WO2024018037A1 - Microalgae expressing glp-2 and uses thereof - Google Patents
Microalgae expressing glp-2 and uses thereof Download PDFInfo
- Publication number
- WO2024018037A1 WO2024018037A1 PCT/EP2023/070232 EP2023070232W WO2024018037A1 WO 2024018037 A1 WO2024018037 A1 WO 2024018037A1 EP 2023070232 W EP2023070232 W EP 2023070232W WO 2024018037 A1 WO2024018037 A1 WO 2024018037A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- host cell
- disorders
- treatment
- biomass
- Prior art date
Links
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 claims abstract description 86
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 claims abstract description 72
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 claims abstract description 70
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 64
- 238000011282 treatment Methods 0.000 claims abstract description 58
- 208000035475 disorder Diseases 0.000 claims abstract description 40
- 230000002265 prevention Effects 0.000 claims abstract description 25
- 239000002417 nutraceutical Substances 0.000 claims abstract description 8
- 235000021436 nutraceutical agent Nutrition 0.000 claims abstract description 8
- 150000007523 nucleic acids Chemical class 0.000 claims description 49
- 239000002028 Biomass Substances 0.000 claims description 47
- 102000039446 nucleic acids Human genes 0.000 claims description 45
- 108020004707 nucleic acids Proteins 0.000 claims description 45
- 238000000034 method Methods 0.000 claims description 42
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 40
- 108091033319 polynucleotide Proteins 0.000 claims description 38
- 102000040430 polynucleotide Human genes 0.000 claims description 38
- 239000002157 polynucleotide Substances 0.000 claims description 38
- 230000000968 intestinal effect Effects 0.000 claims description 34
- 208000027244 Dysbiosis Diseases 0.000 claims description 23
- 230000007140 dysbiosis Effects 0.000 claims description 23
- 239000000203 mixture Substances 0.000 claims description 23
- 230000000295 complement effect Effects 0.000 claims description 20
- 241001465754 Metazoa Species 0.000 claims description 18
- 208000029560 autism spectrum disease Diseases 0.000 claims description 18
- 235000013305 food Nutrition 0.000 claims description 18
- 230000006872 improvement Effects 0.000 claims description 18
- 244000005709 gut microbiome Species 0.000 claims description 17
- 230000002757 inflammatory effect Effects 0.000 claims description 17
- 208000002551 irritable bowel syndrome Diseases 0.000 claims description 15
- 241000196319 Chlorophyceae Species 0.000 claims description 14
- 239000001963 growth medium Substances 0.000 claims description 14
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 13
- 208000011231 Crohn disease Diseases 0.000 claims description 13
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 13
- 230000001684 chronic effect Effects 0.000 claims description 13
- 241000168525 Haematococcus Species 0.000 claims description 12
- 239000000047 product Substances 0.000 claims description 12
- 208000011580 syndromic disease Diseases 0.000 claims description 12
- 208000006386 Bone Resorption Diseases 0.000 claims description 11
- 241000195649 Chlorella <Chlorellales> Species 0.000 claims description 11
- 208000030814 Eating disease Diseases 0.000 claims description 11
- 208000019454 Feeding and Eating disease Diseases 0.000 claims description 11
- 208000001132 Osteoporosis Diseases 0.000 claims description 11
- 241001293481 Trebouxiophyceae Species 0.000 claims description 11
- 230000024279 bone resorption Effects 0.000 claims description 11
- 235000014632 disordered eating Nutrition 0.000 claims description 11
- 102000004190 Enzymes Human genes 0.000 claims description 10
- 108090000790 Enzymes Proteins 0.000 claims description 10
- 229940088598 enzyme Drugs 0.000 claims description 10
- 239000000284 extract Substances 0.000 claims description 8
- 239000002609 medium Substances 0.000 claims description 8
- 108010059892 Cellulase Proteins 0.000 claims description 7
- 229940106157 cellulase Drugs 0.000 claims description 7
- 239000004615 ingredient Substances 0.000 claims description 7
- 230000002101 lytic effect Effects 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- 239000013589 supplement Substances 0.000 claims description 7
- 229920001223 polyethylene glycol Polymers 0.000 claims description 6
- 240000009108 Chlorella vulgaris Species 0.000 claims description 5
- 235000007089 Chlorella vulgaris Nutrition 0.000 claims description 5
- 101000925662 Enterobacteria phage PRD1 Endolysin Proteins 0.000 claims description 5
- 241000168517 Haematococcus lacustris Species 0.000 claims description 5
- 108091005804 Peptidases Proteins 0.000 claims description 5
- 239000004365 Protease Substances 0.000 claims description 5
- -1 driselasi Proteins 0.000 claims description 5
- 238000002360 preparation method Methods 0.000 claims description 5
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 claims description 4
- 229930195725 Mannitol Natural products 0.000 claims description 4
- 239000002202 Polyethylene glycol Substances 0.000 claims description 4
- 239000003795 chemical substances by application Substances 0.000 claims description 4
- 239000006166 lysate Substances 0.000 claims description 4
- 239000000594 mannitol Substances 0.000 claims description 4
- 235000010355 mannitol Nutrition 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 4
- 108010008885 Cellulose 1,4-beta-Cellobiosidase Proteins 0.000 claims description 3
- 108010022172 Chitinases Proteins 0.000 claims description 3
- 102000012286 Chitinases Human genes 0.000 claims description 3
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 claims description 3
- 108060004795 Methyltransferase Proteins 0.000 claims description 3
- 108010059820 Polygalacturonase Proteins 0.000 claims description 3
- 239000013256 coordination polymer Substances 0.000 claims description 3
- 108010005400 cutinase Proteins 0.000 claims description 3
- 230000035622 drinking Effects 0.000 claims description 3
- 108010093305 exopolygalacturonase Proteins 0.000 claims description 3
- 238000010438 heat treatment Methods 0.000 claims description 3
- 239000007788 liquid Substances 0.000 claims description 3
- 229920002488 Hemicellulose Polymers 0.000 claims description 2
- 241000694540 Pluvialis Species 0.000 claims description 2
- 230000008646 thermal stress Effects 0.000 claims description 2
- 101001039966 Homo sapiens Pro-glucagon Proteins 0.000 claims 6
- 102100040918 Pro-glucagon Human genes 0.000 claims 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 1
- 108010088406 Glucagon-Like Peptides Proteins 0.000 abstract description 14
- 230000001154 acute effect Effects 0.000 abstract description 3
- 208000037976 chronic inflammation Diseases 0.000 abstract description 3
- 208000030090 Acute Disease Diseases 0.000 abstract description 2
- 208000037893 chronic inflammatory disorder Diseases 0.000 abstract description 2
- 210000005095 gastrointestinal system Anatomy 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 75
- 241000699670 Mus sp. Species 0.000 description 43
- NHJVRSWLHSJWIN-UHFFFAOYSA-N 2,4,6-trinitrobenzenesulfonic acid Chemical compound OS(=O)(=O)C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O NHJVRSWLHSJWIN-UHFFFAOYSA-N 0.000 description 42
- 108090000623 proteins and genes Proteins 0.000 description 31
- 241000195493 Cryptophyta Species 0.000 description 28
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 25
- 206010009887 colitis Diseases 0.000 description 24
- 201000010099 disease Diseases 0.000 description 24
- 230000000694 effects Effects 0.000 description 24
- 235000018102 proteins Nutrition 0.000 description 23
- 102000004169 proteins and genes Human genes 0.000 description 23
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 230000037396 body weight Effects 0.000 description 15
- 230000014509 gene expression Effects 0.000 description 15
- 230000001225 therapeutic effect Effects 0.000 description 13
- 206010003805 Autism Diseases 0.000 description 12
- 210000001072 colon Anatomy 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 238000010172 mouse model Methods 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 208000020706 Autistic disease Diseases 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 238000010171 animal model Methods 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 9
- 125000003729 nucleotide group Chemical group 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 239000006228 supernatant Substances 0.000 description 9
- 230000003542 behavioural effect Effects 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 8
- 229920001184 polypeptide Polymers 0.000 description 8
- 230000004580 weight loss Effects 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 230000036541 health Effects 0.000 description 7
- 230000004054 inflammatory process Effects 0.000 description 7
- 229960004963 mesalazine Drugs 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- 241000196324 Embryophyta Species 0.000 description 6
- 206010061218 Inflammation Diseases 0.000 description 6
- 235000001014 amino acid Nutrition 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 230000000975 bioactive effect Effects 0.000 description 6
- 230000006378 damage Effects 0.000 description 6
- 235000005911 diet Nutrition 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 238000001802 infusion Methods 0.000 description 6
- 239000004579 marble Substances 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 238000003752 polymerase chain reaction Methods 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 239000000523 sample Substances 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 241001474374 Blennius Species 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 230000006399 behavior Effects 0.000 description 5
- 230000003833 cell viability Effects 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 230000037213 diet Effects 0.000 description 5
- 230000037406 food intake Effects 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 230000003370 grooming effect Effects 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 230000004065 mitochondrial dysfunction Effects 0.000 description 5
- 235000015097 nutrients Nutrition 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 108010077544 Chromatin Proteins 0.000 description 4
- 102000053602 DNA Human genes 0.000 description 4
- 102000016622 Dipeptidyl Peptidase 4 Human genes 0.000 description 4
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 230000009286 beneficial effect Effects 0.000 description 4
- 210000003483 chromatin Anatomy 0.000 description 4
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 235000013376 functional food Nutrition 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 230000002503 metabolic effect Effects 0.000 description 4
- 210000003470 mitochondria Anatomy 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 230000001681 protective effect Effects 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 101500028771 Homo sapiens Glucagon-like peptide 2 Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 230000006978 adaptation Effects 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 230000032683 aging Effects 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000003110 anti-inflammatory effect Effects 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 210000003763 chloroplast Anatomy 0.000 description 3
- 230000000112 colonic effect Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 235000012631 food intake Nutrition 0.000 description 3
- 238000004108 freeze drying Methods 0.000 description 3
- 230000030136 gastric emptying Effects 0.000 description 3
- 230000030279 gene silencing Effects 0.000 description 3
- 230000002879 macerating effect Effects 0.000 description 3
- 208000030159 metabolic disease Diseases 0.000 description 3
- 238000002552 multiple reaction monitoring Methods 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 239000000813 peptide hormone Substances 0.000 description 3
- 230000000243 photosynthetic effect Effects 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 239000006041 probiotic Substances 0.000 description 3
- 235000018291 probiotics Nutrition 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 235000019419 proteases Nutrition 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000001228 spectrum Methods 0.000 description 3
- 238000005728 strengthening Methods 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 230000036642 wellbeing Effects 0.000 description 3
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 206010012741 Diarrhoea haemorrhagic Diseases 0.000 description 2
- 101100412394 Drosophila melanogaster Reg-2 gene Proteins 0.000 description 2
- 238000008157 ELISA kit Methods 0.000 description 2
- 101150032877 GLP2 gene Proteins 0.000 description 2
- 102000015626 Glucagon-Like Peptide-2 Receptor Human genes 0.000 description 2
- 108010024044 Glucagon-Like Peptide-2 Receptor Proteins 0.000 description 2
- 108010033040 Histones Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 208000037112 Intestinal Failure Diseases 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 208000012902 Nervous system disease Diseases 0.000 description 2
- 208000025966 Neurological disease Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 208000025865 Ulcer Diseases 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 210000000436 anus Anatomy 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 238000009227 behaviour therapy Methods 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000004140 cleaning Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000006854 communication Effects 0.000 description 2
- 238000004891 communication Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 235000013325 dietary fiber Nutrition 0.000 description 2
- 235000015872 dietary supplement Nutrition 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000009266 disease activity Effects 0.000 description 2
- 230000004064 dysfunction Effects 0.000 description 2
- 235000013399 edible fruits Nutrition 0.000 description 2
- 239000003480 eluent Substances 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 210000000981 epithelium Anatomy 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 238000000855 fermentation Methods 0.000 description 2
- 230000004151 fermentation Effects 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 238000003304 gavage Methods 0.000 description 2
- 238000012226 gene silencing method Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 210000004347 intestinal mucosa Anatomy 0.000 description 2
- 238000011835 investigation Methods 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 210000002429 large intestine Anatomy 0.000 description 2
- 230000002045 lasting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000010197 meta-analysis Methods 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 239000011707 mineral Substances 0.000 description 2
- 235000010755 mineral Nutrition 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 230000004792 oxidative damage Effects 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 230000008092 positive effect Effects 0.000 description 2
- 235000013406 prebiotics Nutrition 0.000 description 2
- 230000003449 preventive effect Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 208000020016 psychiatric disease Diseases 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 239000003642 reactive oxygen metabolite Substances 0.000 description 2
- 230000003989 repetitive behavior Effects 0.000 description 2
- 208000013406 repetitive behavior Diseases 0.000 description 2
- 230000003252 repetitive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 210000000813 small intestine Anatomy 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000036269 ulceration Effects 0.000 description 2
- 235000013311 vegetables Nutrition 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 235000020926 24-h fasting Nutrition 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102000004400 Aminopeptidases Human genes 0.000 description 1
- 108090000915 Aminopeptidases Proteins 0.000 description 1
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 1
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 1
- 206010002820 Antisocial behaviour Diseases 0.000 description 1
- 206010003694 Atrophy Diseases 0.000 description 1
- 241000206761 Bacillariophyta Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical class [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 101000880640 Centruroides elegans Beta-mammal toxin CeII9 Proteins 0.000 description 1
- 241000195585 Chlamydomonas Species 0.000 description 1
- 241000195628 Chlorophyta Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 238000007400 DNA extraction Methods 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 102000018711 Facilitative Glucose Transport Proteins Human genes 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-N Formic acid Chemical compound OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 208000012671 Gastrointestinal haemorrhages Diseases 0.000 description 1
- 208000034826 Genetic Predisposition to Disease Diseases 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108091052347 Glucose transporter family Proteins 0.000 description 1
- 102100039869 Histone H2B type F-S Human genes 0.000 description 1
- 101001035372 Homo sapiens Histone H2B type F-S Proteins 0.000 description 1
- 206010020565 Hyperaemia Diseases 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 231100000002 MTT assay Toxicity 0.000 description 1
- 238000000134 MTT assay Methods 0.000 description 1
- 241000736262 Microbiota Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010067482 No adverse event Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 229910019142 PO4 Chemical class 0.000 description 1
- 241000199919 Phaeophyceae Species 0.000 description 1
- 201000011252 Phenylketonuria Diseases 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 206010038063 Rectal haemorrhage Diseases 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 230000002293 adipogenic effect Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 1
- 239000001099 ammonium carbonate Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 208000024823 antisocial personality disease Diseases 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 230000037444 atrophy Effects 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 239000002551 biofuel Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229930002868 chlorophyll a Natural products 0.000 description 1
- ATNHDLDRLWWWCB-AENOIHSZSA-M chlorophyll a Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 ATNHDLDRLWWWCB-AENOIHSZSA-M 0.000 description 1
- 229930002869 chlorophyll b Natural products 0.000 description 1
- NSMUHPMZFPKNMZ-VBYMZDBQSA-M chlorophyll b Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C=O)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 NSMUHPMZFPKNMZ-VBYMZDBQSA-M 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000001149 cognitive effect Effects 0.000 description 1
- 230000008951 colonic inflammation Effects 0.000 description 1
- 239000013065 commercial product Substances 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001120 cytoprotective effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000000741 diarrhetic effect Effects 0.000 description 1
- 230000000378 dietary effect Effects 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 235000008242 dietary patterns Nutrition 0.000 description 1
- 235000021004 dietary regimen Nutrition 0.000 description 1
- 210000002249 digestive system Anatomy 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 230000009429 distress Effects 0.000 description 1
- 108010081495 driselase Proteins 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 235000005686 eating Nutrition 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 208000030172 endocrine system disease Diseases 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940095399 enema Drugs 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 230000006353 environmental stress Effects 0.000 description 1
- 230000001973 epigenetic effect Effects 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 239000011888 foil Substances 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 230000027119 gastric acid secretion Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000007149 gut brain axis pathway Effects 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 230000008642 heat stress Effects 0.000 description 1
- 208000035861 hematochezia Diseases 0.000 description 1
- 108010002430 hemicellulase Proteins 0.000 description 1
- 229940059442 hemicellulase Drugs 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 229940124622 immune-modulator drug Drugs 0.000 description 1
- 229960000905 indomethacin Drugs 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003262 industrial enzyme Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 210000005027 intestinal barrier Anatomy 0.000 description 1
- 230000007358 intestinal barrier function Effects 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 238000001659 ion-beam spectroscopy Methods 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- 230000007230 neural mechanism Effects 0.000 description 1
- 230000002981 neuropathic effect Effects 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 235000021590 normal diet Nutrition 0.000 description 1
- 235000015816 nutrient absorption Nutrition 0.000 description 1
- 235000006286 nutrient intake Nutrition 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 230000004783 oxidative metabolism Effects 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 235000016236 parenteral nutrition Nutrition 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000004963 pathophysiological condition Effects 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000010452 phosphate Chemical class 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical class [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 230000029553 photosynthesis Effects 0.000 description 1
- 238000010672 photosynthesis Methods 0.000 description 1
- 230000010399 physical interaction Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 235000017807 phytochemicals Nutrition 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 239000000419 plant extract Substances 0.000 description 1
- 229930000223 plant secondary metabolite Natural products 0.000 description 1
- 235000020777 polyunsaturated fatty acids Nutrition 0.000 description 1
- 230000035409 positive regulation of cell proliferation Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000002000 scavenging effect Effects 0.000 description 1
- 238000005201 scrubbing Methods 0.000 description 1
- 229930000044 secondary metabolite Natural products 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 230000003997 social interaction Effects 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 108010050014 systemin Proteins 0.000 description 1
- HOWHQWFXSLOJEF-MGZLOUMQSA-N systemin Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)OC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]2N(CCC2)C(=O)[C@H]2N(CCC2)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)C(C)C)CCC1 HOWHQWFXSLOJEF-MGZLOUMQSA-N 0.000 description 1
- 238000004885 tandem mass spectrometry Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000001228 trophic effect Effects 0.000 description 1
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/12—Unicellular algae; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to microalgae capable of expressing glucagon-like peptide (GLP), preferably GLP-2 or analogs of GLP-2, and uses thereof in pharmaceuticals or as a dietary supplement in the treatment and prevention of disorders affecting the gastrointestinal system, including in particular acute and chronic inflammatory diseases.
