID NO: HQSRS 2 [0366]
plary CMs of Table 9 with MT-SP1. Table 11 provides exemplary kcat/KM (M-1 s-1) values of the exemplary CMs of Table 9 with MT-SP1.
Table 10. In Vitro Activation of Peptide Probes with Exemplary CMs (pM/s) Probe CM Sequence Probe Cleavage (pM/s) MT-SP1
Table 11. In Vitro Activation of Peptide Probes with Exemplary CMs (kcat/KM) Probe CM Sequence Probe Cleavage (kcat/KM) MT-SP1
[0367] These exemplary results show that CMs HQSRS (SEQ ID NO: 2), HQSR (SEQ ID NO: 1), and HQSKS (SEQ ID NO: 66) had high cleavability by MT-SP1, with a kcat/KM (M-1s-1) of greater than 2.5 x 104 M-1 s-1. Table 12. Exemplary sequences
CYTX-083 SEQ Notes Sequences ID NO
CYTX-083 40 6039 SDHQSRSAL 41 6040 HQSRSALA
CYTX-083 EGFR Mask CISPRGCPDGPYVMY EGFR Mask CISPRGCLDGPYVMY S R G T P T S Y E G K SI L L V S Y E G K A F T
CYTX-083 WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKA DYEKHKVYACEVTHQGLSSPVTKSFNRGEC AA /5007 V LK SGPGLV PS SLSITCTVSGFSLTNYGVHWV V S Y E G K V P K S G K G F T R W A V K
CYTX-083 AA w/6006 - same as SEQ ID NO:84 heavy chain P C1202 lih G SG GCISPRGCPDGPYVMYGGGSSGGSH SRSG S S H E E
CYTX-083 VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL VSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS LSLG e P E C F e L S G V e V G N N e L R P S T Y T
CYTX-083 *Note: the Fc may further comprise a lysine residue (K) at the C-terminus. H I G4 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTV L e
CYTX-083 antibody heavy QGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLV chain KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGT TYICNVNHKPSNTKVDKKVEPKSCD Y E G K S I L Y
[0368] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims. [0369] All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition section headings, the materials, methods, and examples are illustrative only and not intended to be limiting.
Claims
CYTX-083 WHAT IS CLAIMED IS: 1. An isolated polypeptide comprising a cleavable moiety (CM) comprising amino acid sequence HQSR (SEQ ID NO: 1), or HQSKS (SEQ ID NO: 66), wherein the CM is a substrate for a protease. 2. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence HQSRS (SEQ ID NO: 2). 3. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence HQSRSG (SEQ ID NO: 3). 4. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence SHQSRS (SEQ ID NO: 4). 5. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence HQSRSA (SEQ ID NO: 5). 6. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence DHQSRS (SEQ ID NO: 6). 7. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence SDHQSRS (SEQ ID NO: 7). 8. The isolated polypeptide of claim 1, wherein the CM comprises the amino acid sequence HQSKS (SEQ ID NO: 66). 9. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence selected from SEQ ID NOs: 1-74, wherein the CM is a substrate for a protease.
CYTX-083 10. An isolated polypeptide comprising a cleavable moiety (CM) comprising an amino acid sequence with one-amino acid or two-amino acid mutation(s) in any one of SEQ ID NOs: 1-74, wherein the CM is a substrate for a protease. 11. The isolated polypeptide of any one of claims 1-10, wherein the isolated polypeptide is an activatable molecule and further comprises an active moiety (AM) that specifically binds a target. 12. The isolated polypeptide of claim 11, wherein the AM is an antibody or antigen- binding fragment thereof. 13. The isolated polypeptide of claim 12, wherein the antigen-binding fragment is selected from the group consisting of a Fab fragment, a F(ab’)2 fragment, a scFv, a scAb, a dAb, a single domain heavy chain antibody, and a single domain light chain antibody. 14. The isolated polypeptide of claim 11, wherein the AM is a therapeutic macromolecule. 15. The isolated polypeptide of claim 11, wherein the AM is a cytokine or a chimeric antigen receptor. 16. The isolated polypeptide of any one of claims 11-15, wherein the AM is coupled to the CM. 17. The isolated polypeptide of claim 16, wherein the AM is directly coupled to the CM. 18. The isolated polypeptide of claim 16, wherein the AM is indirectly coupled to the CM via a linking peptide. 19. The isolated polypeptide of any one of claims 11-18, further comprising a masking moiety (MM).