- GLP glucagon-like peptide
- a bioactive compound is any compound present in foods, animals, or plants that has an effect on the body that consumes it.
- bioactive ingredients are those that, when inserted in foods, provide some effect of improvement to health.
- Bioactive ingredients or active ingredients often referred to as functional ingredients, are compounds extracted from a source food, such as fruits, cereals, vegetables, and food processing residues, which preserve their characteristics even after extraction.
- nutraceutical product or “functional food” defines all those foods, fresh or processed, which, through their normal consumption within the normal diet, by containing bioactive compounds, offer potential improvement in human health by reducing the occurrence of certain diseases.
- These functional foods aim to promote and support the well-being of the human body, and their development is extremely valuable from the perspective not only of treatment, for patients with gastointestinal (GI) disorders, but also of complementary and alternative prevention and containment of these diseases.
- GI gastointestinal
- Typical functional foods contain, within them, specific natural or additional minerals, vitamins, fatty acids, dietary fiber and/or biologically active substances such as, for example, phytochemicals, antioxidants, probiotics and, also, proteins.
- GI diseases and, in particular, chronic inflammatory bowel diseases (IBDs) such as inflammatory bowel syndrome, Crohn's disease, and ulcerative colitis are characterized by a chronic inflammatory state and, in recent years, their incidence, and prevalence has increased considerably in synergy with their severity.
- IBDs chronic inflammatory bowel diseases
- triggers for such intestinal dysfunctions that can result in severe intestinal failure include all conditions for which there is a change in the intestinal microbiota (drug use, alcohol, presence of malignant neoplasms, etc.).
- IBDs Irritable bowel syndrome
- GLP glucagon-like peptide
- GLP-2 reversed the atrophy of the intestinal mucosa induced by parenteral nutrition and accelerated the process of endogenous adaptation in rats that had a large part of the small intestine severed.
- GLP-2 also significantly attenuated intestinal damage, and weight loss, in rat models with indomethacin-induced enteritis.
- GLP-2 also exerted reparative and cytoprotective actions in rodents in which intestinal inflammation was induced by chemotherapy treatments.
- Human clinical results at the same time, have fully elucidated the beneficial effects of GLP-2 in patients with intestinal mucosal damage, confirming its ability to significantly increase energy uptake, reduce water loss and nitrogen absorption in treated subjects compared with controls.
- Body weight and lean body mass moreover, increased, as opposed to fat mass, which, on the other hand, decreased; the time required for gastric emptying was also increased by 50%.
- histological analysis of intestinal tissue revealed how the depth and height of intestinal villi also increased following GLP-2 administration (Julie Lovshin, Daniel J. Drucker, in Encyclopedia of Endocrine Diseases, 2004).
- GLP-2 is a peptide hormone composed of 33 amino acids released by intestinal L-endocrine cells upon nutrient ingestion and exerts its trophic action on the epithelium of the small and large intestine through stimulation of cell proliferation and inhibition of apoptosis. GLP-2 also upregulates intestinal glucose transporter activity and reduces gastric emptying and gastric acid secretion. GLP- 2 activity is regulated, in part, through renal clearance and cleavage by dipeptidyl peptidase IV aminopeptidase. The actions of GLP-2, in addition, are transduced by the glucagon-like peptide-2 receptor (GLP-2R), which represents a member of the G-protein-coupled receptor superfamily. GLP- 2R is involved in the increased adenylate cyclase activity.
- GLP-2R glucagon-like peptide-2 receptor
- GLP-2 is obtained primarily by chemical synthesis or biologically by recombinant DNA (cDNA) technology, with several purification steps downstream in the process. Based on all these considerations, it is evident that there is a need to make available systems capable of expressing a bioavailable, low-cost form of GLP-2 for use in the treatment and prevention of GI disorders that is easily obtainable and suitable for preferably oral administration.
- Microalgae are single-celled plant organisms belonging to both the prokaryotic and eukaryotic kingdoms. Microalgae produce energy through the photosynthetic process, removing carbon dioxide from the atmosphere and releasing oxygen at the end of the process.
- microalgae Their special position in phylogenetic evolution makes them model organisms, as they share characteristics common to both bacteria and higher plants.
- the unicellular nature of microalgae means that they must respond to environmental stresses quickly and efficiently (to ensure their survival), maintaining the genome in a highly reactive euchromatic state.
- Number of studies, concerning microalgae, derive from the large production of secondary metabolites that are perfectly placed in the nutraceutical and pharmaceutical fields, these being potent antioxidants, essential amino acids and polyunsaturated fatty acids (co3 and co6).
- Microalgae comprise a wide range of mainly aquatic, unicellular, and eukaryotic organisms (including green algae, diatoms, and brown algae) that engage in photosynthetic activity, and contain cytoplasmic organelles such as mitochondria and chloroplasts.
- the chromatin structure of microalgae is distinct from other eukaryotic organisms; in fact, this is heavily colored highlighting a more compact nucleosomal structure and a close association of DNA with histone protein components.
- Microalgae are considered an important source of healthy nutrients for human needs and are important in that biomass and biofuels can also be derived from their cultivation. Genetic engineering and stable expression (maintained over multiple generations) of different transgenes would open new horizons and greatly enhance the value and opportunity of cultivating microalgae for purposes of improving healthy well-being. However, as described earlier, it has been difficult to achieve a stable and sufficiently high level of gene expression, so a new methodology to help overcome this obstacle is extremely useful. Such an approach must consider gene silencing related to the unique and resistant histone presence of microalgae, including green microalgae.
- the present invention reports a totally innovative approach regarding the use of specific microalgal strains and specific growth and reproduction techniques to express and produce GLP-2 and/or GLP- 2 peptide analogs as an endogenous metabolite to be used, for example in the form of freeze-dried biomass or humid biomass absorbed over dried functionalized food flour, as a bio-active material for animal and human use.
- nucleic acid molecule comprising or consisting of: a. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or which matches perfectly or is complementary to any of SEQ ID No. 53-64; and b. at least one linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1-21; wherein the linker polynucleotide sequence is linked to the 5 'end and/or the 3' end of the coding polynucleotide sequence.
- said nucleic acid molecule comprises or consists of: c. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or which matches perfectly or is complementary to any of SEQ ID No. 53-64; and d. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 5' end of the coding polynucleotide sequence; and e. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 3' end of the coding polynucleotide sequence.
- said nucleic acid molecule has at least 85% homology to any of SEQ ID No 29-42 or has at least 85% homology to any of SEQ ID No 65-76.
- an host cell comprising said nucleic acid molecule, wherein said host cell is an algal cell; preferably said host cell belongs to the class of Chlorophyceae and/or to the class of Trebouxiophyceae; still preferably said host cell to the species Haematococcus spp. and/or Chlorella spp.; even more preferably said host cell belongs to Haematococcus pluvialis and/or Chlorella vulgaris.
- the invention provides said host cell for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of irritable bowel disorders, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals; preferably said host cell according is for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
- IBD chronic inflammatory bowel disease
- GLP2 expressing algal biomass comprising at least one host cell as defined above and/or a lysate and/or an extract of said host cell.
- said biomass comprises the GLP2 peptide of SEQ ID No. 43 and/or GLP2 peptide analogs comprising SEQ ID No 43 or comprises the GLP2 peptides of SEQ ID No. 44-52 and/or analogs comprising SEQ ID No. 44-52.
- It is a further object of the invention a method for obtaining said GLP2 expressing algal biomass comprising the following steps: a. induce thermal stress in a culture of microalgae by heating at a temperature between 35° and 50° C for a time between 300 and 600 seconds; b. expose the microalgae culture to UV rays (UV-A, UV-B and UV-C) for one or more time intervals between 5 and 15 min; c. inoculate the culture treated in step b in fresh liquid medium; d.
- UV rays UV-A, UV-B and UV-C
- a mixture of lytic enzymes comprising at least one of the following enzymes: cellulase, cellulase CP, hemicellulose, chitinase, 0-D- glucanase, macerozyme, helicase, driselasi, lytic enzyme L, pectinase, protease, xylanase, cutinase, P-D-glucuronidanase, cellobiohydrolase, mixtures of them; e.
- step d incubate the microalgae culture treated in step d) at a temperature between 30 - 40° C for 4-8 h; f. combine the culture incubated from step e) in 10 ml of culture medium, with 0.1 - 0.5% of a solution comprising the isolated nucleic acid as defined in the previous paragraphs, in the presence of 10-35 % polyethylene glycol (PEG-X).
- PEG-X polyethylene glycol
- the microalgae preferably belong to the Chlorophyceae class and or to the Trebouxiophyceae, more preferably belong to the Haematococcus spp. and/or Chlorella spp., even more preferably belong to the Hematococcus pluvialis species and/or Chlorella vulgaris.
- IBD chronic inflammatory bowel disease
- composition comprising the host cell of the invention or the GLP-2 expressing algal biomass of the invention and at least one pharmacologically acceptable excipient.
- said pharmaceutical composition is for use in the treatment and/or prevention of intestinal dysbiosis and inflammatory bowel disease (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals; preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
- IBD intestinal dysbiosis and inflammatory bowel disease
- IBD chronic inflammatory bowel diseases
- FIG. 1 Effect of natural products with pharmacological properties, extracted from engineered algae, in a mouse model of 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced colitis.
- A Effect of tested compounds on body weight in the TNBS-induced colitis mouse model. Body weight was monitored daily until sacrifice. Weight change over time is expressed as a percentage of initial body weight. Lines indicate the mean ⁇ standard error of each experimental group;
- B Effect of derivatives extracted from artificial seaweed on colonic length in TNBS-induced colitis mice. At the end of the study (day +3 from TNBS infusion), the two spots were excised and the length was determined with a slide caliper. Data shown represent mean + ES of 8 mice/group.
- FIG. 1 Cell viability reported as a function of the tested dose of algae, expressed as the absorbance value of formazan crystals that is directly proportional to cell viability.
- A 24 hours;
- B 48 hours;
- FIG. 1 Schematic representation showing the method of the invention according to one embodiment.
- Chlorophyceae are one of the classes of green microalgae, distinguished mainly on the basis of ultrastructural morphology. Usually their coloration is caused by the predominance of photosynthetic pigments such as chlorophyll a and chlorophyll b.
- the chloroplast can have a discoidal, plate-shaped, reticulate, cup-shaped, spiral or ribbon-like conformation depending on the species to which it belongs.
- pyrenoids located within the chloroplast. Pyrenoids, in turn, contend with various proteins including starch.
- Some species of green microalgae can store nutrient sources in the form of oily droplets. They usually have a cell wall consisting of an inner layer of cellulose and an outer layer of pectose.
- Trebouxiophyceae is a further class of green microalgae suitable for the purposes of the invention, in particular Chlorella spp.
- the present invention is related to the production of exogenous proteins within a host cell, represented by a microalgal cell belonging to the class Chlorophyceae and/or Trebouxiophyceae.
- the host cell is used as a biofactory for protein production.
- the recombinant Chlorophyceae host cell is Haematococcus spp.
- the recombinant Trebouxiophyceae host cell is Chlorella spp.
- the host cell is Haematococcus pluvialis and/or Chlorella vulgaris.
- nucleic acid molecule comprising or consisting of: a. a polynucleotide coding sequence having at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent, at least about 90 percent, at least about 95 percent, at least about 98 percent to SEQ ID No. 28 or that appears perfectly or is substantially complementary to SEQ ID No. 28, or its fragments or functional derivatives; b.
- linker polynucleotide sequence with at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent , at least about 90 percent, at least about 95 percent, at least about 98 percent to any one of SEQ ID No 1-21; wherein the linker polynucleotide sequence is operatively bound to the 5' and/or 3' end of the coding sequence.
- homology refers to sequences characterized by similarity at the nucleotide level or amino acid level as discussed herein.
- a nucleic acid molecule that is complementary to the nucleotide sequence of SEQ ID NO 28 is one that is sufficiently complementary to the nucleotide sequence of SEQ ID NO 28 that it can hydrogen bond with few or no mismatches to the nucleotide sequence shown in SEQ ID NO 28 thereby forming a stable duplex.
- binding means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like.
- a physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
- the linker polynucleotide sequences with at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent, at least about 90 percent, at least about 95 percent, at least about 98 percent to any one of SEQ ID No 1-21 are two and are bound at the 5' and 3' ends, respectively, of the coding polynucleotide sequence.
- the isolated nucleic acid molecule is of sequence corresponding to SEQ IDs No 29-42, or functional fragments and derivatives.
- a host cell comprising the isolated nucleic acid molecule as defined above, wherein said host cell is an algal cell, preferably said host cell belongs to the class Chlorophyceae and/or Trebouxiophyceae, preferably said host cell belongs to the species Haematococcus spp. and/or Chlorella spp..
- the invention also relates to the host cell for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders resulting from irritable bowel syndrome, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, for strengthening and improving the intestinal microbiota, preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disordersand autism spectrum disorders.
- IBD chronic inflammatory bowel disease
- IBD chronic inflammatory bowel disease
- osteoporosis for the improvement of disorders resulting from bone resorption
- strengthening and improving the intestinal microbiota preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disordersand autism spectrum disorders.
- the invention is directed to an algal biomass comprising at least one host cell as defined above and/or a lysate and/or extract and/or secretion of said host cell and comprising expressed GLP2 (SEQ ID No 43) and GLP2 peptide analogs .
- a GLP2 peptide analog is a peptide comprising the GLP2 sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID No. 43) elongated at the N or C terminal with additional aminoacids corresponding to or encoded by the specific linkers of the invention.
- Said GLP2 analog is a functional analog as it maintains the same biological properties of the GLP2 peptide of SEQ ID No 43.
- an object of the invention is a method for obtaining an algal biomass expressing GLP2 and/or GLP2 peptide analogs comprising the following steps: a. Induce heat stress in a culture of microalgae belonging to the class Chlorophyceae by heating at a temperature between 35 and 50°C for between 300 and 600 seconds; b. Expose the microalgae culture to UV light (UV-A, UV-B and UV-C) for one or more time intervals between 5 and 15 min; c. Inoculate the culture treated in step b into fresh liquid medium to restore normal biophysiological conditions; d.
- UV light UV-A, UV-B and UV-C
- a macerating solution consisting of 16-50% (v/v) 0.35 M mannitol and 0.2-0.6% lytic enzyme mixture comprising at least one of the following enzymes: cellulase, cellulase CP, hemicellulase, chitinase, 0-D-glucanase, macerozyme, helicase, driselase, lytic enzyme L, pectinase, protease, xylanase, cutinase, P-D-glucuronidanase, cellobiohydrolase, or mixtures thereof; e.
- step (d) Incubate the microalgae culture treated in step (d) at a temperature of 30 to 40°C for 4 to 8 h; f. combine the culture incubated from step (e) in 10 ml of culture medium, with 0.1 to 0.5 % of a solution comprising the nucleic acid isolated according to any of claims 1 or 2, in the presence of 10 to 35 % polyethylene glycol (PEG-X).
- PEG-X polyethylene glycol
- microalgae belong to the classes Chlorophyceae, Trebouxiophyceae, preferably microalgae belong to the species Haematococcus spp., Chlorella spp. Further forming an object of the invention is an algal biomass expressing GLP-2 and /or GLP-2 peptide analogs obtainable by the method defined above.
- the present invention also relates to a pharmaceutical composition
- a pharmaceutical composition comprising the invention's host cell or biomass and at least one pharmacologically acceptable excipient.
- said pharmaceutical composition is for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders resulting from irritable bowel syndrome, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, for strengthening and improving the intestinal microbiota, preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis, and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
- IBD chronic inflammatory bowel disease
- a food supplement or drinking product comprising the host cell or biomass as defined above.
- IBD chronic inflammatory bowel disease
- the products of the invention find use in treatment, prevention and as supplements in situations of intestinal dysbiosis preferably due to eating disorders and autism spectrum disorders.
- Efficient growth medium is defined as any culture medium in which a microalgal cell, such as the Chlorophyceae cell, is usually grown. Such medium typically includes an aqueous phase containing assimilable sources of carbon, nitrogen and phosphate, as well as mineral salts, metals and other appropriate nutrients such as, for example, vitamins.
- suitable media and growth conditions are described in the "Examples" section.
- Cells of the present invention can be cultured in conventional fermentation photobioreactors, shaking flasks, test tubes, microtiter plates, and Petri dishes. Culture can be carried out at appropriate temperature, pH and oxygen content for the recombinant cell.
- the term "transformation” identifies any methodology by which an exogenous nucleic acid molecule (i.e., a recombinant nucleic acid molecule) can be inserted within microbial cells.
- an exogenous nucleic acid molecule i.e., a recombinant nucleic acid molecule
- transformation is used primarilyto describe a genetic, heritable change caused by the acquisition of exogenous nucleic acids by the microorganism, and is essentially synonymous with the term “transfection.”
- Several methodologies suitable for the introduction of exogenous nucleic acid molecules inside algal hostcells are known, such as (i) shotgun with gold particles, (ii) electroporation, (iii) micro injection, (iv) lipofection, (v) adsorption, (vi) infection, and (vii) protoplastic fusion.
- a biomass according to the present invention is a composition comprising transformed algal cells and/or extracts and/or lysates or other derivatives. More specifically, the biomass of the invention is obtained after lysis of the cell culture and comprises, inter aha, the GLP2 peptide and the GLP2 peptide analogs.
- a methodology for transforming a competent algal host cell involves two main steps: a) pretreating the host cell with an enzyme, and b) introducing an exogenous nucleic acid molecule into the host cell.
- the method of the invention is well explained in Figure 4.
- the enzyme can have cellulase, protease, P-glucoronase and various combinations of these activities.
- the expression system of the invention which allows the GLP-2 protein to be expressed within the algal cell, includes regulatory control elements that are active in microalgal cells. Many of these elements, including several promoters, are active in different species; therefore, the novel regulatory sequences, described as aspects of the invention, can be used not only in the algal cells described here, but also in cells belonging to different species characterized by the same evolutionary mechanisms .
- the design and construction of theexpression systems covered by the invention use standard biomolecular technologies known to persons skilled in the art. See, for example, Sambrook et al., 2001, Molecular Cloning: A Laboratory Manual, 3rd edition.
- the expression system or expression vector comprises a polynucleotide sequence encoding for the GLP-2 protein associated with any promoter sequence, or 5' linker, and possibly a terminator sequence, or 3' linker.
- the 5' linker, the GLP-2 coding sequence and the 3' linker are operatively linked so that they are functional within the host cell.
- the expression system may also include additional regulatory sequences that are functional within the genome of the host cell. Inducible or constitutively active sequences can be used. Suitable control elements, also include any regulatory element associated with the expression of the nucleicacid molecules described here.
- the present invention is also directed to the algal host cell comprising the expression system described above and/or to a biomass obtained from or comprising said algal cell.
- the expression system of the invention preferably comprises at least one of the nucleic acid molecules isolated in the present invention and described herein.
- all genetic elements of the expression system are sequences associated with previously isolated nucleic acid molecules.
- the nucleic acid sequence encoding for the GLP-2 protein, or coding sequence is stably integrated into the genome of the host cell, while in others, said coding sequence is operatively linked to a promoter linker sequence and/or a terminator linker sequence, both of which are functional in the host cell.
- the linker sequences to which the coding sequence is operatively linked include, but are not limited to, the novel nucleic acid sequences described inthe present invention.
- the coding sequence is optimized for the codon belonging specifically to the host cell of Haematococcus spp. and/or Chlorella spp. so as to maximize translation efficiency.
- the recombinant algal cell that is the subject of the invention is capable of expressing therapeutic proteins.
- a "therapeutic protein,” as used herein, includes proteins useful for the treatment or prevention of diseases, pathological conditions, and various disorders in both animals and humans.
- prevention and treatment refer to both therapeutic treatment and prophylactic or preventive measures in which the objective is to prevent or slow (reduce) an undesirable pathophysiological condition, disease, or disorder, or to achieve beneficial or desired clinical results.
- beneficial or desired clinical results include, butare not limited to, the alleviation of symptoms or signs associated with a pathological condition or disorder of normal physiology; reducing the severity of a condition, disease, or disorder; stabilization of a condition, disease, or disorder (or better, situations in which the condition, disease, or disorder is stable and does not worsen over time) delay in the onset or progression of the condition, disease, or disorder; improvement of the condition, disease, or disorder; remission (total or partial and detectable or undetectable) of the condition, disease, or disorder; or enhancement or improvement of a condition, disease, or disorder.
- Treatment includes eliciting a clinically meaningful response without excessive side effects and also prolonging survival over expected survival if treatment is not received.
- the therapeutic protein is glucagon-like peptide 2 (GLP-2) and analogs thereof.
- GLP-2 glucagon-like peptide 2
- Protein produced or expressed by the algae cell according to the invention can be produced on a commercial scale.
- Commercial scale includes protein production from a microorganism grown in an aerated bioreactor (biofermentor) of size > 100 L, > 1,000 L, > 10,000 L, or > 100,000 L. In some forms of implementation, commercial-scale production is performed in an aerated biofermentor with agitation.
- the protein produced by the algae cell can also accumulate within the cell or can be secreted by the cell, for example, into the culture medium as a soluble protein.
- the protein produced can be recovered from the cell, the culture medium, or the fermentation medium in which the cell itself is grown.
- the same biomass expressing the GLP-2 protein and GLP-2 analog can be used directly for the purposes of the invention, which include therapeutic and preventive uses and nontherapeutic uses, for example, in the preparation of
- the present invention is directed to a method for producing a recombinant protein; the methodology also includes culture conditions for the microalgal cells of the invention such that a polynucleotide sequence coding for a protein can be expressed.
- Proteins produced by the method elaborated in this invention can also be purified using a variety of standard protein purification techniques such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reversed phase chromatography, chromatographyusing concanavallin A, chromatofocusing, and differential solubilization.
- proteins produced by the method described in the present invention are isolated in "substantially pure” form. In this context, “substantially pure” refers to a purity that allows effective use of the protein as a commercial product and/or ingredient to be used in combination with others.
- the recombinant protein accumulates within the cell and is recovered from the cell; in some embodiments, the host cell of the method belongs to the Chlorophyceae class, while in other embodiments, the host cell is from Haematococcus spp. In some embodiments, the host cell belongs to the Trebouxiophyceae class, while in other embodiments is Chlorella spp.
- the recombinant protein is a therapeutic protein, a food enzyme or an industrial enzyme. In some realizations, the recombinant protein is GLP-2. In some realizations, the recombinant protein is a therapeutic protein that includes a secretion signal sequence, such as the GLP2 analog.
- Isolated nucleic acid molecules or polynucleotide sequences that constitute the expression systemin the algal cell form the object of the invention.
- the nucleic acid sequences described here include the 5' and 3' linker sequences and coding sequences, particularly the GLP-2 coding sequence.
- An isolated nucleic acid molecule can be a DNA molecule, RNA molecule (e.g., mRNA) or derivatives of them (e.g., cDNA).
- nucleic acid molecule refers principally to the physical nucleic acid molecule, and although the phrases “nucleic acid sequence” or “polynucleotide sequence” refer primarily to the sequence of nucleotides present on the nucleic acid molecule, the phrases are used interchangeably, especially in reference to a nucleic acid molecule, polynucleotide sequence, or nucleic acid sequence encoding a protein.
- a nucleic acid molecule isolated by the present invention is produced using recombinant DNA technology (such as, for example, cloning and amplification by polymerase chain reaction (PCR)) or by chemical synthesis.
- PCR polymerase chain reaction
- Isolated nucleic acid molecules include naturally occurring nucleic acid molecules and their homologs, including, but not limited to, naturally occurring allelic variants and modified nucleic acid molecules in which nucleotides have been inserted, deleted, substituted, and/or reversed in such a way that these modifications provide the desired effect on the sequence, function, and/or biological activity of the encoded peptide or protein.
- a double-stranded DNA present in this invention includes a single-stranded DNA and its complementary strand, the sequence of which mirrors the sequence of the single-stranded DNA.
- nucleic acid molecules of the present invention may be double-stranded or single- stranded and also include those nucleic acid molecules that form stable hybrids under high "stringency" conditions with a sequence of the invention and/or with a sequence complementary to a sequence of the invention. Methods for tracing a complementary sequence are known to experts in the field.
- protein includes single-chain polypeptide molecules as well as multiple polypeptide complexes in which the individual constituent polypeptides are bound through covalent and noncovalent means.
- polypeptide includes peptides of two or more amino acids in length, typically having more than 5, 10 or 20 amino acids.
- the human GLP-2 peptide is a 33 amino acid peptide, having the following sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID No. 43).
- GLP-2 peptide refers also to peptides of other mammals, including:
- the new nucleic acid molecules of the present invention can be used in any genus of microalgae in which they are found to be functional.
- the nucleic acid molecules are used in algae belonging to the class Chlorphyceae.
- recombinant nucleic acid molecules are used in the species Haematococccus spp.
- recombinant nucleic acid molecules are used in the class of Trebouxiophyceae and/or in the species Chlorella spp.
- a recombinant microorganism has a genome that has been modified (i.e., mutated or changed) from its natural (i.e., naturally occurring or wild-type) form using recombinant technology.
- a recombinant microorganism according to the present invention may include a microorganism in which nucleic acid molecules have been inserted, deleted, or modified (i.e., mutated, e.g., by nucleotide insertion, deletion, substitution, and/or inversion) such that the modifications provide the desired effect within the microorganism.
- the present invention is directed to the 5' and 3' linker sequences.
- the 5' or promoter linker is a DNA sequence that directs transcription of a coding region associated with it.
- the 3' or terminal linker is the gene sequence that marks the end of transcription of genomic DNA.
- the linker of the invention is any of the following sequences: CGGGGCAACTCAAGAAATTC (SEQ ID No 1) GTCTGGCCGAGGTCTGGTTCCTGTGCC (SEQ ID No 2)
- CCGGACTGCCATAGCACAGCTAGACGA (SEQ ID No 11) GTCTGGCCGAGGTCTGGTTCCTGCCTAG (SEQ ID No 12) ACTGACTGCCATAGCACAGCTAGACGA (SEQ ID No 13) ATTTGCTGCATGACTGGATCAATGCGACGA (SEQ ID No 14) GTCTGGCCTGACGTATGATCGATGCCATAAATGC (SEQ ID No 15) ATGCCCTGATCCCAATGATGGACGA (SEQ ID No 16) GTCTGGCCGAAACTGATTTGGCCATGAC (SEQ ID No 17) GAGCGTGCTGAAATGCATGCGACGA (SEQ ID No 18) GTCTGGCCCCCGGGTATAGTAGCTGAC (SEQ ID No 19) CCCGGGTATAGTAGCTGACTGCGACGA (SEQ ID No 20) GTCTGGGAGCGTGCTGAAATGCATG (SEQ ID No 21)
- nucleic acid molecule comprising a polynucleotide sequence that is at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any one of SEQ ID NO: 1 - SEQ ID NO:21, in which the polynucleotidesequence functions as a promoter and/or terminal linker at least in algae belonging to the class Chlorophyceae.
- the invention also relates to an isolated nucleic acid molecule comprising a polynucleotide sequence that hybridizes with any of the SEQ ID NO:1 - SEQ ID NO:21 sequences or that hybridizes with a polynucleotide sequence that is at least 95 percent identical to any of the SEQ ID NO: 1 - SEQ ID NO:21 sequences.
- the isolated nucleic acid molecule may include a polynucleotide sequence that is completely complementary to any of the SEQ ID NO: 1 - SEQ ID NO:21 sequences or to a polynucleotide sequence that is at least 95% identical to any of the SEQID NO:1 - SEQ ID NO:21 sequences.
- Microalgae belonging to the genus Chlorophyceae, were grown in the culture medium shown in Table 1, under illumination with an intensity of 120 mmol photons m s -2-1 in an alternating cycle 25 of 16 h of light and 8 h of dark, at a temperature of 25 °C.
- the cultures were agitated by mechanical shaker (g24 environmental incubator shaker, American Laboratory Trading) at 70 rpm throughoutthe growth time.
- Table 1 composition of the growth medium
- the percentages shown in the table may vary depending on the species, genotype and initial concentration of microalgae cultures.
- microalgae-specific genes related to the photosynthesis pathway were analyzed.
- the following sequences were derived from specific algal sequences:
- CACATGCCATCCGAGTCGTC (SEQ ID No 7)
- ATGGCCACGC SEQ ID No 9
- CTCTACCCAC (SEQ ID No 10)
- the sequence of the human GLP-2 gene is as follows:
- oligonucleotides comprising the human GLP2 gene sequence and at least one promoter linker, preferably a promoter linker and a terminal linker (underlined in the list below), derived from the specific algal sequences and previously described, were then synthesized:
- the sequences of the GLP-2 gene of other mammals are as follows:
- oligonucleotides comprising the GLP2 gene sequence from other species and at least one promoter linker, preferably a promoter linker and a terminal linker (underlined in the list below), derived from the specific algal sequences and previously described, were also synthesized by using the same method of the invention:
- the microalgae culture was resuspended at a ratio of 1 :5 to 1 :25, depending on cell concentrations, in a macerating solution which constitutes a lytic mixture.
- the macerating solution contained 16- 50% (v/v) 0.35 M mannitol and 0.2-0.6% lytic enzyme mixture (Table 2).
- the lytic mixtures were then incubated at 30-37°C for 4-8 h.
- the composition of the lytic mixture, temperature and incubation time changed according to the microalgae species.
- microalgae solutions after treatment with the lytic mixture were combined, in a final volume of 10 ml of culture medium, with 0.1 to 0.5 % v/v of polynucleotide diluted 2, 5, 10, 20, 25, or 50 times (initial concentration 100 pM), depending on the nucleotide length and the resultingmolecular weight of each polynucleotide (Table 3)
- Steps i, ii and iii are repeated 2 to 5 times.
- the pellet is resuspended in 1 to 50 ml of standard culture medium. Centrifugation speed and duration vary according to the concentrations of PEG used (Table 4)
- Pri GLP Pri GLP regl - Forward AGACATGCTGATGGTTCTTT (SEQ ID No 22) Pri GLP reg2 - Forward TCTCTGATGAGATGAACACC (SEQ ID No 23) Pri GLP reg4 - Forward GATTTCCCAGAAGAGGTCG (SEQ ID No 24) Pri GLP regl - Reverse AACATTTCAAACATCCCACG (SEQ ID No 25) Pri GLP reg2 - Reverse GCAGGTGATGTTGTGAAGAT (SEQ ID No 26)
- the amplification protocol is as suggested in the Phire Plant Direct PCR Master Mix brochure. (Thermo ScientificTM - Cat. Number: Fl 60S - https : //www. thermofisher , com/ order/ catalog/product/F 160S )
- Mass Spec analysis was used to determine the concentration of the GLP-2 and GLP-2 analogs in dried biomass by lyophilization.
- the humid microalgae biomass expressing GLP-2 was collected and freeze-dried to obtain a green powder and 100 mg of this material used to extracted the desired peptide hormone.
- Ipl of supernatant were analysed by using a AB-sciex 5500 QTRAP® system with a HPLC chromatography system Exion LCTM.
- the mobile phase was generated by mixing eluent A (0.1 % Eormic Acid in water) and eluent B (0.1 % Eormic Acid in acetonitrile) and the flow rate was 0.200 mL/min.
- Chromatographic gradient was from 20% to 90% in 4 min, hold for 2 min, then return to 20 % in 1 min. Tandem mass spectrometry was performed using Turbo VTM ion source operated in positive ion mode, and the multiple reaction monitoring (MRM) mode was used for the selected analytes.
- MRM multiple reaction monitoring
- GLP2 human glucagon-like peptide 2
- a human glucagon-like peptide 2 (GLP2) ELISA kit (0.156-10 ng/mL) was used. 100 mg of dry algal biomass, obtained by freeze- drying the crude product, was dissolved in 10 mL of water containing 50% acetonitrile and 0.1% trifluoroacetic acid. The extraction step performed is reported in the materials and methods, in fact, the solution was sonicated for 15 min and then, by centrifugation, the algal biomass was separatedfrom the supernatant. The supernatant was lyophilized and 100 pl was resuspended in diluent buffer (provided by the kit).
- diluent buffer provided by the kit.
- the analysis protocol used includes the following steps:
- the amount of peptide present in the sample is in the range of 150 to 2000 pg/ml.
- IEC-6 cells 5x10 3 IEC-6 cells were seeded and allowed to grow overnight.
- CTRL and GLP-2 cells of Haematococcus spp were sonicated and filtered to separate the precipitated phase from the liquid phase.
- Different concentrations of algal extracts were tested (starting from 25% v/v. Serial 1:2 dilutions were made until the final concentration of 0.39 % v/v was reached).
- MTT assay was conducted after 24 and 48 hours to check cell viability. The protocol used involves the following steps:
- mice Two different efficacy studies were conducted in animal models (mouse) with the aim of verifying non toxicity in vivo and measuring the efficacy of GLP2 produced in alga .
- IBD Inflammatory bowel disease
- TNBS 2,4,6-trinitrobenzene sulfonic acid
- GLP-2 2,4,6-trinitrobenzene sulfonic acid
- ethanol and TNBS trinitrobenzenesulfonic acid
- Ethanol is used as a means to effectively destroy the intestinal barrier and allow TNBS to interact with proteins in colon tissue.
- mice After colitis induction, mice develop several manifestations of acute colitis. These include soft stool formation and occult or even bloody diarrhea. Intracolonic administration of TNBS/ethanol,in mice induces severe disease characterized by bloody diarrhea and dramatic body weight loss during the first week.
- colitis was induced by rectal administration of 2 mg/100 ml TNBS (Sigma- Aldrich, St. Louis, MO, USA) in 45% ethanol (Merck, Darmstadt, Germany) using a vinylcatheter placed 3.5 cm proximal to the anus. During the procedure, mice were anesthetized using Rumpun/Zoletil. After instillation of the catheter, the animals were kept upright for 30 sec.
- mice underwent identical procedures but were instilled with 45% ethanol dissolved in phosphate- buffered saline (PBS). Mice were monitored daily for survival, body weight, rectal bleeding and stool consistency. All animals were sacrificed on day 5 of the experiment for cervical dislocation.
- PBS phosphate- buffered saline
- mice were kept fasting for 24 h before colitis induction. At day 0, mice were anesthetized by inhalation of isoflurane, 2 mg of TNBS in 100 pL of 50% ethanol solution were administered slowly into the colon through a medical-grade catheter (3.5 F) inserted gently about 4 cm into the anus.
- a medical-grade catheter 3.5 F
- mice Food and water were administered ad libitum after TNBS instillation. Mice were divided into the following experimental groups (8 mice/group):
- GLP2 algae are GLP2-expressing algae according to the invention
- CTRL algae are control algae
- Mesalazine an anti-inflammatory agent used in the treatment of inflammatory bowel disease (positive disease control) was administered orally by gastric gavage from three hours before the TNBS infusion and for the next three days (once daily in the morning, 4 total doses). Algae were administered orally by gavage from seven days before TNBS infusion and for the next three days (once daily in the morning, 10 total doses). Mice were sacrificed by CO asphyxiation2 in the afternoon 3 days after intrarectal administration of TNBS.
- Blood samples were collected and frozen from 3 mice of groups 1, 3, 5 and 6. the two points were explanted, measured in length with a slide caliper, immediately frozen inliquid nitrogen, and stored at -80°.
- PBS 1 mL/mouse
- TNBS 100 pL in 50% ethanol/mouse solution.
- Mesalazine 1 mL/mouse GLP2 and CTRL algae: 300pL and lOOpL/mouse (two doses for both types of algae)
- TNBS Frequency of administration
- Mesalazine daily from three hours before TNBS infusion until the mice are sacrificed.
- GLP2 and CTRL algae daily from seven days before TNBS infusion until mice are sacrificed.