CYTX-083 20. The isolated polypeptide of claim 19, wherein the MM has a dissociation constant for binding to the AM that is greater than a dissociation constant of the AM for binding to the target. 21. The isolated polypeptide of claim 19 or 20, wherein the MM is 2 to 40 amino acids in length. 22. The isolated polypeptide of any one of claims 19-21, wherein the MM is coupled to the CM such that the isolated polypeptide comprises the structural arrangement from N-terminus to C-terminus as follows: MM-CM-AM or AM-CM-MM. 23. The isolated polypeptide of claim 22, wherein the MM is coupled directly to the CM. 24. The isolated polypeptide of claim 22, wherein the MM is coupled indirectly to the CM via a linking peptide. 25. The isolated polypeptide of any one of claims 18-22 and 24, wherein the isolated polypeptide comprises a first linking peptide (LP1) and a second linking peptide (LP2), and wherein the isolated polypeptide has a structural arrangement from N- terminus to C-terminus as follows: MM-LP1-CM-LP2-AM or AM-LP2-CM-LP1- MM. 26. The isolated polypeptide of claim 25, wherein the LP1 and LP2 are not identical to each other. 27. The isolated polypeptide of claim 25, wherein the LP1 and LP2 are identical to each other. 28. The isolated polypeptide of any one of claims 25-27, wherein each of LP1 and LP2 is a peptide of 1 to 20 amino acids in length.
CYTX-083 29. The isolated polypeptide of any one of claims 1-28, wherein the CM is a substrate for a serine protease. 30. The isolated polypeptide of claim 29, wherein the serine protease is membrane type serine protease 1 (MT-SP1). 31. The isolated polypeptide of claim 30, wherein the kcat/KM of the CM by MT-SP1 cleavage is at least 1 x 103 M-1s-1. 32. The isolated polypeptide of claim 30, wherein the kcat/KM of the CM by MT-SP1 cleavage is at least 1 x 104 M-1s-1. 33. The isolated polypeptide of claim 29, wherein the serine protease is transmembrane protease serine 11 (TMPRSS11), 34. The isolated polypeptide of claim 33, wherein the kcat/KM of the CM by TMPRSS11 cleavage is at least 1 x 103 M-1s-1. 35. The isolated polypeptide of claim 33, wherein the kcat/KM of the CM by TMPRSS11 cleavage is at least 1 x 104 M-1s-1. 36. The isolated polypeptide of any one of claims 1-35, wherein the CM is resistant to cleavage in situ in human bone marrow. 37. The isolated polypeptide of any one of claims 1-35, wherein the CM is resistant to cleavage in vivo in human bone marrow. 38. The isolated polypeptide of any one of claims 1-37, further comprising one or more additional cleavable moieties, optionally wherein at least a portion of the CM overlaps with at least a portion of a second cleavable moiety.
CYTX-083 39. A polypeptide complex comprising one or more of the isolated polypeptides of any one of claims 1-38 bound to a second isolated polypeptide. 40. A conjugated polypeptide comprising the isolated polypeptide of any one of claims 1-38 conjugated to an agent. 41. The conjugated polypeptide of claim 40, wherein the agent is conjugated to the isolated polypeptide via a conjugating linker. 42. The conjugated polypeptide of claim 41, wherein the conjugating linker is cleavable. 43. The conjugated polypeptide of claim 41, wherein the conjugating linker is non- cleavable. 44. The conjugated polypeptide of claim 42, wherein the conjugating linker comprises an amino acid sequence selected from SEQ ID NOs: 1-74. 45. The conjugated polypeptide of any one of claims 39-44, wherein the agent is a toxin, a microtubule inhibitor, a nucleic acid damaging agent, a dolastatin, an auristatin, a maytansinoid, a duocarmycin, a calicheamicin, or a combination thereof. 46. A composition comprising the isolated polypeptide of any one of claims 1-38, the polypeptide complex of claim 39, or the conjugated polypeptide of any one of claims 40-45, and a carrier. 47. The composition of claim 46, wherein the carrier is a pharmaceutically acceptable carrier. 48. The composition of claim 46 or 47, comprising an additional agent. 49. The composition of claim 48, wherein the additional agent is a therapeutic agent. 50. An isolated nucleic acid molecule encoding the isolated polypeptide of any one of claims 1-38.