- mice that were instilled with TNBS disease control developed severe disease characterized by a body weight loss of about 14% from their initial body weight.
- Figure 1(B) shows that, macroscopically, the colon is shorter in the groups of mice treated with TNBS and both doses of CTL alga, with a reduction of about 70% compared with the positive control group (Mesalazine).
- the DAI score is a marker of disease activity and was determined based on the methods of Murano et al. (Murano M. et al. (2000): Therapeutic effect of intracolonically administered nuclear factor K B (p65) antisense oligonucleotide on mouse dextran sulphate sodium (DSS)-induced colitis.
- Res65 nuclear factor K B
- DSS mouse dextran sulphate sodium
- the health quality of mice is a marker extrapolated from the human endpoint scoring system, according to which, based on predetermined physiological or behavioral signs, a score can be assigned to the health status of the animal enrolled in the experimental study.
- colon damage index scores colon features in TNBS-treated mice such as hyperemia, thickening and ulceration.
- mice that received GLP2 algae had a lower mortality rate (and thus higher survival) than both the control and Mesalazine groups.
- ASD Autism
- mice of the BTBR T+ Itpr3tf/J strain Animal models currently used by the scientific community as a model of the autism spectrum include mice of the BTBR T+ Itpr3tf/J strain (BTBR; Meyza,K.Z., Blanchard, D.C., The BTBR mouse model of idiopathic autism. Current view on mechanisms. Neurosci. Biobehav. Rev. (2017)). In fact, presenting the 3 key symptoms (problems with socialization, communication, and repetitive behaviors), he summarizes the main biochemical, neuropathological, and behavioral features found in human pathology (13, 14). In addition, recent studies have shown that a nutritional approach can induce metabolic and behavioral changes in these mice. For example, when subjected to fatty diet from the time of weaning, such strain shows even more antisocial behavior and cognitive rigidity. This strain therefore constitutes an important investigative tool for the study of metabolic disorders related to autism (15-17).
- Mitochondria in addition to being the main cellular energy powerhouse (contributing to the production of about 90 percent of the energy used by our body), are known to synthesize key molecules during inflammatory and oxidative processes, serving as the main source of free radicals. Therefore, it is not surprising that mitochondrial dysfunction is associated with inflammation and other metabolic disorders in which cellular oxidative damage is caused by reactive oxygen species (ROS) production that exceeds physiological antioxidant activity (20). So, mitochondrial dysfunction can be both the cause and the consequence of inflammatory processes and cause metabolic adaptations that could be protective or become progressively harmful (21).
- ROS reactive oxygen species
- the animals were fed a standard laboratory diet (15.88 kJ/g) for 3 weeks and were divided into two groups: the first group (control) received daily intragastric administration of vehicle (water), the second group (treated) received daily intragastric administration of Haematococcus spp- GLP2 extract of lOOpl/day for 2 weeks and 200pl/dayfor an additional 7 days (Haematococcus pluvialis was used for this experiment). Body weight and food intake were monitored daily.
- the conceptual idea behind the invention is based on the use of microalgae as natural and green bioreactors, capable of producing and transporting molecules of interest.
- GLP-2 as described above, plays a key role in intestinal well-being, and microalgae represent optimal carriers.
- the platform aims to design edible microalgae to make naturally produced GLP-2 to be used directly as a carrier for gut delivery.
- the innovation of this technology lies in the combination of an already useful product for humanhealth (microalgae high in antioxidants) with a molecule of pharmaceutical interest (GLP-2 and/or GLP-2 peptide analogs).
- the methodology used exploits the possible ability of microalgae to incorporate exogenous DNA.
- a polynucleotide containing the GLP-2 coding sequence was synthesized and two linkers were joined at the terminal end, coding for a structural gene of the microalgae, to enable targeted insertion.
- No physical or biological vector was used.
- a novel methodology was applied and special conditions were optimized that allowed the microalgae to incorporate the synthetic polynucleotide.
- the microalgae were first selected on solid medium and at a later stage were inoculated into the specific liquid culture medium and allowed to grow following standard growth protocols.
- the biomass was harvested and processed to obtain the extract in accordance with what was described in the experimental part.
- the TNBS-induced colitis model has proven very useful in understanding the pathophysiology of intestinal inflammation and is a powerful tool for evaluating interventions to prevent or amelioratethe disease.
- the in vivo study carried out in the present invention aims to evaluate the protective and antiinflammatory effect of derivatives extracted from engineered algae in an experimental mouse model of TNBS-induced colonic inflammation.
- the hypothesis based on suggestions from the literature, is that they might have a marked effect of reconstructing the intestinal epithelium, thus reducing the process of dysbiosis resulting in anti-inflammatory activity and improvement of the intestinal microbiota. It also might be able to prevent oxidative damage by scavenging free radicals.
- the experimental data obtained in the invention confirmed the high protective and antiinflammatory effects with improvement in clinical manifestations of colitis obtained by administering the GLP2 alga of the invention at both doses used, but especially at the lowest dose (lOOul) .
- the in vivo model correlating with autism spectrum also confirmed that the tested product is not toxic in mice (that although genetically modified for the BTBR gene have a normal life span) and provided a clear evidence that the improvement of the epithelium quality results in less inflammation and, consequently, better quality of the microbiota. Through the gut-brais axis these effects have a positive impact on autistic behavior.
- Mitochondrial dysfunction in autism spectrum disorders a systematic review and meta-analysis. Mol Psychiatry 2012;17:290-314. Chan DC. Mitochondria: dynamic organelles in disease, aging, and development. Cell 2006;125:1241-1252. Currais A, Goldberg J, Farrokhi C, Chang M, Prior M, Dargusch R, Daugherty D, et al. A comprehensive multiomics approach toward understanding the relationship between aging and dementia. Aging (Albany NY) 2015;7:937-955.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Toxicology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Plant Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Endocrinology (AREA)
- Botany (AREA)
- Cell Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention relates to a microalgae product capable of expressing glucagon-like peptide (GLP), preferably GLP-2, and its use in the pharmaceutical or nutraceutical field in the treatment and prevention of disorders affecting the gastrointestinal system, including in particular acute and chronic inflammatory diseases.
Description
MICRO ALGAE EXPRESSING GLP-2 AND USES THEREOF
Field of Invention
The present invention relates to microalgae capable of expressing glucagon-like peptide (GLP), preferably GLP-2 or analogs of GLP-2, and uses thereof in pharmaceuticals or as a dietary supplement in the treatment and prevention of disorders affecting the gastrointestinal system, including in particular acute and chronic inflammatory diseases.
Background of the invention
A bioactive compound is any compound present in foods, animals, or plants that has an effect on the body that consumes it. In that direction, bioactive ingredients are those that, when inserted in foods, provide some effect of improvement to health. Bioactive ingredients or active ingredients, often referred to as functional ingredients, are compounds extracted from a source food, such as fruits, cereals, vegetables, and food processing residues, which preserve their characteristics even after extraction. In the same context, the term nutraceutical product or "functional food" defines all those foods, fresh or processed, which, through their normal consumption within the normal diet, by containing bioactive compounds, offer potential improvement in human health by reducing the occurrence of certain diseases. These functional foods aim to promote and support the well-being of the human body, and their development is extremely valuable from the perspective not only of treatment, for patients with gastointestinal (GI) disorders, but also of complementary and alternative prevention and containment of these diseases.
Usually functional foods contain, within them, specific natural or additional minerals, vitamins, fatty acids, dietary fiber and/or biologically active substances such as, for example, phytochemicals, antioxidants, probiotics and, also, proteins.
In the scientific landscape, there are several studies that support how certain categories of functional foods, containing probiotics, prebiotics, specific plant extracts, act positively on the digestive system, driving the food industry toward the production and development of innovative foods, capable of containing beneficial living substances using, increasingly predominantly, state-of-the-art genetic technologies.
It is necessary to emphasize that in the context of GI disorders, complementary strategies turn out to be essential not only for the reduction of the onset of such disorders, but also, and more importantly, for the management of physiological consequences related to an inflammatory state that adversely
affect a normal lifestyle. Moreover, such disorders greatly impact the cost of public health, as very often, a correct diagnosis is not obtainable in a short time.
GI diseases and, in particular, chronic inflammatory bowel diseases (IBDs) such as inflammatory bowel syndrome, Crohn's disease, and ulcerative colitis are characterized by a chronic inflammatory state and, in recent years, their incidence, and prevalence has increased considerably in synergy with their severity. In addition, triggers for such intestinal dysfunctions that can result in severe intestinal failure include all conditions for which there is a change in the intestinal microbiota (drug use, alcohol, presence of malignant neoplasms, etc.).
For example, although there is a genetic predisposition for the occurrence of IBDs, the development of these diseases appears to be multifactorial, encompassing lifestyle, diet, and endogenous factors, including the composition of the gut microbiota. High intakes of mono/di-saccharides, and total fat have been shown to significantly increase the risk of developing IBDs, while a diet rich in vegetables, fruits and/or dietary fiber, protects against the onset of Crohn's disease and ulcerative colitis; these are also associated with probiotics and prebiotics which modulate the gut microflora and reduce the likelihood of IBD progression. Certain dietary patterns, rather than individual foods or nutrients, in fact, may be critical to susceptibility toward these diseases. Irritable bowel syndrome (IBS) is considered a chronic, common and little-known disease condition that is treated pharmacologically with different active ingredients, dietary factors and psychotherapeutic forms without, however, in lasting success.
Among the main drugs approved by regulatory agencies and used in the treatment of IBD at different stages are those that can regulate major inflammatory cytokines, immunomodulatory drugs, anti- TNF agents, antibiotics, corticosteroids and others
(https://link.springer.eom/article/10.1007/s00210-019-01698-z). Unfortunately, however, a large percentage of patients with IBD are in the age group of over 60 years and have comorbidities such as cardiovascular disease and/or diabetes that make the treatment of GI disorders more complex and difficult. In addition, some patients are found to be unresponsive to anti-IBD therapies. All these co-factors, therefore, make it necessary to develop new therapeutic strategies in the treatment of GI failure.
It is now known in therapeutic protocols that glucagon-like peptide (GLP) possesses numerous functions in the human body involving the reduction of blood glucose levels, control of body weight, inhibition of gastric emptying, reduction of food ingestion, increased proliferation of intestinal villi, and enhancement of intestinal growth and nutrient absorption; therefore, GLP peptides and
dipeptidyl peptidase IV (DPP-IV) inhibitors have recently attracted the attention of researchers for the treatment of IBD. Several animal models, in fact, have shown how GLP administration improves the clinical course of colitis. In particular, the use of GLP-2 in the treatment of IBDs and IBSs appears to be a new therapeutic option for intestinal failure. In several experimental models, GLP-2 reversed the atrophy of the intestinal mucosa induced by parenteral nutrition and accelerated the process of endogenous adaptation in rats that had a large part of the small intestine severed. GLP-2 also significantly attenuated intestinal damage, and weight loss, in rat models with indomethacin-induced enteritis. GLP-2 also exerted reparative and cytoprotective actions in rodents in which intestinal inflammation was induced by chemotherapy treatments. Human clinical results, at the same time, have fully elucidated the beneficial effects of GLP-2 in patients with intestinal mucosal damage, confirming its ability to significantly increase energy uptake, reduce water loss and nitrogen absorption in treated subjects compared with controls. Body weight and lean body mass, moreover, increased, as opposed to fat mass, which, on the other hand, decreased; the time required for gastric emptying was also increased by 50%. Finally, histological analysis of intestinal tissue revealed how the depth and height of intestinal villi also increased following GLP-2 administration (Julie Lovshin, Daniel J. Drucker, in Encyclopedia of Endocrine Diseases, 2004).
GLP-2 is a peptide hormone composed of 33 amino acids released by intestinal L-endocrine cells upon nutrient ingestion and exerts its trophic action on the epithelium of the small and large intestine through stimulation of cell proliferation and inhibition of apoptosis. GLP-2 also upregulates intestinal glucose transporter activity and reduces gastric emptying and gastric acid secretion. GLP- 2 activity is regulated, in part, through renal clearance and cleavage by dipeptidyl peptidase IV aminopeptidase. The actions of GLP-2, in addition, are transduced by the glucagon-like peptide-2 receptor (GLP-2R), which represents a member of the G-protein-coupled receptor superfamily. GLP- 2R is involved in the increased adenylate cyclase activity.
Recently, several approaches have been developed to improve the half-life of circulating GLP-2, such as (i) structural modifications that affect the cleavage sites of degrading enzymes (DPP-IV and other proteases), (ii) fusion with proteins or lipids that allow better bindingto albumin or other circulating proteins, (iii) combining the sequence or formulation of GLP-2 with lipids/phospholipids or excipients that preserve the primary structure of the peptide hormone.
In all of these approaches, regardless of the modifications or formulation applied to improve its bioavailability and/or half-life, GLP-2 is obtained primarily by chemical synthesis or biologically by recombinant DNA (cDNA) technology, with several purification steps downstream in the process.
Based on all these considerations, it is evident that there is a need to make available systems capable of expressing a bioavailable, low-cost form of GLP-2 for use in the treatment and prevention of GI disorders that is easily obtainable and suitable for preferably oral administration. Microalgae are single-celled plant organisms belonging to both the prokaryotic and eukaryotic kingdoms. Microalgae produce energy through the photosynthetic process, removing carbon dioxide from the atmosphere and releasing oxygen at the end of the process. Their special position in phylogenetic evolution makes them model organisms, as they share characteristics common to both bacteria and higher plants. The unicellular nature of microalgae means that they must respond to environmental stresses quickly and efficiently (to ensure their survival), maintaining the genome in a highly reactive euchromatic state. Number of studies, concerning microalgae, derive from the large production of secondary metabolites that are perfectly placed in the nutraceutical and pharmaceutical fields, these being potent antioxidants, essential amino acids and polyunsaturated fatty acids (co3 and co6). Microalgae comprise a wide range of mainly aquatic, unicellular, and eukaryotic organisms (including green algae, diatoms, and brown algae) that engage in photosynthetic activity, and contain cytoplasmic organelles such as mitochondria and chloroplasts. The chromatin structure of microalgae is distinct from other eukaryotic organisms; in fact, this is heavily colored highlighting a more compact nucleosomal structure and a close association of DNA with histone protein components. These differences, which are more present in green microalgae, indicate a differential mechanism in the regulation of gene expression at the histone chromatin level. In addition, structural chromatin differences in microalgae may be explanatory regarding stable nuclear transgene expression that is, in fact, difficult and transient due to chromatin-mediated gene silencing itself (H. Cerutti, A.M. I, N.W. Gillham, J.E. Boynton, Epigenetic silencing of a foreign gene in nuclear transformants of Chlamydomonas, The Plant Cell9:925-945 (1997)). Several anti-apoptotic gene constructs derived from mammalian cells combined with fluorescent reporter genes were introduced within model algae to evaluate their expression. The results showed that expression was low and no fluorescence gene expression could be detected, confirming the difficulty in the expression of transgenes within the microalgal genome.
Microalgae are considered an important source of healthy nutrients for human needs and are important in that biomass and biofuels can also be derived from their cultivation. Genetic engineering and stable expression (maintained over multiple generations) of different transgenes would open new horizons and greatly enhance the value and opportunity of cultivating microalgae for purposes of improving healthy well-being. However, as described earlier, it has been difficult to achieve a stable
and sufficiently high level of gene expression, so a new methodology to help overcome this obstacle is extremely useful. Such an approach must consider gene silencing related to the unique and resistant histone presence of microalgae, including green microalgae.
The present invention reports a totally innovative approach regarding the use of specific microalgal strains and specific growth and reproduction techniques to express and produce GLP-2 and/or GLP- 2 peptide analogs as an endogenous metabolite to be used, for example in the form of freeze-dried biomass or humid biomass absorbed over dried functionalized food flour, as a bio-active material for animal and human use.
Summary of the invention
It is therefore an object of the invention a nucleic acid molecule comprising or consisting of: a. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or which matches perfectly or is complementary to any of SEQ ID No. 53-64; and b. at least one linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1-21; wherein the linker polynucleotide sequence is linked to the 5 'end and/or the 3' end of the coding polynucleotide sequence.
Preferably said nucleic acid molecule comprises or consists of: c. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or which matches perfectly or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or which matches perfectly or is complementary to any of SEQ ID No. 53-64; and d. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 5' end of the coding polynucleotide sequence; and e. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 3' end of the coding polynucleotide sequence.
Still preferably said nucleic acid molecule has at least 85% homology to any of SEQ ID No 29-42 or has at least 85% homology to any of SEQ ID No 65-76.
It is a further object of the invention an host cell comprising said nucleic acid molecule, wherein said host cell is an algal cell; preferably said host cell belongs to the class of Chlorophyceae and/or to the class of Trebouxiophyceae; still preferably said host cell to the species Haematococcus spp. and/or Chlorella spp.; even more preferably said host cell belongs to Haematococcus pluvialis and/or Chlorella vulgaris.
In a further embodiment the invention provides said host cell for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of irritable bowel disorders, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals; preferably said host cell according is for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
It is a further object of the invention a GLP2 expressing algal biomass comprising at least one host cell as defined above and/or a lysate and/or an extract of said host cell.
Preferably said biomass comprises the GLP2 peptide of SEQ ID No. 43 and/or GLP2 peptide analogs comprising SEQ ID No 43 or comprises the GLP2 peptides of SEQ ID No. 44-52 and/or analogs comprising SEQ ID No. 44-52.
It is a further object of the invention a method for obtaining said GLP2 expressing algal biomass comprising the following steps: a. induce thermal stress in a culture of microalgae by heating at a temperature between 35° and 50° C for a time between 300 and 600 seconds; b. expose the microalgae culture to UV rays (UV-A, UV-B and UV-C) for one or more time intervals between 5 and 15 min; c. inoculate the culture treated in step b in fresh liquid medium; d. suspend the microalgae culture from step c) in a solution composed of 16-50% (v / v) of 0.35 M mannitol and 0.2-0.6% of a mixture of lytic enzymes comprising at least one of the following enzymes: cellulase, cellulase CP, hemicellulose, chitinase, 0-D- glucanase, macerozyme, helicase, driselasi, lytic enzyme L, pectinase, protease, xylanase, cutinase, P-D-glucuronidanase, cellobiohydrolase, mixtures of them; e. incubate the microalgae culture treated in step d) at a temperature between 30 - 40° C for 4-8 h;
f. combine the culture incubated from step e) in 10 ml of culture medium, with 0.1 - 0.5% of a solution comprising the isolated nucleic acid as defined in the previous paragraphs, in the presence of 10-35 % polyethylene glycol (PEG-X).
In the method of the invention the microalgae preferably belong to the Chlorophyceae class and or to the Trebouxiophyceae, more preferably belong to the Haematococcus spp. and/or Chlorella spp., even more preferably belong to the Hematococcus pluvialis species and/or Chlorella vulgaris.
It is a further object of the invention the GLP-2 expressing algal biomass as defined above or obtainable by the method above for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders deriving from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals; preferably said GLP-2 expressing algal biomass is for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
It is a further object of the invention a pharmaceutical composition comprising the host cell of the invention or the GLP-2 expressing algal biomass of the invention and at least one pharmacologically acceptable excipient.
Preferably said pharmaceutical composition is for use in the treatment and/or prevention of intestinal dysbiosis and inflammatory bowel disease (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals; preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
It is a further object of the invention a supplement or food product or drinking product comprising the host cell of the invention or the GLP-2 expressing algal biomass of the invention.
It is a further object of the invention the non-therapeutic use of the GLP-2 expressing algal biomass of the above supplement or food product or product to drink in the nutraceutical sector or as a basic ingredient in preparations of supplements and/or as an agent for the prevention and/or treatment of intestinal dysbiosis, chronic inflammatory bowel diseases (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal
microbiota, inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
The invention will be illustrated with reference to the following figures .
Figure 1. Effect of natural products with pharmacological properties, extracted from engineered algae, in a mouse model of 2,4,6-trinitrobenzene sulfonic acid (TNBS)-induced colitis. (A) Effect of tested compounds on body weight in the TNBS-induced colitis mouse model. Body weight was monitored daily until sacrifice. Weight change over time is expressed as a percentage of initial body weight. Lines indicate the mean ± standard error of each experimental group; (B) Effect of derivatives extracted from artificial seaweed on colonic length in TNBS-induced colitis mice. At the end of the study (day +3 from TNBS infusion), the two spots were excised and the length was determined with a slide caliper. Data shown represent mean + ES of 8 mice/group. ***P<0.0001 vs TNBS (test-t); (C) Effect of artificial seaweed extracted derivatives on health quality index (Health score, as defined in the results description section) in mice with TNBS-induced colitis; (D) Effect of derivatives extracted from engineered algae on DAI index (Disease Activity Index, as defined in the results description section) in mice with TNBS-induced colitis; (E) Effect of derivatives extracted from engineered algae on macroscopically visible colonic damage in mice with TNBS-induced colitis; (F) All mice in the different groups in the study were treated with TNBS. Mortality changed from the control group ( 37.5% mortality) if the mice ate seaweed withGLP2 ( 12.5% mortality) or did only Mesalazine ( 25% ) or ate seaweed not expressing GLP2 ( 50%); (G) Analysis of Body Weight and food intake of BTBR mice involved in the study. Mice treated with both lOOuL and 200 uL contrarily to the control group take less food (Right Panel) and consequently do not gain weight (Left Panel) as a consequence of socializing and playing more; (H): BTBR Mice and Behavioral Tests: Marble burying (Left Panel ) and Self grooming (Right Panel) . The treatment albeit reduced in time to 3 weeks of observation with GLP2 alga specifically and significantly changed the OCD type behavior of BTBR mice (socializing attitude) while leaving the self grooming attitude unchanged.
Figure 2. Cell viability reported as a function of the tested dose of algae, expressed as the absorbance value of formazan crystals that is directly proportional to cell viability. (A) 24 hours; (B) 48 hours; (C) Cell viability expressed as % compared to control (untreated cells = 0%) The results show a positive effect on cell viability at 24 and 48 hours after treatment with the GLP-2 expressing alga compared to the control alga. On HepG2, the effect is visible only at 24h.
Figure 3. Pharmacokinetic study in C57BL/6 male mice (n=6) with single dose treatment p.o. administration of 0.100 ml per mouse of humid biomass microalgae expressing GLP-2 peptides. The
sampling time was following: the predosing and 15 min, Ih and 6h after dosing.
Figure 4. Schematic representation showing the method of the invention according to one embodiment.
Detailed description of the invention
The invention is based on the development of a novel strategy for the biosynthesis of active compounds by unicellular microalgae. In particular, within the present invention specific microalgal genotypes have been selected for the production of bioactive molecules under controlled conditions, which are available and suitable for the preparation of nutraceutical and/or pharmaceutical products. Chlorophyceae are one of the classes of green microalgae, distinguished mainly on the basis of ultrastructural morphology. Usually their coloration is caused by the predominance of photosynthetic pigments such as chlorophyll a and chlorophyll b. The chloroplast can have a discoidal, plate-shaped, reticulate, cup-shaped, spiral or ribbon-like conformation depending on the species to which it belongs. Most species belonging to this class, have one or more storage compartments called pyrenoids, located within the chloroplast. Pyrenoids, in turn, contend with various proteins including starch. Some species of green microalgae can store nutrient sources in the form of oily droplets. They usually have a cell wall consisting of an inner layer of cellulose and an outer layer of pectose. Trebouxiophyceae is a further class of green microalgae suitable for the purposes of the invention, in particular Chlorella spp.
The present invention is related to the production of exogenous proteins within a host cell, represented by a microalgal cell belonging to the class Chlorophyceae and/or Trebouxiophyceae. In some embodiments, the host cell is used as a biofactory for protein production. In some embodiments of the invention, the recombinant Chlorophyceae host cell is Haematococcus spp. In some embodiments of the invention, the recombinant Trebouxiophyceae host cell is Chlorella spp. In some embodiments of the invention the host cell is Haematococcus pluvialis and/or Chlorella vulgaris.
It therefore forms an object of the invention an isolated nucleic acid molecule comprising or consisting of: a. a polynucleotide coding sequence having at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent, at least about 90 percent, at least about 95 percent, at least about 98 percent to SEQ ID No. 28 or that appears perfectly or is substantially complementary to SEQ ID No. 28, or its fragments or functional derivatives;
b. at least one linker polynucleotide sequence with at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent , at least about 90 percent, at least about 95 percent, at least about 98 percent to any one of SEQ ID No 1-21; wherein the linker polynucleotide sequence is operatively bound to the 5' and/or 3' end of the coding sequence.
As used herein, the term “homology” refers to sequences characterized by similarity at the nucleotide level or amino acid level as discussed herein.
A nucleic acid molecule that is complementary to the nucleotide sequence of SEQ ID NO 28 is one that is sufficiently complementary to the nucleotide sequence of SEQ ID NO 28 that it can hydrogen bond with few or no mismatches to the nucleotide sequence shown in SEQ ID NO 28 thereby forming a stable duplex.
As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotides units of a nucleic acid molecule, and the term "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
Preferably the linker polynucleotide sequences with at least about 50 percent homology, preferably at least about 60 percent, preferably at least about 70 percent, preferably at least about 85 percent, at least about 90 percent, at least about 95 percent, at least about 98 percent to any one of SEQ ID No 1-21 are two and are bound at the 5' and 3' ends, respectively, of the coding polynucleotide sequence. Preferably the isolated nucleic acid molecule is of sequence corresponding to SEQ IDs No 29-42, or functional fragments and derivatives.
It is a further object of the invention a host cell comprising the isolated nucleic acid molecule as defined above, wherein said host cell is an algal cell, preferably said host cell belongs to the class Chlorophyceae and/or Trebouxiophyceae, preferably said host cell belongs to the species Haematococcus spp. and/or Chlorella spp..
The invention also relates to the host cell for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders resulting from
irritable bowel syndrome, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, for strengthening and improving the intestinal microbiota, preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disordersand autism spectrum disorders.
In a further embodiment the invention is directed to an algal biomass comprising at least one host cell as defined above and/or a lysate and/or extract and/or secretion of said host cell and comprising expressed GLP2 (SEQ ID No 43) and GLP2 peptide analogs .
As used herein, a GLP2 peptide analog is a peptide comprising the GLP2 sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID No. 43) elongated at the N or C terminal with additional aminoacids corresponding to or encoded by the specific linkers of the invention. Said GLP2 analog is a functional analog as it maintains the same biological properties of the GLP2 peptide of SEQ ID No 43.
Further forming an object of the invention is a method for obtaining an algal biomass expressing GLP2 and/or GLP2 peptide analogs comprising the following steps: a. Induce heat stress in a culture of microalgae belonging to the class Chlorophyceae by heating at a temperature between 35 and 50°C for between 300 and 600 seconds; b. Expose the microalgae culture to UV light (UV-A, UV-B and UV-C) for one or more time intervals between 5 and 15 min; c. Inoculate the culture treated in step b into fresh liquid medium to restore normal biophysiological conditions; d. Suspend the microalgae culture pretreated according to steps (a), (b) and (c) in a macerating solution consisting of 16-50% (v/v) 0.35 M mannitol and 0.2-0.6% lytic enzyme mixture comprising at least one of the following enzymes: cellulase, cellulase CP, hemicellulase, chitinase, 0-D-glucanase, macerozyme, helicase, driselase, lytic enzyme L, pectinase, protease, xylanase, cutinase, P-D-glucuronidanase, cellobiohydrolase, or mixtures thereof; e. Incubate the microalgae culture treated in step (d) at a temperature of 30 to 40°C for 4 to 8 h; f. combine the culture incubated from step (e) in 10 ml of culture medium, with 0.1 to 0.5 % of a solution comprising the nucleic acid isolated according to any of claims 1 or 2, in the presence of 10 to 35 % polyethylene glycol (PEG-X).
In a preferred form of realization microalgae belong to the classes Chlorophyceae,
Trebouxiophyceae, preferably microalgae belong to the species Haematococcus spp., Chlorella spp. Further forming an object of the invention is an algal biomass expressing GLP-2 and /or GLP-2 peptide analogs obtainable by the method defined above.
The present invention also relates to a pharmaceutical composition comprising the invention's host cell or biomass and at least one pharmacologically acceptable excipient.
Preferably said pharmaceutical composition is for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders resulting from irritable bowel syndrome, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, for strengthening and improving the intestinal microbiota, preferably for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis, and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
Further forming an object of the invention is a food supplement or drinking product comprising the host cell or biomass as defined above.
It is an object of the invention to make nontherapeutic use of the host cell, biomass or suppiementor food or drink product, as defined above, in the nutraceutical field or as a basic ingredient in supplement or drug preparations and/or as an agent for the prevention and/or treatment of chronic inflammatory bowel disease (IBD), for the treatment of disorders arising from irritable bowel syndrome, for the containment of the progression of osteoporosis, for the amelioration of disorders arising from bone resorption, for strengthening and improving the intestinal microbiota, preferably of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis. In addition, the products of the invention find use in treatment, prevention and as supplements in situations of intestinal dysbiosis preferably due to eating disorders and autism spectrum disorders.
For this innovative process, effective but not limiting growth conditions for the host cell include (i) efficient growth media, (ii) bioreactor temperature, (iii) pH, and (iv) oxygenation. Efficient growth medium is defined as any culture medium in which a microalgal cell, such as the Chlorophyceae cell, is usually grown. Such medium typically includes an aqueous phase containing assimilable sources of carbon, nitrogen and phosphate, as well as mineral salts, metals and other appropriate nutrients such as, for example, vitamins. Non-limiting examples of suitable media and growth conditions are described in the "Examples" section. Cells of the present invention can be cultured in conventional fermentation photobioreactors, shaking flasks, test tubes, microtiter plates, and Petri dishes. Culture can be carried out at appropriate temperature, pH and oxygen content for the
recombinant cell.
According to the present invention, the term "transformation" identifies any methodology by which an exogenous nucleic acid molecule (i.e., a recombinant nucleic acid molecule) can be inserted within microbial cells. Within microbial cells, the term "transformation" is used primarilyto describe a genetic, heritable change caused by the acquisition of exogenous nucleic acids by the microorganism, and is essentially synonymous with the term "transfection." Several methodologies suitable for the introduction of exogenous nucleic acid molecules inside algal hostcells are known, such as (i) shotgun with gold particles, (ii) electroporation, (iii) micro injection, (iv) lipofection, (v) adsorption, (vi) infection, and (vii) protoplastic fusion.
A biomass according to the present invention is a composition comprising transformed algal cells and/or extracts and/or lysates or other derivatives. More specifically, the biomass of the invention is obtained after lysis of the cell culture and comprises, inter aha, the GLP2 peptide and the GLP2 peptide analogs.
In the present invention, a methodology for transforming a competent algal host cell has been developed that involves two main steps: a) pretreating the host cell with an enzyme, and b) introducing an exogenous nucleic acid molecule into the host cell. The method of the invention is well explained in Figure 4. According to the present invention, the enzyme can have cellulase, protease, P-glucoronase and various combinations of these activities.
The expression system of the invention, which allows the GLP-2 protein to be expressed within the algal cell, includes regulatory control elements that are active in microalgal cells. Many of these elements, including several promoters, are active in different species; therefore, the novel regulatory sequences, described as aspects of the invention, can be used not only in the algal cells described here, but also in cells belonging to different species characterized by the same evolutionary mechanisms . The design and construction of theexpression systems covered by the invention use standard biomolecular technologies known to persons skilled in the art. See, for example, Sambrook et al., 2001, Molecular Cloning: A Laboratory Manual, 3rd edition.
In an embodiment of the invention, the expression system or expression vector comprises a polynucleotide sequence encoding for the GLP-2 protein associated with any promoter sequence, or 5' linker, and possibly a terminator sequence, or 3' linker. The 5' linker, the GLP-2 coding sequence and the 3' linker are operatively linked so that they are functional within the host cell. The expression system may also include additional regulatory sequences that are functional within the genome of the host cell. Inducible or constitutively active sequences can be used. Suitable control elements, also
include any regulatory element associated with the expression of the nucleicacid molecules described here.
The present invention is also directed to the algal host cell comprising the expression system described above and/or to a biomass obtained from or comprising said algal cell.
The expression system of the invention preferably comprises at least one of the nucleic acid molecules isolated in the present invention and described herein. In addition, all genetic elements of the expression system are sequences associated with previously isolated nucleic acid molecules. In some embodiment protocols, the nucleic acid sequence encoding for the GLP-2 protein, or coding sequence, is stably integrated into the genome of the host cell, while in others, said coding sequence is operatively linked to a promoter linker sequence and/or a terminator linker sequence, both of which are functional in the host cell. The linker sequences to which the coding sequence is operatively linked include, but are not limited to, the novel nucleic acid sequences described inthe present invention. In some embodiments, moreover, the coding sequence is optimized for the codon belonging specifically to the host cell of Haematococcus spp. and/or Chlorella spp. so as to maximize translation efficiency.
The recombinant algal cell that is the subject of the invention is capable of expressing therapeutic proteins. A "therapeutic protein," as used herein, includes proteins useful for the treatment or prevention of diseases, pathological conditions, and various disorders in both animals and humans. The terms "prevention" and "treatment" refer to both therapeutic treatment and prophylactic or preventive measures in which the objective is to prevent or slow (reduce) an undesirable pathophysiological condition, disease, or disorder, or to achieve beneficial or desired clinical results. For the purposes of the present invention, beneficial or desired clinical results include, butare not limited to, the alleviation of symptoms or signs associated with a pathological condition or disorder of normal physiology; reducing the severity of a condition, disease, or disorder; stabilization of a condition, disease, or disorder (or better, situations in which the condition, disease, or disorder is stable and does not worsen over time) delay in the onset or progression of the condition, disease, or disorder; improvement of the condition, disease, or disorder; remission (total or partial and detectable or undetectable) of the condition, disease, or disorder; or enhancement or improvement of a condition, disease, or disorder. Treatment includes eliciting a clinically meaningful response without excessive side effects and also prolonging survival over expected survival if treatment is not received. In the present invention, the therapeutic protein is glucagon-like peptide 2 (GLP-2) and analogs thereof. Protein produced or expressed by the algae cell according to the invention can be produced on a
commercial scale. Commercial scale includes protein production from a microorganism grown in an aerated bioreactor (biofermentor) of size > 100 L, > 1,000 L, > 10,000 L, or > 100,000 L. In some forms of implementation, commercial-scale production is performed in an aerated biofermentor with agitation. The protein produced by the algae cell can also accumulate within the cell or can be secreted by the cell, for example, into the culture medium as a soluble protein. The protein produced can be recovered from the cell, the culture medium, or the fermentation medium in which the cell itself is grown. The same biomass expressing the GLP-2 protein and GLP-2 analog, can be used directly for the purposes of the invention, which include therapeutic and preventive uses and nontherapeutic uses, for example, in the preparation of a nutraceutical product or active ingredient as for pharmaceutical use thereafter.
In addition, the present invention is directed to a method for producing a recombinant protein; the methodology also includes culture conditions for the microalgal cells of the invention such that a polynucleotide sequence coding for a protein can be expressed.
Proteins produced by the method elaborated in this invention can also be purified using a variety of standard protein purification techniques such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reversed phase chromatography, chromatographyusing concanavallin A, chromatofocusing, and differential solubilization. In some embodiments, proteins produced by the method described in the present invention are isolated in "substantially pure" form. In this context, "substantially pure" refers to a purity that allows effective use of the protein as a commercial product and/or ingredient to be used in combination with others. In some embodiments, the recombinant protein accumulates within the cell and is recovered from the cell; in some embodiments, the host cell of the method belongs to the Chlorophyceae class, while in other embodiments, the host cell is from Haematococcus spp. In some embodiments, the host cell belongs to the Trebouxiophyceae class, while in other embodiments is Chlorella spp. In some realizations, the recombinant protein is a therapeutic protein, a food enzyme or an industrial enzyme. In some realizations, the recombinant protein is GLP-2. In some realizations, the recombinant protein is a therapeutic protein that includes a secretion signal sequence, such as the GLP2 analog.