CYTX-083 51. A vector comprising the isolated nucleic acid molecule of claim 50. 52. A cell comprising the isolated polypeptide of any one of claims 1-38, the isolated nucleic acid molecule of claim 50, or the vector of claim 51. 53. A method of manufacturing an activatable molecule that contains a cleavable moiety (CM), the method comprising expressing and recovering an activatable molecule comprising the isolated polypeptide of any one of claims 1-38. 54. A method of treating, alleviating a symptom of, or delaying the progression of a disease or disorder in a subject, comprising administering a therapeutically effective amount of the isolated polypeptide of any one of claims 1-38, the polypeptide complex of claim 39, or the conjugated polypeptide of any one of claims 40-45, the composition of any one of claims 46-49, the nucleic acid molecule of claim 50, the vector of claim 51, or the cell of claim 52 to the subject. 55. The method of claim 54, wherein the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder. 56. The isolated polypeptide of any one of claims 1-38, the polypeptide complex of claim 39, or the conjugated polypeptide of any one of claims 40-45, the composition of any one of claims 46-49, the nucleic acid molecule of claim 50, the vector of claim 51, or the cell of claim 52 for use as a medicament or for use in therapy, optionally for treating a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder, optionally with an additional agent which is optionally a therapeutic agent. 57. A method of detecting or diagnosing a disease or health condition of a subject, comprising: contacting the isolated polypeptide of any one of claims 1-38, the polypeptide complex of claim 39, or the conjugated polypeptide of any one of
CYTX-083 claims 40-45, or the composition of any one of claims 46-49 with a sample from the subject; and measuring a level of cleavage of the isolated polypeptide, thereby detecting or diagnosing the disease or health condition of the subject. 58. The method of claim 57, wherein the disease is a cancer, an infection, an inflammatory disorder, a cardiovascular disorder, a neurodegenerative disorder, or an autoimmune disorder.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263370020P | 2022-08-01 | 2022-08-01 | |
US63/370,020 | 2022-08-01 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024030843A1 true WO2024030843A1 (en) | 2024-02-08 |
Family
ID=87801056
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2023/071298 WO2024030843A1 (en) | 2022-08-01 | 2023-07-31 | Protease-cleavable moieties and methods of use thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024030843A1 (en) |
Citations (47)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
US5030719A (en) | 1986-08-28 | 1991-07-09 | Teijin Limited | Cytotoxic antibody conjugates and a process for preparation thereof |
WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
WO2009025846A2 (en) | 2007-08-22 | 2009-02-26 | The Regents Of The University Of California | Activatable binding polypeptides and methods of identification and use thereof |
US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
WO2010081173A2 (en) | 2009-01-12 | 2010-07-15 | Cytomx Therapeutics, Llc | Modified antibody compositions, methods of making and using thereof |
WO2010129609A2 (en) | 2009-05-07 | 2010-11-11 | The Regents Of The University Of California | Antibodies and methods of use thereof |
US8586714B2 (en) | 2009-09-01 | 2013-11-19 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