Nucleic acids
Isolated nucleic acid molecules or polynucleotide sequences that constitute the expression systemin the algal cell form the object of the invention. The nucleic acid sequences described here include the 5' and 3' linker sequences and coding sequences, particularly the GLP-2 coding sequence.
An isolated nucleic acid molecule can be a DNA molecule, RNA molecule (e.g., mRNA) or derivatives of them (e.g., cDNA). Although the phrase "nucleic acid molecule" refers principally to the physical nucleic acid molecule, and although the phrases "nucleic acid sequence" or "polynucleotide sequence" refer primarily to the sequence of nucleotides present on the nucleic acid molecule, the phrases are used interchangeably, especially in reference to a nucleic acid molecule, polynucleotide sequence, or nucleic acid sequence encoding a protein. In some embodiments, a nucleic acid molecule isolated by the present invention is produced using recombinant DNA technology (such as, for example, cloning and amplification by polymerase chain reaction (PCR)) or by chemical synthesis. Isolated nucleic acid molecules include naturally occurring nucleic acid molecules and their homologs, including, but not limited to, naturally occurring allelic variants and modified nucleic acid molecules in which nucleotides have been inserted, deleted, substituted, and/or reversed in such a way that these modifications provide the desired effect on the sequence, function, and/or biological activity of the encoded peptide or protein.
A double-stranded DNA present in this invention, includes a single-stranded DNA and its complementary strand, the sequence of which mirrors the sequence of the single-stranded DNA. As such, nucleic acid molecules of the present invention, may be double-stranded or single- stranded and also include those nucleic acid molecules that form stable hybrids under high "stringency" conditions with a sequence of the invention and/or with a sequence complementary to a sequence of the invention. Methods for tracing a complementary sequence are known to experts in the field.
The term "protein" includes single-chain polypeptide molecules as well as multiple polypeptide complexes in which the individual constituent polypeptides are bound through covalent and noncovalent means. The term "polypeptide" includes peptides of two or more amino acids in length, typically having more than 5, 10 or 20 amino acids.
The human GLP-2 peptide is a 33 amino acid peptide, having the following sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD (SEQ ID No. 43).
The new nucleic acid molecules of the present invention can be used in any genus of microalgae in which they are found to be functional. In some forms of embodiment, the nucleic acid molecules are used in algae belonging to the class Chlorphyceae. In some forms of embodiment, recombinant nucleic acid molecules are used in the species Haematococccus spp. In some forms of embodiment, recombinant nucleic acid molecules are used in the class of Trebouxiophyceae and/or in the species Chlorella spp. As used in this invention, a recombinant microorganism has a genome that has been modified (i.e., mutated or changed) from its natural (i.e., naturally occurring or wild-type) form using recombinant technology. A recombinant microorganism according to the present invention, may include a microorganism in which nucleic acid molecules have been inserted, deleted, or modified (i.e., mutated, e.g., by nucleotide insertion, deletion, substitution, and/or inversion) such that the modifications provide the desired effect within the microorganism.
Linker promoters and terminals
The present invention is directed to the 5' and 3' linker sequences. The 5' or promoter linker is a DNA sequence that directs transcription of a coding region associated with it. The 3' or terminal linker, on the other hand, is the gene sequence that marks the end of transcription of genomic DNA.
The linker of the invention (promoter or terminal) is any of the following sequences: CGGGGCAACTCAAGAAATTC (SEQ ID No 1) GTCTGGCCGAGGTCTGGTTCCTGTGCC (SEQ ID No 2)
ACTGCACATCGCTGCAGTCT (SEQ ID No 3) CGCGTCGGGGCCTGCCTAAG (SEQ ID No 4) TTACCTGCCACACAAGCCTG (SEQ ID No 5) CGTGCTACTGGGGTCTGGCAG (SEQ ID No 6) CACATGCCATCCGAGTCGTC (SEQ ID No 7) CACAACCATACTGGCGAAGT (SEQ ID No 8) ATGGCCACGC (SEQ ID No 9)
CTCTACCCAC (SEQ ID No 10)
CCGGACTGCCATAGCACAGCTAGACGA (SEQ ID No 11) GTCTGGCCGAGGTCTGGTTCCTGCCTAG (SEQ ID No 12) ACTGACTGCCATAGCACAGCTAGACGA (SEQ ID No 13) ATTTGCTGCATGACTGGATCAATGCGACGA (SEQ ID No 14) GTCTGGCCTGACGTATGATCGATGCCATAAATGC (SEQ ID No 15) ATGCCCTGATCCCAATGATGGACGA (SEQ ID No 16) GTCTGGCCGAAACTGATTTGGCCATGAC (SEQ ID No 17) GAGCGTGCTGAAATGCATGCGACGA (SEQ ID No 18) GTCTGGCCCCCGGGTATAGTAGCTGAC (SEQ ID No 19) CCCGGGTATAGTAGCTGACTGCGACGA (SEQ ID No 20) GTCTGGGAGCGTGCTGAAATGCATG (SEQ ID No 21)
It therefore forms an object of the invention to have an isolated nucleic acid molecule comprising a polynucleotide sequence that is at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any one of SEQ ID NO: 1 - SEQ ID NO:21, in which the polynucleotidesequence functions as a promoter and/or terminal linker at least in algae belonging to the class Chlorophyceae. The invention also relates to an isolated nucleic acid molecule comprising a polynucleotide sequence that hybridizes with any of the SEQ ID NO:1 - SEQ ID NO:21 sequences or that hybridizes with a polynucleotide sequence that is at least 95 percent identical to any of the SEQ ID NO: 1 - SEQ ID NO:21 sequences.
The isolated nucleic acid molecule may include a polynucleotide sequence that is completely complementary to any of the SEQ ID NO: 1 - SEQ ID NO:21 sequences or to a polynucleotide sequence that is at least 95% identical to any of the SEQID NO:1 - SEQ ID NO:21 sequences.
MATERIALS AND METHODS
Cell cultures
Microalgae, belonging to the genus Chlorophyceae, were grown in the culture medium shown in Table 1, under illumination with an intensity of 120 mmol photons m s-2-1 in an alternating cycle 25 of 16 h of light and 8 h of dark, at a temperature of 25 °C. The cultures were agitated by mechanical shaker (g24 environmental incubator shaker, American Laboratory Trading) at 70 rpm throughoutthe growth time.
Table 1 : composition of the growth medium
The percentages shown in the table may vary depending on the species, genotype and initial concentration of microalgae cultures.
Polynucleotide design
Through bioinformatics research, some microalgae-specific genes related to the photosynthesis pathway were analyzed. The following sequences were derived from specific algal sequences:
CGGGGCAACTCAAGAAATTC (SEQ ID No 1)
GTCTGGCCGAGGTCTGGTTCCTGTGCC (SEQ ID No 2)
ACTGCACATCGCTGCAGTCT (SEQ ID No 3)
CGCGTCGGGGCCTGCCTAAG (SEQ ID No 4)
TTACCTGCCACACAAGCCTG (SEQ ID No 5)
CGTGCTACTGGGGTCTGGCAG (SEQ ID No 6)
CACATGCCATCCGAGTCGTC (SEQ ID No 7)
CACAACCATACTGGCGAAGT (SEQ ID No 8)
ATGGCCACGC (SEQ ID No 9)
CTCTACCCAC (SEQ ID No 10)
CCGGACTGCCATAGCACAGCTAGACGA (SEQ ID No 11)
GTCTGGCCGAGGTCTGGTTCCTGCCTAG (SEQ ID No 12)
ACTGACTGCCATAGCACAGCTAGACGA (SEQ ID No 13)
ATTTGCTGCATGACTGGATCAATGCGACGA (SEQ ID No 14)
GTCTGGCCTGACGTATGATCGATGCCATAAATGC (SEQ ID No 15)
ATGCCCTGATCCCAATGATGGACGA (SEQ ID No 16)
GTCTGGCCGAAACTGATTTGGCCATGAC (SEQ ID No 17)
GAGCGTGCTGAAATGCATGCGACGA (SEQ ID No 18)
GTCTGGCCCCCGGGTATAGTAGCTGAC (SEQ ID No 19)
CCCGGGTATAGTAGCTGACTGCGACGA (SEQ ID No 20)
GTCTGGGAGCGTGCTGAAATGCATG (SEQ ID No 21)
The sequence of the human GLP-2 gene is as follows:
CATGCTGATGGTTCTTTCTCTGATGAGATGAACACCATTCTTGATAATCTTGCCGCCAG
GGACTTTATAAACTGGTTGATTCAGACCAAAATCACTGAC (SEQ ID No. 28)
The following oligonucleotides comprising the human GLP2 gene sequence and at least one promoter linker, preferably a promoter linker and a terminal linker (underlined in the list below), derived from the specific algal sequences and previously described, were then synthesized:
CGGGGCAACTCAAGAAATTCCATGCTGATGGTTCTTTCTCTGATGAGATGAACAC CATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAA ATCACTGACGTCTGGCCGAGGTCTGGTTCCTGTGCC (SEQ ID No 29)
ACTGCACATCGCTGCAGTCTCATGCTGATGGTTCTTTCTCTGATGAGATGAACAC CATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAA ATCACTGACCGCGTCGGGGCCTGCCTAAG (SEQ ID No 30)
TTACCTGCCACACAAGCCTGCATGCTGATGGTTCTTTCTCTGATGAGATGAACAC CATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAA ATCACTGAC (SEQ ID No 31)
CGTGCTACTGGGGTCTGGCAGCATGCTGATGGTTCTTTCTCTGATGAGATGAACA CCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAA AATCACTGAC (SEQ ID No 32)
CACATGCCATCCGAGTCGTCCATGCTGATGGTTCTTTCTCTGATGAGATGAACAC CATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAA ATCACTGAC (SEQ ID No 33)
CACAACCATACTGGCGAAGTCATGCTGATGGTTCTTTCTCTGATGAGATGAACAC CATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAA ATCACTGAC (SEQ ID No 34)
ATGGCCACGCCATGCTGATGGTTCTTTCTCTGATGAGATGAACACCATTCTTGAT AATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGACCAAAATCACTGACC TCTACCCAC (SEQ ID No 35)
CCGGACTGCCATAGCACAGCTAGACGACATGCTGATGGTTCTTTCTCTGATGAGA TGAACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCA GACCAAAATCACTGACGTCTGGCCGAGGTCTGGTTCCTGCCTAG (SEQ ID No 36)
ACTGACTGCCATAGCACAGCTAGACGACATGCTGATGGTTCTTTCTCTGATGAGA TGAACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCA GACCAAAATCACTGACGTCTGGCCGAGGTCTGGTTCCTGCCTAG (SEQ ID No 37)
ATTTGCTGCATGACTGGATCAATGCGACGACATGCTGATGGTTCTTTCTCTGATG AGATGAACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGAT TCAGACCAAAATCACTGACGTCTGGCCTGACGTATGATCGATGCCATAAATGC
(SEQ ID No 38)
ATGCCCTGATCCCAATGATGGACGACATGCTGATGGTTCTTTCTCTGATGAGATG
AACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGA
CCAAAATCACTGACGTCTGGCCGAAACTGATTTGGCCATGAC (SEQ ID No 39)
GAGCGTGCTGAAATGCATGCGACGACATGCTGATGGTTCTTTCTCTGATGAGATG AACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCAGA CCAAAATCACTGACGTCTGGCCCCCGGGTATAGTAGCTGAC (SEQ ID No 40)
CCCGGGTATAGTAGCTGACTGCGACGACATGCTGATGGTTCTTTCTCTGATGAGA TGAACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCA GACCAAAATCACTGACGTCTGGGAGCGTGCTGAAATGCATG (SEQ ID No 41)
ACTGACTGCCATAGCACAGCTAGACGACATGCTGATGGTTCTTTCTCTGATGAGA TGAACACCATTCTTGATAATCTTGCCGCCAGGGACTTTATAAACTGGTTGATTCA GACCAAAATCACTGACAAAAAAAAAAAAAAAAAAGTCTGGCCGAGGTCTGGTTC
CTGCCTAG (SEQ ID No 42)
The following oligonucleotides comprising the GLP2 gene sequence from other species and at least one promoter linker, preferably a promoter linker and a terminal linker (underlined in the list below), derived from the specific algal sequences and previously described, were also synthesized by using the same method of the invention:
Treatment of microalgae
The microalgae culture was resuspended at a ratio of 1 :5 to 1 :25, depending on cell concentrations, in a macerating solution which constitutes a lytic mixture. The macerating solution contained 16- 50% (v/v) 0.35 M mannitol and 0.2-0.6% lytic enzyme mixture (Table 2). The lytic mixtures were then incubated at 30-37°C for 4-8 h. The composition of the lytic mixture, temperature and incubation time changed according to the microalgae species.
The microalgae solutions after treatment with the lytic mixture were combined, in a final volume of 10 ml of culture medium, with 0.1 to 0.5 % v/v of polynucleotide diluted 2, 5, 10, 20, 25, or 50 times (initial concentration 100 pM), depending on the nucleotide length and the resultingmolecular weight of each polynucleotide (Table 3)
Table 3: Polynucleotide dilutions and percentages of lithium mixture used
10-35 % w/V Polyethylene glycol (PEG-X) chemical melting agent was added to the culture
(Table 4), calculated in consideration of the biomass obtained from the previous step.
Subsequently, the following steps were taken: i) The mixture was centrifuged at 1000 to 7000 rpm for 2 to 15 minutes; ii) The supernatant was removed and the pellet was washed with 2-15 ml of culture medium; iii)The mixture was centrifuged at 1000 to 7000 rpm for 2 to 15 minutes.
Steps i, ii and iii are repeated 2 to 5 times. When finished, the pellet is resuspended in 1 to 50 ml of standard culture medium. Centrifugation speed and duration vary according to the concentrations of PEG used (Table 4)
DNA extraction and amplification reaction by PCR
After several subcultures, PCR on DNA was conducted using Phire Plant Direct PCR Master Mix
(Thermo Fisher). The following primers were used in the reaction:
Pri GLP regl - Forward AGACATGCTGATGGTTCTTT (SEQ ID No 22) Pri GLP reg2 - Forward TCTCTGATGAGATGAACACC (SEQ ID No 23) Pri GLP reg4 - Forward GATTTCCCAGAAGAGGTCG (SEQ ID No 24) Pri GLP regl - Reverse AACATTTCAAACATCCCACG (SEQ ID No 25) Pri GLP reg2 - Reverse GCAGGTGATGTTGTGAAGAT (SEQ ID No 26)
Pri GLP reg4 - Reverse CGGCAAGATTATCAAGAATGG (SEQ ID No 27)
The amplification protocol is as suggested in the Phire Plant Direct PCR Master Mix brochure. (Thermo Scientific™ - Cat. Number: Fl 60S - https : //www. thermofisher , com/ order/ catalog/product/F 160S )
To extract metabolites contained within culture, this was sonicated for 15 min (1/2 W converterset to 100 % . Modulated pulse. UH-500B probe - Probe 600 ml - 50% pulse duty cycle). Then the sonicated culture was centrifuged at 4500 rpm for 10 min in order to separate cell debris from the supernatant. Depending on the different applications (in vivo or in vitro), the supernatant and/or biomass were subjected to lyophilization.
Quantification of GLP-2 (pg/g) in microalgae biomass by Mass Spectometry analysis
Mass Spec analysis was used to determine the concentration of the GLP-2 and GLP-2 analogs in dried biomass by lyophilization.
The humid microalgae biomass expressing GLP-2 was collected and freeze-dried to obtain a green powder and 100 mg of this material used to extracted the desired peptide hormone.
Methodology:
- Sample weighing
- Extracted with 20 mL of methanol
- Doing three freeze/thaw cycles with sonication lasting 30 min each
- Leave to stand over night
- The next day centrifuge and 1 mL of supernatant dried by N2
- Added 1 mL of Ammonium bicarbonate 50 mM to the dried sample.
- Sonicated for 20 min
- Centrifuge and supernatant dried in Savant
- Resuspended in 200 pL of HCOOH 0,1%
- Centrifuge and supernatant in vial for LC-MS/MS “MRM” analysis
Ipl of supernatant were analysed by using a AB-sciex 5500 QTRAP® system with a HPLC chromatography system Exion LC™. The mobile phase was generated by mixing eluent A (0.1 % Eormic Acid in water) and eluent B (0.1 % Eormic Acid in acetonitrile) and the flow rate was 0.200 mL/min. Chromatographic gradient was from 20% to 90% in 4 min, hold for 2 min, then return to 20 % in 1 min. Tandem mass spectrometry was performed using Turbo VTM ion source operated in positive ion mode, and the multiple reaction monitoring (MRM) mode was used for the selected analytes.
The extracted mass chromatogram peaks were integrated using Skyline software for data processing.
Pharmakokinetic Studies
A pharmacokinetic study was conducted in C57BL/6 Male mice (n=6) by single dose treatment by p.o. administration of 0.100 ml per mouse of humid biomass microalgae expressing GLP-2 peptides. The sampling time was following: the predosing and 15 min , Ih and 6h after dosing. To preserve the peptide stability, blood samples was collected in presence of a protease inhibitor cocktail to be analyzed by LC-MS and by highly specific and very sensitive (picomols) ELISA sandwich to determine the PK parameters (results are shown in Pig. 3).
RESULTS
In vitro studies
Quantification of GLP-2 (pg/ml) in microalgae biomass by ELISA assay
To determine the amount of GLP-2 expressed by algal biomass, a human glucagon-like peptide 2 (GLP2) ELISA kit (0.156-10 ng/mL) was used. 100 mg of dry algal biomass, obtained by freeze- drying the crude product, was dissolved in 10 mL of water containing 50% acetonitrile and 0.1%
trifluoroacetic acid. The extraction step performed is reported in the materials and methods, in fact, the solution was sonicated for 15 min and then, by centrifugation, the algal biomass was separatedfrom the supernatant. The supernatant was lyophilized and 100 pl was resuspended in diluent buffer (provided by the kit).
The analysis protocol used includes the following steps:
1. Prepare all reagents, samples and standards.
2. Add 100 pl of sample to each well. Incubate 2 hours at 37°C
3. Aspirate and add 100 pl of prepared detection reagent A. Incubate 1 hour at 37°C
4. Vacuum and wash 3 times
5. Add 100 pl of prepared detection reagent B. Incubate 1 hour at 37°C
6. Vacuum and wash 5 times
7. Add 90 pl of substrate solution. Incubate 15-25 min at 37°C
8. Add 50 pl of blocking solution.
9. Read the absorbance immediately at 450 nm.
Interpolating the different measurements made, with the calibration line derived from the assay of the GLP-2 standard provided by the ELISA kit, the amount of peptide present in the sample is in the range of 150 to 2000 pg/ml.
Cytotoxicity Assays
Biocompatibility experiment conducted through Mi l assay of the extract derived from control cells of Haematococcus spp. and GLP-2
5x103 IEC-6 cells were seeded and allowed to grow overnight. CTRL and GLP-2 cells of Haematococcus spp were sonicated and filtered to separate the precipitated phase from the liquid phase. Different concentrations of algal extracts were tested (starting from 25% v/v. Serial 1:2 dilutions were made until the final concentration of 0.39 % v/v was reached). MTT assay was conducted after 24 and 48 hours to check cell viability. The protocol used involves the following steps:
1. Remove the treatment medium: For adherent cells, carefully aspirate the medium.
2. Add 50 pl of serum-free medium and 50 pl of MTT reagent to each well.
3. Background control wells were prepared: 50 pL of MTT reagent + 50 pL of cell culture
medium (without cells)
4. Incubate the plate at 37°C for 3 hours.
5. After incubation, add 150 pl of MTT solvent to each well.
6. Wrap the plate in aluminum foil and shake on an orbital shaker for 15 minutes.
7. Read the absorbance at OD = 590 nm.
Data analysis and statistics were performed using GraphPad Prism. Haematococcus pluvialis was used in the experiment.
In vivo studies
Animal Efficay Studies
Two different efficacy studies were conducted in animal models (mouse) with the aim of verifying non toxicity in vivo and measuring the efficacy of GLP2 produced in alga . The first study was conducted on a mouse model of inflammatory bowel disease (TNBS mouse model) and a second study conducted on Autism Spectrum Disorder Animal Model (BTBR T+tf/J mouse mode - Gut- BRAIN axis report )
Animal Model (TNBS)
Inflammatory bowel disease (IBD) is a multifactorial disease involving immunological, environmental and genetic factors. Although there are no animal models that effectively mimic human inflammatory bowel disease, experimental models allow to analyze the mechanisms of chronic intestinal inflammation. IBD can be induced in mice by a 2,4,6-trinitrobenzene sulfonic acid (TNBS)- ethanol enema that elicits an immune response and colitis. In order to evaluate the efficacy of GLP-2 contained in the biomass of our microalgae on a mouse model of IBD, it was decided to use the TNBS-ethanol-induced colitis model. Based on the scientific publication by Morris et al. (Morris G.P., Beck P.L., Herridge M.S., Depew W.T., Szewczuk M.R., Wallace J.L.Hapten-induced model of chronic inflammation and ulceration in the rat colon. Gastroenterology. 1989;96(3):795-803. [PMID: 2914642]), ethanol and TNBS (trinitrobenzenesulfonic acid) at a dose of 100 mg/kg are co-administered intrarectally to rats. Ethanol is used as a means to effectively destroy the intestinal barrier and allow TNBS to interact with proteins in colon tissue.
After colitis induction, mice develop several manifestations of acute colitis. These include soft stool
formation and occult or even bloody diarrhea. Intracolonic administration of TNBS/ethanol,in mice induces severe disease characterized by bloody diarrhea and dramatic body weight loss during the first week. In detail, colitis was induced by rectal administration of 2 mg/100 ml TNBS (Sigma- Aldrich, St. Louis, MO, USA) in 45% ethanol (Merck, Darmstadt, Germany) using a vinylcatheter placed 3.5 cm proximal to the anus. During the procedure, mice were anesthetized using Rumpun/Zoletil. After instillation of the catheter, the animals were kept upright for 30 sec. Control mice underwent identical procedures but were instilled with 45% ethanol dissolved in phosphate- buffered saline (PBS). Mice were monitored daily for survival, body weight, rectal bleeding and stool consistency. All animals were sacrificed on day 5 of the experiment for cervical dislocation.
Immunocompetent mice were kept fasting for 24 h before colitis induction. At day 0, mice were anesthetized by inhalation of isoflurane, 2 mg of TNBS in 100 pL of 50% ethanol solution were administered slowly into the colon through a medical-grade catheter (3.5 F) inserted gently about 4 cm into the anus.
Food and water were administered ad libitum after TNBS instillation. Mice were divided into the following experimental groups (8 mice/group):
1) TNBS 2 mg/topo ir + PBS 1 mL/topo os
2) TNBS 2 mg/topo ir + Mesalazine 1 mL/topo (100 mg/Kg) os
3) TNBS 2 mg/topo ir + Algae CTRL (300pL) os
4) TNBS 2 mg/topo ir + Algae CTRL (lOOpL) os
5) TNBS 2 mg/topo ir + Algae GLP2 (300pL) os
6) TNBS 2 mg/topo ir + Algae GLP2 (lOOpL) os
(os: oral administration; ir: intra-rectal administration; GLP2 algae are GLP2-expressing algae according to the invention; CTRL algae are control algae)
Mesalazine, an anti-inflammatory agent used in the treatment of inflammatory bowel disease (positive disease control) was administered orally by gastric gavage from three hours before the TNBS infusion and for the next three days (once daily in the morning, 4 total doses). Algae were administered orally by gavage from seven days before TNBS infusion and for the next three days (once daily in the morning, 10 total doses). Mice were sacrificed by CO asphyxiation2 in the afternoon 3 days after intrarectal administration of TNBS.
The following parameters were recorded during the study:
Clinical signs.
Daily body weight (for measuring weight loss).
The day of sacrifice:
Blood samples were collected and frozen from 3 mice of groups 1, 3, 5 and 6. the two points were explanted, measured in length with a slide caliper, immediately frozen inliquid nitrogen, and stored at -80°.
The following parameters were recorded ex vivo:
- length of the colon.
Dosages PBS: 1 mL/mouse TNBS: 100 pL in 50% ethanol/mouse solution. Mesalazine: 1 mL/mouse GLP2 and CTRL algae: 300pL and lOOpL/mouse (two doses for both types of algae)
Frequency of administration TNBS: only once at time 0 to induce colitis. Mesalazine: daily from three hours before TNBS infusion until the mice are sacrificed. GLP2 and CTRL algae: daily from seven days before TNBS infusion until mice are sacrificed.
Results
Impact on weight loss
To study the potential therapeutic action of derivatives extracted from artificial algae and the potential adverse effects due to administration of test compounds in a TNBS model of colitis, changes in body weight over time were monitored because weight loss in mice represents one of the parameters of disease severity.
As expected, mice that were instilled with TNBS (disease control) developed severe disease characterized by a body weight loss of about 14% from their initial body weight.
Prior to TNBS infusion, no changes in body weight and/or adverse effects were observed during prophylactic oral treatment with seaweed.
Among the two doses of GLP2 tested, a 100 pL dose showed a protective effect against TNBS- induced colitis, comparable to the positive control (Mesalazine-treated group), attenuating clinical symptoms and weight loss (Figure 1A).
Both groups treated with CTRL algae, in which no effect was expected, showed marked weight loss
as did the TNBS control disease group.
Impact on colon length
To assess the impact of artificial algae derivative treatments on the inflammatory response in the mouse model with colitis, at the end of the study, the length of the explanted colon was measured with a slide caliper. This parameter makes it possible to estimate the level of inflammation in the colon, since colitis could cause edema of the large intestine and a decrease in the length of the entire colon.
Figure 1(B) shows that, macroscopically, the colon is shorter in the groups of mice treated with TNBS and both doses of CTL alga, with a reduction of about 70% compared with the positive control group (Mesalazine).
These results are very encouraging; in fact, mice treated with GLP2 alga at both doses used, but especially at the 100-pL dose, showed markedly improved macroscopic signs, with a significant reduction in inflammatory activity and restoration of colonic length at the level of Mesalazine- treated group.
Impact on clinical manifestation scores
To assess the putative ability of the compounds under investigation to repair colon inflammation and damage by reducing its clinical manifestations in this model, indices of DAI, colon damage, and health-related quality of life in mice were monitored and evaluated over time.
The DAI score is a marker of disease activity and was determined based on the methods of Murano et al. (Murano M. et al. (2000): Therapeutic effect of intracolonically administered nuclear factor K B (p65) antisense oligonucleotide on mouse dextran sulphate sodium (DSS)-induced colitis. Clin
Exp Immunol 120, 51-58) and calculated as the sum of the weight loss score, diarrheal score, and hematochezia score.
The health quality of mice (health score) is a marker extrapolated from the human endpoint scoring system, according to which, based on predetermined physiological or behavioral signs, a score can be assigned to the health status of the animal enrolled in the experimental study.
Finally, the colon damage index scores colon features in TNBS-treated mice such as hyperemia, thickening and ulceration.
As shown in Figures 1(C), 1(D) and 1(E), the severity of colitis symptoms tended to worsen especially in CTL-treated mice, possibly due to a toxic effect with higher scores than mice in the TNBS-treated (disease control) group alone.
In contrast, an improvement in clinical manifestations of colitis, including phenotypic and behavioral
characters, reduction in weight loss and stool consistency, was observed in both groupsadministered with GLP2 alga especially at the lowest dose, which was able to bring these signs ofdisease back almost to the levels of the positive control group.
In addition, as shown in Figure 1(F) and Table 5, the mice that received GLP2 algae had a lower mortality rate (and thus higher survival) than both the control and Mesalazine groups.
Animal Model for Autism Spectrum (BTBR T+ Itpr3tf/J (BTBR)
In recent years, scientific research toward the study of metabolic and inflammatory disorders related to central neurological disorders has expanded greatly with strong evidence on thecorrelation of gut integrity and behavioral issues.
Autism (ASD) is a neuro-psychiatric disorder characterized primarily by substantial impairments in social interaction, difficulties in communication, and stereotyped and repetitive behaviors (9).
Several studies have reported the presence of altered gut microbiota and eating disorders in autism spectrum disorders in both humans and animal models (10, 11), hypothesizing a possible involvement of dysbiosis in worsening symptoms (11). In addition, a range of epidemiological evidence has shown a relationship between exposure to a fatty diet by pregnant women and the risk of developing neurological disorders in their offspring including autism (12).
Animal models currently used by the scientific community as a model of the autism spectrum include mice of the BTBR T+ Itpr3tf/J strain (BTBR; Meyza,K.Z., Blanchard, D.C., The BTBR mouse model of idiopathic autism. Current view on mechanisms. Neurosci. Biobehav. Rev. (2017)). In fact, presenting the 3 key symptoms (problems with socialization, communication, and repetitive behaviors), he summarizes the main biochemical, neuropathological, and behavioral features found in human pathology (13, 14). In addition, recent studies have shown that a nutritional approach can induce metabolic and behavioral changes in these mice. For example, when subjected to fatty diet from the time of weaning, such strain shows even more antisocial behavior and cognitive rigidity. This strain therefore constitutes an important investigative tool for the study of metabolic disorders
related to autism (15-17).
Examining oxidative metabolism, among the abnormalities in energy metabolism, a key role is played by mitochondria. Several studies in both patients and BTBR animal models have shown that mitochondrial dysfunction is a very common condition in autism (18, 19). However, it is stillunclear whether this dysfunction is a cause or effect of ASD.
Mitochondria, in addition to being the main cellular energy powerhouse (contributing to the production of about 90 percent of the energy used by our body), are known to synthesize key molecules during inflammatory and oxidative processes, serving as the main source of free radicals. Therefore, it is not surprising that mitochondrial dysfunction is associated with inflammation and other metabolic disorders in which cellular oxidative damage is caused by reactive oxygen species (ROS) production that exceeds physiological antioxidant activity (20). So, mitochondrial dysfunction can be both the cause and the consequence of inflammatory processes and cause metabolic adaptations that could be protective or become progressively harmful (21). The trial was conducted with 6 genetically modified male BTBR T+ Itpr3tf/J (BTBR) strain miceat the age of 3 months. The animals were fed a standard laboratory diet (15.88 kJ/g) for 3 weeks and were divided into two groups: the first group (control) received daily intragastric administration of vehicle (water), the second group (treated) received daily intragastric administration of Haematococcus spp- GLP2 extract of lOOpl/day for 2 weeks and 200pl/dayfor an additional 7 days (Haematococcus pluvialis was used for this experiment). Body weight and food intake were monitored daily. In addition, behavioraltests were performed by means of the "Marble burying test" and "self grooming." These tests consist of assessing repetitive/perversive behaviors such as number of marbles or enrichment material buried in the Marble burying Test or time spent cleaning and rubbing the body in self grooming. In self-grooming, animals are placed one per cage, and after 5 minutes of settling in, the time the animal spends in cleaning/scrubbing the various body parts is calculated for 10 minutes. In the marble burying test, on the other hand, mice are placed individually in a cage whose floor has been covered with a layer of sawdust. After an initial adaptation period, 20 marbles of 1cm diameter were placed on the sawdust at a regular distance from each other. Their behavior and the number of marbles hidden by the animals were evaluated. A marble was considered hidden ifit was two-thirds covered by the sawdust.
The administration of GLP2 algae caused no adverse effects to the animals, which showed no signsof distress with either dose. In addition, the results obtained showed that no changes in major metabolic parameters were observed following the 3 weeks of treatment regarding food intake and
body weight gain between the two experimental groups (Fig. G). Following behavioral investigations aimed at assessing the repetitive/perseverative behaviors characteristic of the BTBR phenotype, in the Marble burying Test, the alga-GLP2 -treated mice showed more disinterested behavior in burying the marbles (thus very positive effect), while regarding self grooming the differences between the two groups for the short period of treatment showed no statistically significant differences (Fig. H).
Discussion
The conceptual idea behind the invention is based on the use of microalgae as natural and green bioreactors, capable of producing and transporting molecules of interest. GLP-2, as described above, plays a key role in intestinal well-being, and microalgae represent optimal carriers. The platform aims to design edible microalgae to make naturally produced GLP-2 to be used directly as a carrier for gut delivery. The innovation of this technology lies in the combination of an already useful product for humanhealth (microalgae high in antioxidants) with a molecule of pharmaceutical interest (GLP-2 and/or GLP-2 peptide analogs).
The methodology used, exploits the possible ability of microalgae to incorporate exogenous DNA. Forthis purpose, a polynucleotide containing the GLP-2 coding sequence was synthesized and two linkers were joined at the terminal end, coding for a structural gene of the microalgae, to enable targeted insertion. No physical or biological vector was used. A novel methodology was applied and special conditions were optimized that allowed the microalgae to incorporate the synthetic polynucleotide. Once the GLP-2 was inserted, the microalgae were first selected on solid medium and at a later stage were inoculated into the specific liquid culture medium and allowed to grow following standard growth protocols.
At the end of the culture cycle (12-15 days), the biomass was harvested and processed to obtain the extract in accordance with what was described in the experimental part.
The TNBS-induced colitis model has proven very useful in understanding the pathophysiology of intestinal inflammation and is a powerful tool for evaluating interventions to prevent or amelioratethe disease.
The in vivo study carried out in the present invention aims to evaluate the protective and antiinflammatory effect of derivatives extracted from engineered algae in an experimental mouse model of TNBS-induced colonic inflammation. The hypothesis, based on suggestions from the literature, is that they might have a marked effect of reconstructing the intestinal epithelium, thus reducing the process of dysbiosis resulting in anti-inflammatory activity and improvement of the intestinal
microbiota. It also might be able to prevent oxidative damage by scavenging free radicals.
Overall, the experimental data obtained in the invention confirmed the high protective and antiinflammatory effects with improvement in clinical manifestations of colitis obtained by administering the GLP2 alga of the invention at both doses used, but especially at the lowest dose (lOOul) .
The in vivo model correlating with autism spectrum also confirmed that the tested product is not toxic in mice (that although genetically modified for the BTBR gene have a normal life span) and provided a clear evidence that the improvement of the epithelium quality results in less inflammation and, consequently, better quality of the microbiota. Through the gut-brais axis these effects have a positive impact on autistic behavior.
Bibliography
1. Janelle A. Jiminez, et al. (2015) Animal models to study acute and chronic intestinal inflammation in mammals. Gut Pathogens. Nov 10; 7:29.
2. dolsky DK et al. Pride and prejudice: inflammatory bowel disease models and drug development. Curr Opin Gastroenterol 2000; 16: 295-296
3. Elson CO et al. Experimental models of inflammatory bowel disease. Gastroenterology 1995; 109: 1344-1367.
4. Fiocchi C. Inflammatory bowel disease: etiology and pathogenesis. Gastroenterology 1998; 115: 182-205.
5. tz JA et al. Pathogenesis of inflammatory bowel disease. Curr Opin Gastroenterol 1999; 15: 291-297.
6. Tarcisio V. Brito et al. Sulfated-polysaccharide fraction extracted from red algae Gracilaria birdiae ameliorates trinitrobenzene sulfonic acid- induced colitis in rats. 2014; Journal of Pharmacy and Pharmacology, 66, pp. 1161-1170.
7. Yali Yang et al. (2016): Andrographolide derivative AL-1 ameliorates TNBS-induced colitis in mice: involvement of NF-KB and PPAR-y signaling pathways. Scientific rep 6:29716.
8. Murano M. et al. (2000): Therapeutic effect of intracolonically administered nuclear factor K B (p65) antisense oligonucleotide on mouse dextran sulphate sodium (DSS)-induced colitis. Clin Exp Immunol 120, 51-58.
9. Diagnostic and statistical manual of mental disorders : DSM-5. 5th ed. ed. Arlington, VA: American Psychiatric Association, 2013.