US8716450B2 (en) | 2009-10-15 | 2014-05-06 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8722855B2 (en) | 2009-10-28 | 2014-05-13 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8735546B2 (en) | 2010-08-03 | 2014-05-27 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8822645B2 (en) | 2008-07-08 | 2014-09-02 | Abbvie Inc. | Prostaglandin E2 dual variable domain immunoglobulins and uses thereof |
WO2015048329A2 (en) | 2013-09-25 | 2015-04-02 | Cytomx Therapeutics, Inc. | Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof |
WO2015116933A2 (en) | 2014-01-31 | 2015-08-06 | Cytomx Therapeutics, Inc. | Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof |
WO2016014974A2 (en) | 2014-07-25 | 2016-01-28 | Cytomx Therapeutics, Inc. | Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same |
WO2016118629A1 (en) | 2015-01-20 | 2016-07-28 | Cytomx Therapeutics, Inc. | Matrix metalloprotease-cleavable and serine protease cleavable substrates and methods of use thereof |
WO2016149201A2 (en) | 2015-03-13 | 2016-09-22 | Cytomx Therapeutics, Inc. | Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof |
WO2016179285A1 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-cd166 antibodies, activatable anti-cd166 antibodies, and methods of use thereof |
WO2016179257A2 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-cd71 antibodies, activatable anti-cd71 antibodies, and methods of use thereof |
WO2016179335A1 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-itga3 antibodies, activatable anti-itga3 antibodies, and methods of use thereof |
WO2017011580A2 (en) | 2015-07-13 | 2017-01-19 | Cytomx Therapeutics, Inc. | Anti-pd-1 antibodies, activatable anti-pd-1 antibodies, and methods of use thereof |
WO2018085555A1 (en) | 2016-11-03 | 2018-05-11 | Bristol-Myers Squibb Company | Activatable anti-ctla-4 antibodies and uses thereof |
WO2018165619A1 (en) | 2017-03-09 | 2018-09-13 | Cytomx Therapeutics, Inc. | Cd147 antibodies, activatable cd147 antibodies, and methods of making and use thereof |
WO2018222949A1 (en) | 2017-06-01 | 2018-12-06 | Cytomx Therapeutics, Inc. | Activatable anti-pdl1 antibodies, and methods of use thereof |
WO2019014586A1 (en) | 2017-07-14 | 2019-01-17 | Cytomx Therapeutics, Inc. | Anti-cd166 antibodies and uses thereof |
WO2019018828A1 (en) | 2017-07-20 | 2019-01-24 | Cytomx Therapeutics, Inc. | Methods of qualitatively and/or quantitatively analyzing properties of activatable antibodies and uses thereof |
WO2019046652A1 (en) | 2017-08-30 | 2019-03-07 | Cytomx Therapeutics, Inc. | Activatable anti-cd166 antibodies and methods of use thereof |
WO2019075405A1 (en) | 2017-10-14 | 2019-04-18 | Cytomx Therapeutics, Inc. | Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof |
WO2019165143A1 (en) | 2018-02-21 | 2019-08-29 | Cytomx Therapeutics, Inc. | Positron emission tomography imaging of activatable binding polypeptides and related compositions thereof |
WO2019173771A1 (en) | 2018-03-09 | 2019-09-12 | Cytomx Therapeutics, Inc. | Activatable cd147 antibodies and methods of making and use thereof |
WO2019183218A1 (en) | 2018-03-20 | 2019-09-26 | Cytomx Therapeutics, Inc. | Systems and methods for quantitative pharmacological modeling of activatable antibody species in mammalian subjects |
WO2019213444A1 (en) | 2018-05-02 | 2019-11-07 | Cytomx Therapeutics, Inc. | Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof |
WO2020086665A1 (en) | 2018-10-26 | 2020-04-30 | Immunogen, Inc. | Epcam antibodies, activatable antibodies, and immunoconjugates, and uses thereof |
WO2020092881A1 (en) | 2018-11-02 | 2020-05-07 | Cytomx Therapeutics, Inc. | Activatable anti-cd166 antibodies and methods of use thereof |
WO2020118109A2 (en) | 2018-12-06 | 2020-06-11 | Cytomx Therapeutics, Inc. | Matrix metalloprotease-cleavable and serine or cysteine protease-cleavable substrates and methods of use thereof |