Sharp WG, Berry RC, McCracken C, Nuhu NN, Marvel E, Saulnier CA, Klin A, et al. Feeding problems and nutrient intake in children with autism spectrum disorders: a metaanalysis and comprehensive review of the literature. J Autism Dev Disord 2013;43:2159- 2173. Coretti L, Cristiano C, Florio E, Scala G, Lama A, Keller S, Cuomo M, et al. Sex-related alterations of gut microbiota composition in the BTBR mouse model of autism spectrum disorder. Sci Rep 2017;7:45356. Sullivan K, Stone WL, Dawson G. Potential neural mechanisms underlying the effectiveness of early intervention for children with autism spectrum disorder. Res Dev Disabil 2014;35:2921-2932. McFarlane HG, Kusek GK, Yang M, Phoenix JL, Bolivar VJ, Crawley JN. Autism-like behavioral phenotypes in BTBR T+tf/J mice. Genes Brain Behav 2008;7: 152-163. Silverman JL, Yang M, Lord C, Crawley JN. Behavioural phenotyping assays for mouse models of autism. Nat Rev Neurosci 2010;11:490-502. Shedlovsky A, McDonald JD, Symula D, Dove WF. Mouse models of human phenylketonuria. Genetics 1993;134: 1205-1210. Nadler ST, Stoehr JP, Schueler KL, Tanimoto G, Yandell BS, Attie AD. The expression of adipogenic genes is decreased in obesity and diabetes mellitus. Proc Natl Acad Sci U S A 2000;97:11371-11376. Gee SM, Nadler ST, Attie AD. Genetic and genomic studies of the BTBR ob/ob mouse model of type 2 diabetes. Am J Ther 2005;12:491-498. Frye RE, Rossignol DA. Mitochondrial dysfunction can connect the diverse medical symptoms associated with autism spectrum disorders. Pediatr Res 2011;69:41R-47R. Rossignol DA, Frye RE. Mitochondrial dysfunction in autism spectrum disorders: a systematic review and meta-analysis. Mol Psychiatry 2012;17:290-314. Chan DC. Mitochondria: dynamic organelles in disease, aging, and development. Cell 2006;125:1241-1252. Currais A, Goldberg J, Farrokhi C, Chang M, Prior M, Dargusch R, Daugherty D, et al. A comprehensive multiomics approach toward understanding the relationship between aging and dementia. Aging (Albany NY) 2015;7:937-955.
Claims
CLAIMS . A nucleic acid molecule comprising or consisting of: a. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or is complementary to any of SEQ ID No. 53-64; and b. at least one linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1-21; wherein the linker polynucleotide sequence is linked to the 5 'end and/or the 3' end of the coding polynucleotide sequence of a).
2. The nucleic acid molecule according to claim 1 comprising or consisting of: a. a coding polynucleotide sequence having at least 85% homology to SEQ ID No. 28 or is complementary to SEQ ID No. 28 or is complementary to SEQ ID No. 28 or having at least 85% homology to any of SEQ ID No. 53-64 or is complementary to any of SEQ ID No. 53-64; and b. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 5' end of the coding polynucleotide sequence of a); and c. a linker polynucleotide sequence with at least 85% homology to any of SEQ ID No 1- 21, linked to the 3' end of the coding polynucleotide sequence of a).
3. The nucleic acid molecule according to any one of claims 1 or 2 having at least 85% homology to any of SEQ ID No 29-42 or having at least 85% homology to any of SEQ ID No 65-76.
4. A host cell comprising the nucleic acid molecule according to any one of claims 1 to 3, where said host cell is an algal cell.
5. The host cell according to claim 4 wherein said host cell belongs to the class of Chlorophyceae and/or wherein said host cell belongs to the class of Trebouxiophyceae.
6. The host cell according to claim 5 wherein said host cell belongs to the species Haematococcus spp. and/or Chlorella spp..
7. The host cell according to claim 6 wherein said host cell belongs to Haematococcus pluvialis and/or Chlorella vulgaris.
8. The host cell according to any one of claims 4-7 for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of irritable
bowel disorders, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals. The host cell according to claim 8 for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders. A GLP2 expressing algal biomass comprising at least one host cell according to any of claims 4- 7 and/or a lysate and/or an extract of said host cell. The GLP2 expressing algal biomass according to claim 10 wherein said biomass comprises the GLP2 peptide of SEQ ID No. 43 and/or GLP2 peptide analogs comprising SEQ ID No 43 or wherein said biomass comprises the GLP2 peptides of SEQ ID No. 44-52 and/or analogs comprising SEQ ID No. 44-52. A method for obtaining the GLP2 expressing algal biomass according to any of claims 10 and 11 comprising the following steps: a. induce thermal stress in a culture of microalgae by heating at a temperature between 35° and 50° C for a time between 300 and 600 seconds; b. expose the microalgae culture to UV rays (UV-A, UV-B and UV-C) for one or more time intervals between 5 and 15 min; c. inoculate the culture treated in step b in fresh liquid medium; d. suspend the microalgae culture from step c) in a solution composed of 16-50% (v / v) of 0.35 M mannitol and 0.2-0.6% of a mixture of lytic enzymes comprising at least one of the following enzymes: cellulase, cellulase CP, hemicellulose, chitinase, 0-D- glucanase, macerozyme, helicase, driselasi, lytic enzyme L, pectinase, protease, xylanase, cutinase, P-D-glucuronidanase, cellobiohydrolase, mixtures of them; e. incubate the microalgae culture treated in step d) at a temperature between 30 - 40° C for 4-8 h; f. combine the culture incubated from step e) in culture medium with 0.1 - 0.5% of a solution comprising the isolated nucleic acid according to any one of claims 1-3, in the presence of 10-35 % polyethylene glycol (PEG-X).
13. The method according to claim 12 wherein the microalgae belong to the Chlorophyceae class and or to the Trebouxiophyceae.
14. The method according to any of claims 12-13 wherein the microalgae belong to the Haematococcus spp. and/or Chlorella spp..
15. The method according to claim 14 wherein the microalgae belong to the Hematococcus pluvialis species and/or Chlorella vulgaris.
16. The GLP-2 expressing algal biomass according to any of claims 10 and 11 or obtainable by the method according to any one of claims 12 -15 for use in the treatment and/or prevention of intestinal dysbiosis, chronic inflammatory bowel disease (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders deriving from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals.
17. The GLP-2 expressing algal biomass according to claim 16 for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
18. A pharmaceutical composition comprising the host cell according to any one of claims 4-9 or the biomass according to any one of claims 10-11 or the biomass obtainable from the method according to any one of claims 12 - 14 and at least one pharmacologically acceptable excipient.
19. The pharmaceutical composition according to claim 18 for use in the treatment and/or prevention of intestinal dysbiosis and inflammatory bowel disease (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota in human or veterinary animals.
20. The pharmaceutical composition according to claim 19 for use in the treatment and/or prevention of inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
21. Supplement or food product or drinking product comprising the host cell according to any one of claims 4 -9 or the biomass according to any one of claims 10-11 or the biomass obtainable from the method according to any one of claims 12 - 14.
Non-therapeutic use of the biomass according to any one of claims 10-11 or the biomass obtainable from the method according to any one of claims 12 - 14 or of the supplement or food product or product to drink according to claim 21 in the nutraceutical sector or as a basic ingredient in preparations of supplementsand/or as an agent for the prevention and/or treatment of intestinal dysbiosis, chronic inflammatory bowel diseases (IBD), for the treatment of disorders deriving from irritable bowel, for the containment of the progression of osteoporosis, for the improvement of disorders resulting from bone resorption, to strengthen and improve the intestinal microbiota, inflammatory bowel syndrome, Crohn's disease and ulcerative colitis and/or intestinal dysbiosis due to eating disorders and autism spectrum disorders.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
IT202200015204 | 2022-07-20 | ||
IT102022000015204 | 2022-07-20 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024018037A1 true WO2024018037A1 (en) | 2024-01-25 |
Family
ID=84369669
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2023/070232 WO2024018037A1 (en) | 2022-07-20 | 2023-07-20 | Microalgae expressing glp-2 and uses thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024018037A1 (en) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20060162020A1 (en) * | 2003-08-18 | 2006-07-20 | Sungene Gmbh | Promoters for the expression of genes in tagetes |
WO2008058948A1 (en) * | 2006-11-14 | 2008-05-22 | Basf Plant Science Gmbh | Plastid-lipid-associated protein promoters for the production of keto-carotenoids in tagetes |
WO2013040093A2 (en) * | 2011-09-12 | 2013-03-21 | Amunix Operating Inc. | Glucagon-like peptide-2 compositions and methods of making and using same |
WO2018104558A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
WO2022072636A1 (en) * | 2020-09-30 | 2022-04-07 | Synlogic Operating Company, Inc. | Bacteria engineered to secrete active proteins |
-
2023
- 2023-07-20 WO PCT/EP2023/070232 patent/WO2024018037A1/en unknown
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20060162020A1 (en) * | 2003-08-18 | 2006-07-20 | Sungene Gmbh | Promoters for the expression of genes in tagetes |
WO2008058948A1 (en) * | 2006-11-14 | 2008-05-22 | Basf Plant Science Gmbh | Plastid-lipid-associated protein promoters for the production of keto-carotenoids in tagetes |
WO2013040093A2 (en) * | 2011-09-12 | 2013-03-21 | Amunix Operating Inc. | Glucagon-like peptide-2 compositions and methods of making and using same |
WO2018104558A1 (en) * | 2016-12-09 | 2018-06-14 | Zealand Pharma A/S | Acylated glp-1/glp-2 dual agonists |
WO2022072636A1 (en) * | 2020-09-30 | 2022-04-07 | Synlogic Operating Company, Inc. | Bacteria engineered to secrete active proteins |
Non-Patent Citations (25)
Title |
---|
CHAN DC: "Mitochondria: dynamic organelles in disease, aging, and development", CELL, vol. 125, 2006, pages 1241 - 1252 |
CLEE SMNADLER STATTIE AD: "Genetic and genomic studies of the BTBR ob/ob mouse model of type 2 diabetes", AM J THER, vol. 12, 2005, pages 491 - 498 |
CORETTI L, CRISTIANO C, FLORIO E, SCALA G, LAMA A, KELLER S, CUOMO M: "Sex-related alterations of gut microbiota composition in the BTBR mouse model of autism spectrum disorder", SCI REP, vol. 7, 2017, pages 45356 |
CURRAIS AGOLDBERG JFARROKHI CCHANG MPRIOR MDARGUSCH RDAUGHERTY D ET AL.: "A comprehensive multiomics approach toward understanding the relationship between aging and dementia", AGING (ALBANY NY, vol. 7, 2015, pages 937 - 955 |
DOLSKY DK ET AL.: "Pride and prejudice: inflammatory bowel disease models and drug development", CURR OPIN GASTROENTEROL, vol. 16, 2000, pages 295 - 296 |
ELSON CO ET AL.: "Experimental models of inflammatory bowel disease", GASTROENTEROLOGY, vol. 109, 1995, pages 1344 - 1367 |
FIOCCHI C: "Inflammatory bowel disease: etiology and pathogenesis", GASTROENTEROLOGY, vol. 115, 1998, pages 182 - 205, XP005138997, DOI: 10.1016/S0016-5085(98)70381-6 |
FRYE REROSSIGNOL DA: "Mitochondrial dysfunction can connect the diverse medical symptoms associated with autism spectrum disorders", PEDIATR RES, vol. 69, 2011, pages 41R - 47R, XP055758613, DOI: 10.1203/PDR.0b013e318212f16b |
H. CERUTTIA.M. J.N. W. GILLHAMJ.E. BOYNTON: "Epigenetic silencing of a foreign gene in nuclear transformants of Chlamydomonas", THE PLANT CELL, vol. 9, 1997, pages 925 - 945 |
JANELLE A. JIMINEZ: "Animal models to study acute and chronic intestinal inflammation in mammals", GUT PATHOGENS, vol. 7, 10 November 2015 (2015-11-10), pages 29 |
JULIE LOVSHINDANIEL J. DRUCKER, ENCYCLOPEDIA OF ENDOCRINE DISEASES, 2004 |
MCFARLANE HGKUSEK GKYANG MPHOENIX JLBOLIVAR VJCRAWLEY JN: "Autism-like behavioral phenotypes in BTBR T+tf/J mice", GENES BRAIN BEHAV, vol. 7, 2008, pages 152 - 163 |
MEYZA,K.Z.BLANCHARD, D.C.: "The BTBR mouse model of idiopathic autism. Current view on mechanisms", NEUROSCI. BIOBEHAV. REV., 2017 |
MORRIS G.P.BECK P.L.HERRIDGE M.S.DEPEW W.T.SZEWCZUK M.R.WALLACE J.L.: "Hapten-induced model of chronic inflammation and ulceration in the rat colon", GASTROENTEROLOGY, vol. 96, no. 3, 1989, pages 795 - 803, XP009537060, DOI: 10.1016/0016-5085(89)90904-9 |
MURANO M ET AL.: "Therapeutic effect of intracolonically administered nuclear factor B (p65) antisense oligonucleotide on mouse dextran sulphate sodium (DSS)-induced colitis", CLIN EXP IMMUNOL, vol. 120, 2000, pages 51 - 58, XP000982359, DOI: 10.1046/j.1365-2249.2000.01183.x |
NADLER STSTOEHR JPSCHUELER KLTANIMOTO GYANDELL BSATTIE AD: "The expression of adipogenic genes is decreased in obesity and diabetes mellitus", PROC NATL ACAD SCI U S A, vol. 97, 2000, pages 11371 - 11376, XP002223701, DOI: 10.1073/pnas.97.21.11371 |
ROSSIGNOL DAFRYE RE: "Mitochondrial dysfunction in autism spectrum disorders: a systematic review and meta-analysis", MOL PSYCHIATRY, vol. 17, 2012, pages 290 - 314 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001 |
SHARP WGBERRY RCMCCRACKEN CNUHU NNMARVEL ESAULNIER CAKLIN A ET AL.: "Feeding problems and nutrient intake in children with autism spectrum disorders: a meta-analysis and comprehensive review of the literature", J AUTISM DEV DISORD, vol. 43, 2013, pages 2159 - 2173 |
SHEDLOVSKY AMCDONALD JDSYMULA DDOVE WF: "Mouse models of human phenylketonuria", GENETICS, vol. 134, 1993, pages 1205 - 1210 |
SILVERMAN JLYANG MLORD CCRAWLEY JN: "Behavioural phenotyping assays for mouse models of autism", NAT REV NEUROSCI, vol. 11, 2010, pages 490 - 502 |
SULLIVAN KSTONE WLDAWSON G: "Potential neural mechanisms underlying the effectiveness of early intervention for children with autism spectrum disorder", RES DEV, vol. 35, 2014, pages 2921 - 2932 |
TARCISIO V. BRITO ET AL.: "Sulfated-polysaccharide fraction extracted from red algae Gracilaria birdiae ameliorates trinitrobenzene sulfonic acid-induced colitis in rats", JOURNAL OF PHARMACY AND PHARMACOLOGY, vol. 66, 2014, pages 1161 - 1170 |
TZ JA ET AL.: "Pathogenesis of inflammatory bowel disease", CURR OPIN GASTROENTEROL, vol. 15, 1999, pages 291 - 297 |
YALI YANG ET AL.: "Andrographolide derivative AL-1 ameliorates TNBS-induced colitis in mice: involvement of NF- B and PPAR-γ signaling pathways", SCIENTIFIC REP, vol. 6, 2016, pages 29716 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102117567B1 (en) | Nanovesicles derived from Cupriavidus bacteria and Use thereof | |
JP7018396B2 (en) | Ficalibacterium prausnitzi and dessulfovibriopigel for use in the treatment or prevention of diabetes and enteropathy | |
KR102128287B1 (en) | NEW Akkermansia muciniphila EB-AMDK19 strain AND uses thereof | |
EP3612198A1 (en) | Engineered commensal bacteria and methods of use | |
US10912794B2 (en) | Use of beta-1,3-glucan for modulating immune function and treating intestinal inflammation | |
KR102128289B1 (en) | NEW Akkermansia muciniphila EB-AMDK27 strain AND uses thereof | |
KR101746635B1 (en) | Composition for metabolic diseases comprising Bacteroides acidifaciens | |
ES2899185T3 (en) | Probiotic strains that have cholesterol absorption capacity, procedures and uses thereof | |
KR102169794B1 (en) | Novel Faecalibacterium prausnitzii EB-FPDK11 and Use Thereof | |
JP2022506748A (en) | Microbial composition containing ellagitannin and how to use | |
Chang et al. | Effects of mesobiliverdin IXα-enriched microalgae feed on gut health and microbiota of broilers | |
KR102309911B1 (en) | Discovery of novel Akkermansia muciniphila AK32 strain and application for preventing or treating intestinal injury | |
WO2024018037A1 (en) | Microalgae expressing glp-2 and uses thereof | |
CN114989258B (en) | Application of plant extract composition in preparing product for treating constipation and reducing weight | |
CN114369146B (en) | Acremonium Amuc-2172 protein and preparation method and application thereof | |
CN114699424B (en) | New application of bacteroides fragilis zwitterionic capsular polysaccharide and/or modified zwitterionic capsular polysaccharide | |
KR102169795B1 (en) | Novel Faecalibacterium prausnitzii EB-FPDK9 and Use Thereof | |
CN111448306A (en) | Anaerobic clavulanate (Anaerofuss stercoris) and application thereof | |
WO2004093877A1 (en) | Vitamin comprising pyroloquinoline quinone and use thereof | |
Chai et al. | The mitigative effect of ovotransferrin-derived peptide IQW on DSS-induced colitis via alleviating intestinal injury and reprogramming intestinal microbes | |
CN111481565A (en) | Use of lipopolysaccharide of paradisella gordonii for pharmaceutical composition for inhibiting inflammatory reaction | |
CN117965391B (en) | Acremonium muciniphilum Amuci-1 and application thereof | |
TWI810852B (en) | Use of Bacillus coagulans BC198 or its metabolites for the prevention or adjuvant treatment of intestinal damage-related lesions or flora imbalance caused by chemotherapy | |
JP7013052B2 (en) | Nanovesicles derived from enhydrobacter bacteria and their uses | |
WO2022108392A1 (en) | Theragnostic composition for scleroderma, containing bifidobacterium sp. as active ingredient |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23744804 Country of ref document: EP Kind code of ref document: A1 |