WO2020176672A1 (en) | 2019-02-26 | 2020-09-03 | Cytomx Therapeutics, Inc. | Combined therapies of activatable immune checkpoint inhibitors and conjugated activatable antibodies |
US20200308243A1 (en) | 2009-02-23 | 2020-10-01 | Cytomx Therapeutics, Inc | Proproteins and methods of use thereof |
WO2020236679A1 (en) | 2019-05-17 | 2020-11-26 | Cytomx Therapeutics, Inc. | Methods and compositions for determining the biodistribution of activatable anti-cd166 antibody conjugates |
WO2020252358A1 (en) | 2019-06-13 | 2020-12-17 | Cytomx Therapeutics, Inc. | Use of an activatable anti-pdl1 antibody and an anti-ctla-4 antibody in a neoadjuvant combination therapy for the treatment of cancer |
WO2020252349A1 (en) | 2019-06-13 | 2020-12-17 | Cytomx Therapeutics, Inc. | Use of an activatable anti-pdl1 antibody and an anti-ctla-4 antibody in a combination therapy for the treatment of cancer |
WO2021061867A1 (en) | 2019-09-23 | 2021-04-01 | Cytomx Therapeutics, Inc. | Anti-cd47 antibodies, activatable anti-cd47 antibodies, and methods of use thereof |
WO2021142029A1 (en) | 2020-01-06 | 2021-07-15 | Cytomx Therapeutics, Inc. | Auristatin-related compounds, conjugated auristatin-related compounds, and methods of use thereof |
WO2021207669A1 (en) | 2020-04-10 | 2021-10-14 | Cytomx Therapeutics, Inc. | Activatable cytokine constructs and related compositions and methods |
WO2021207657A1 (en) | 2020-04-09 | 2021-10-14 | Cytomx Therapeutics, Inc. | Compositions containing activatable antibodies |
-
2023
- 2023-07-31 WO PCT/US2023/071298 patent/WO2024030843A1/en unknown
Patent Citations (49)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
US5030719A (en) | 1986-08-28 | 1991-07-09 | Teijin Limited | Cytotoxic antibody conjugates and a process for preparation thereof |
US5013556A (en) | 1989-10-20 | 1991-05-07 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
WO1994011026A2 (en) | 1992-11-13 | 1994-05-26 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma |
US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
US8258268B2 (en) | 2005-08-19 | 2012-09-04 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
WO2009025846A2 (en) | 2007-08-22 | 2009-02-26 | The Regents Of The University Of California | Activatable binding polypeptides and methods of identification and use thereof |
US8822645B2 (en) | 2008-07-08 | 2014-09-02 | Abbvie Inc. | Prostaglandin E2 dual variable domain immunoglobulins and uses thereof |
WO2010081173A2 (en) | 2009-01-12 | 2010-07-15 | Cytomx Therapeutics, Llc | Modified antibody compositions, methods of making and using thereof |
US20200308243A1 (en) | 2009-02-23 | 2020-10-01 | Cytomx Therapeutics, Inc | Proproteins and methods of use thereof |
WO2010129609A2 (en) | 2009-05-07 | 2010-11-11 | The Regents Of The University Of California | Antibodies and methods of use thereof |
US8586714B2 (en) | 2009-09-01 | 2013-11-19 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
US8716450B2 (en) | 2009-10-15 | 2014-05-06 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8722855B2 (en) | 2009-10-28 | 2014-05-13 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8735546B2 (en) | 2010-08-03 | 2014-05-27 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
WO2015048329A2 (en) | 2013-09-25 | 2015-04-02 | Cytomx Therapeutics, Inc. | Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof |
WO2015116933A2 (en) | 2014-01-31 | 2015-08-06 | Cytomx Therapeutics, Inc. | Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof |
WO2016014974A2 (en) | 2014-07-25 | 2016-01-28 | Cytomx Therapeutics, Inc. | Anti-cd3 antibodies, activatable anti-cd3 antibodies, multispecific anti-cd3 antibodies, multispecific activatable anti-cd3 antibodies, and methods of using the same |
WO2016118629A1 (en) | 2015-01-20 | 2016-07-28 | Cytomx Therapeutics, Inc. | Matrix metalloprotease-cleavable and serine protease cleavable substrates and methods of use thereof |
WO2016149201A2 (en) | 2015-03-13 | 2016-09-22 | Cytomx Therapeutics, Inc. | Anti-pdl1 antibodies, activatable anti-pdl1 antibodies, and methods of use thereof |
WO2016179285A1 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-cd166 antibodies, activatable anti-cd166 antibodies, and methods of use thereof |
WO2016179257A2 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-cd71 antibodies, activatable anti-cd71 antibodies, and methods of use thereof |
WO2016179335A1 (en) | 2015-05-04 | 2016-11-10 | Cytomx Therapeutics, Inc. | Anti-itga3 antibodies, activatable anti-itga3 antibodies, and methods of use thereof |
WO2017011580A2 (en) | 2015-07-13 | 2017-01-19 | Cytomx Therapeutics, Inc. | Anti-pd-1 antibodies, activatable anti-pd-1 antibodies, and methods of use thereof |
WO2018085555A1 (en) | 2016-11-03 | 2018-05-11 | Bristol-Myers Squibb Company | Activatable anti-ctla-4 antibodies and uses thereof |
WO2018165619A1 (en) | 2017-03-09 | 2018-09-13 | Cytomx Therapeutics, Inc. | Cd147 antibodies, activatable cd147 antibodies, and methods of making and use thereof |
WO2018222949A1 (en) | 2017-06-01 | 2018-12-06 | Cytomx Therapeutics, Inc. | Activatable anti-pdl1 antibodies, and methods of use thereof |
WO2019014586A1 (en) | 2017-07-14 | 2019-01-17 | Cytomx Therapeutics, Inc. | Anti-cd166 antibodies and uses thereof |
WO2019018828A1 (en) | 2017-07-20 | 2019-01-24 | Cytomx Therapeutics, Inc. | Methods of qualitatively and/or quantitatively analyzing properties of activatable antibodies and uses thereof |
WO2019046652A1 (en) | 2017-08-30 | 2019-03-07 | Cytomx Therapeutics, Inc. | Activatable anti-cd166 antibodies and methods of use thereof |
WO2019075405A1 (en) | 2017-10-14 | 2019-04-18 | Cytomx Therapeutics, Inc. | Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof |
US20190135943A1 (en) | 2017-10-14 | 2019-05-09 | Cytomx Therapeutics, Inc. | Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof |
WO2019165143A1 (en) | 2018-02-21 | 2019-08-29 | Cytomx Therapeutics, Inc. | Positron emission tomography imaging of activatable binding polypeptides and related compositions thereof |
WO2019173771A1 (en) | 2018-03-09 | 2019-09-12 | Cytomx Therapeutics, Inc. | Activatable cd147 antibodies and methods of making and use thereof |
WO2019183218A1 (en) | 2018-03-20 | 2019-09-26 | Cytomx Therapeutics, Inc. | Systems and methods for quantitative pharmacological modeling of activatable antibody species in mammalian subjects |
WO2019213444A1 (en) | 2018-05-02 | 2019-11-07 | Cytomx Therapeutics, Inc. | Antibodies, activatable antibodies, bispecific antibodies, and bispecific activatable antibodies and methods of use thereof |
WO2020086665A1 (en) | 2018-10-26 | 2020-04-30 | Immunogen, Inc. | Epcam antibodies, activatable antibodies, and immunoconjugates, and uses thereof |
WO2020092881A1 (en) | 2018-11-02 | 2020-05-07 | Cytomx Therapeutics, Inc. | Activatable anti-cd166 antibodies and methods of use thereof |
WO2020118109A2 (en) | 2018-12-06 | 2020-06-11 | Cytomx Therapeutics, Inc. | Matrix metalloprotease-cleavable and serine or cysteine protease-cleavable substrates and methods of use thereof |
WO2020176672A1 (en) | 2019-02-26 | 2020-09-03 | Cytomx Therapeutics, Inc. | Combined therapies of activatable immune checkpoint inhibitors and conjugated activatable antibodies |
WO2020236679A1 (en) | 2019-05-17 | 2020-11-26 | Cytomx Therapeutics, Inc. | Methods and compositions for determining the biodistribution of activatable anti-cd166 antibody conjugates |
WO2020252358A1 (en) | 2019-06-13 | 2020-12-17 | Cytomx Therapeutics, Inc. | Use of an activatable anti-pdl1 antibody and an anti-ctla-4 antibody in a neoadjuvant combination therapy for the treatment of cancer |
WO2020252349A1 (en) | 2019-06-13 | 2020-12-17 | Cytomx Therapeutics, Inc. | Use of an activatable anti-pdl1 antibody and an anti-ctla-4 antibody in a combination therapy for the treatment of cancer |
WO2021061867A1 (en) | 2019-09-23 | 2021-04-01 | Cytomx Therapeutics, Inc. | Anti-cd47 antibodies, activatable anti-cd47 antibodies, and methods of use thereof |
WO2021142029A1 (en) | 2020-01-06 | 2021-07-15 | Cytomx Therapeutics, Inc. | Auristatin-related compounds, conjugated auristatin-related compounds, and methods of use thereof |
WO2021207657A1 (en) | 2020-04-09 | 2021-10-14 | Cytomx Therapeutics, Inc. | Compositions containing activatable antibodies |
WO2021207669A1 (en) | 2020-04-10 | 2021-10-14 | Cytomx Therapeutics, Inc. | Activatable cytokine constructs and related compositions and methods |
Non-Patent Citations (47)
Title |
---|
"Contributions to Microbiology and Immunology", 1989, CARGER PRESS, article "Conjugate Vaccines" |
"Current Protocols in Molecular Biology", CURRENT PROTOCOLS, 1993 |
B. TURK: "Targeting proteases: successes, failures and future prospects", NATURE REVIEWS DRUG DISCOVERY, vol. 5, 2006, XP002556191, DOI: 10.1038/nrd2092 |
BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 |
CAS , no. 61791-12-6 |
CROMIE ET AL., CURR. TOP. MED. CHEM., vol. 15, 2016, pages 2543 - 2557 |
DARRAGH MOLLY R ET AL: "MT-SP1 proteolysis and regulation of cell-microenvironment interactions", FRONTIERS IN BIOSCIENCE, FRONTIERS IN BIOSCIENCE, ALBERTSON, NY, US, vol. 13, 1 January 2008 (2008-01-01), pages 528 - 539, XP002786599, ISSN: 1093-9946 * |
DATABASE UniProt [online] 13 July 2010 (2010-07-13), "SubName: Full=AT1G14580-like protein {ECO:0000313|EMBL:ADG37877.1}; Flags: Fragment;", XP093094834, retrieved from EBI accession no. UNIPROT:D6PNE5 Database accession no. D6PNE5 * |
DATABASE UniProt [online] 2 June 2021 (2021-06-02), "SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CAD9470403.1};", XP093094976, retrieved from EBI accession no. UNIPROT:A0A7S2GUI1 Database accession no. A0A7S2GUI1 * |
DATABASE UniProt [online] 5 December 2018 (2018-12-05), "SubName: Full=DUF354 domain-containing protein {ECO:0000313|EMBL:RKI84039.1};", XP093094568, retrieved from EBI accession no. UNIPROT:A0A3A8ZXS7 Database accession no. A0A3A8ZXS7 * |
DATABASE UniProt [online] 8 May 2019 (2019-05-08), "RecName: Full=Wax synthase domain-containing protein {ECO:0000259|Pfam:PF13813};", XP093094943, retrieved from EBI accession no. UNIPROT:A0A409YG42 Database accession no. A0A409YG42 * |
DAVIES ET AL., ANNUAL REV BIOCHEM, vol. 59, 1990, pages 439 - 473 |
DE GENST ET AL., DEV. COMP. IMMUNOL., vol. 30, 2006, pages 187 - 198 |
DE MEYER ET AL., TRENDS BIOTECHNOL, vol. 32, 2014, pages 263 - 270 |
DIGIAMMARINO ET AL., METHODS MOL. BIOL., vol. 899, 2012, pages 145 - 156 |
EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 |
GARBER, NATURE REVIEWS DRUG DISCOVERY, vol. 13, 2014, pages 799 - 801 |
GOBIN ET AL.: "A pan-cancer perspective of matrix metalloproteases (MMP) gene expression profile and their diagnostic/prognostic potential", BMC CANCER, vol. 19, no. 1, 14 June 2019 (2019-06-14), pages 581 |
HOWNG ET AL.: "Novel Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies", PHARMACEUTICS, vol. 13, no. 9, 2 September 2021 (2021-09-02), pages 1390, XP093006309, DOI: 10.3390/pharmaceutics13091390 |
HOWNG, B ET AL.: "Novel Ex Vivo Zymography Approach for Assessment of Protease Activity in Tissues with Activatable Antibodies", PHARMACEUTICS, vol. 13, no. 9, 2021, pages 1390, XP093006309, DOI: 10.3390/pharmaceutics13091390 |
HWANG ET AL., PROC. NATL ACAD. SCI. USA, vol. 77, 1980, pages 4030 |
JAKOB ET AL., MABS, vol. 5, 2013, pages 358 - 363 |
KIJANKA ET AL., NANOMEDICINE, vol. 10, 2015, pages 161 - 174 |
KOVALEVA ET AL., EXPERT. OPIN. BIOL. THER., vol. 14, 2014, pages 1527 - 1539 |
KRAH ET AL., IMMUNOPHARMACOL. IMMUNOTOXICOL., vol. 38, 2016, pages 21 - 28 |
L. DESNOYERS ET AL.: "Tumor-specific activation of an EGFR-targeting probody enhances therapeutic index", SCIENCE TRANSLATIONAL MEDICINE, vol. 5, no. 207, 2013, XP055296685, DOI: 10.1126/scitranslmed.3006682 |
LEVESQUE JEAN-PIERRE ET AL: "Characterization of hematopoietic progenitor mobilization in protease-deficient mice", BLOOD, vol. 104, no. 1, 1 July 2004 (2004-07-01), US, pages 65 - 72, XP093095092, ISSN: 0006-4971, DOI: 10.1182/blood-2003-05-1589 * |
MARTIN ET AL., J. BIOL. CHEM., vol. 257, 1982, pages 286 - 288 |
MITRALAWTON, J. AMER. CHEM. SOC., vol. 101, 1979, pages 3097 - 3110 |
MUJIC-DELIC ET AL., TRENDS PHARMACOL. SCI, vol. 35, 2014, pages 247 - 255 |
MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235 |
MUYLDERMANS, ANN. REV. BIOCHEM., vol. 82, 2013, pages 775 - 797 |
MUYLDERMANS, J. BIOTECHNOL., vol. 74, 2001, pages 277 - 302 |
NATURE, vol. 361, 1993, pages 186 - 87 |
O. ERSTER ET AL.: "Site-specific targeting of antibody activity in vivo mediated by disease-associated proteases", J. CONTROL RELEASE, vol. 161, no. 3, 2012, pages 804 - 812 |
O. VASILJEVA ET AL.: "Monitoring protease activity in biological tissues using antibody prodrugs as sensing probes", SCIENTIFIC REPORTS, vol. 10, 2020, pages 5894 |
RAHBARIZADEH ET AL., IMMUNOL, INVEST., vol. 40, 2011, pages 299 - 338 |
RAMAKRISHNAN, S ET AL., CANCER RES., vol. 44, 1984, pages 201 - 208 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS |
SCHERAGA, REV. COMPUTATIONAL CHEM., 1992, pages 11173 - 142 |
THOMTON, NATURE, vol. 354, 1991, pages 105 |
VAN AUDENHOVE ET AL., EBIOMEDICINE, vol. 8, 2016, pages 40 - 48 |
VAN BOCKSTAELE ET AL., CURR. OPIN. INVESTIG. DRUGS, vol. 10, 2009, pages 1212 - 1224 |
VASILJEVA ET AL.: "The multifaceted roles of tumor-associated proteases and harnessing their activity for prodrug activation", BIOL. CHEM, 22 April 2019 (2019-04-22) |
VINCKE ET AL., METHODS MOL, BIOL, vol. 911, 2012, pages 15 - 26 |
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098 |
WESOLOWSKI ET AL., MED. MICROBIOL. IMMUNOL., vol. 198, 2009, pages 157 - 174 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11884746B2 (en) | Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof | |
US20240084022A1 (en) | Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof | |
US11802158B2 (en) | Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same | |
US20210238291A1 (en) | Multispecific antibodies, multispecific activatable antibodies and methods of using the same | |
US20200377602A1 (en) | Matrix metalloprotease-cleavable and serine or cysteine protease-cleavable substrates and methods of use thereof | |
WO2024030843A1 (en) | Protease-cleavable moieties and methods of use thereof | |
WO2024030845A1 (en) | Protease-cleavable moieties and methods of use thereof | |
WO2024030858A1 (en) | Protease-cleavable substrates and methods of use thereof | |
WO2024030850A1 (en) | Protease-cleavable substrates and methods of use thereof | |
WO2024030847A1 (en) | Protease-cleavable moieties and methods of use thereof | |
WO2023192973A1 (en) | Activatable multispecific molecules and methods of use thereof | |
WO2023192606A2 (en) | Cd3-binding proteins and methods of use thereof | |
WO2023183923A1 (en) | Activatable dual-anchored masked molecules and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23761346 Country of ref document: EP Kind code of ref document: A1 |