WO2023282654A1 - Composition for predicting severity of disease mediated by il-23 - Google Patents
Composition for predicting severity of disease mediated by il-23 Download PDFInfo
- Publication number
- WO2023282654A1 WO2023282654A1 PCT/KR2022/009830 KR2022009830W WO2023282654A1 WO 2023282654 A1 WO2023282654 A1 WO 2023282654A1 KR 2022009830 W KR2022009830 W KR 2022009830W WO 2023282654 A1 WO2023282654 A1 WO 2023282654A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antigen
- composition
- disease
- present
- asthma
- Prior art date
Links
- 201000010099 disease Diseases 0.000 title claims abstract description 61
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims abstract description 61
- 230000001404 mediated effect Effects 0.000 title claims abstract description 41
- 239000000203 mixture Substances 0.000 title claims abstract description 32
- 108010065637 Interleukin-23 Proteins 0.000 claims abstract description 58
- 238000000034 method Methods 0.000 claims abstract description 43
- 210000001616 monocyte Anatomy 0.000 claims abstract description 41
- 108090000623 proteins and genes Proteins 0.000 claims description 56
- 208000006673 asthma Diseases 0.000 claims description 35
- 102000004169 proteins and genes Human genes 0.000 claims description 32
- 239000000427 antigen Substances 0.000 claims description 26
- 108091007433 antigens Proteins 0.000 claims description 26
- 102000036639 antigens Human genes 0.000 claims description 26
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 17
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 17
- 108010017009 CD11b Antigen Proteins 0.000 claims description 16
- 102000004354 CD11b Antigen Human genes 0.000 claims description 16
- 108010011491 CD11c Antigen Proteins 0.000 claims description 16
- 108010080422 CD39 antigen Proteins 0.000 claims description 15
- 208000011231 Crohn disease Diseases 0.000 claims description 15
- 108010077673 Tetraspanin 29 Proteins 0.000 claims description 15
- 102000010431 Tetraspanin 29 Human genes 0.000 claims description 15
- 239000000523 sample Substances 0.000 claims description 15
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 14
- 239000003795 chemical substances by application Substances 0.000 claims description 14
- 108091093037 Peptide nucleic acid Proteins 0.000 claims description 11
- 238000004458 analytical method Methods 0.000 claims description 9
- 238000006243 chemical reaction Methods 0.000 claims description 9
- 201000009890 sinusitis Diseases 0.000 claims description 9
- 238000002659 cell therapy Methods 0.000 claims description 8
- 201000004681 Psoriasis Diseases 0.000 claims description 7
- 238000002965 ELISA Methods 0.000 claims description 6
- 230000000692 anti-sense effect Effects 0.000 claims description 6
- 230000000295 complement effect Effects 0.000 claims description 6
- 201000006417 multiple sclerosis Diseases 0.000 claims description 6
- 239000002773 nucleotide Substances 0.000 claims description 6
- 125000003729 nucleotide group Chemical group 0.000 claims description 6
- 238000010839 reverse transcription Methods 0.000 claims description 6
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 6
- 206010002556 Ankylosing Spondylitis Diseases 0.000 claims description 5
- 238000003556 assay Methods 0.000 claims description 5
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 claims description 5
- 108091023037 Aptamer Proteins 0.000 claims description 4
- 238000000018 DNA microarray Methods 0.000 claims description 4
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 claims description 4
- 238000000684 flow cytometry Methods 0.000 claims description 3
- 238000012744 immunostaining Methods 0.000 claims description 3
- 238000004949 mass spectrometry Methods 0.000 claims description 3
- 238000003757 reverse transcription PCR Methods 0.000 claims description 3
- 108010038807 Oligopeptides Proteins 0.000 claims description 2
- 102000015636 Oligopeptides Human genes 0.000 claims description 2
- 239000004480 active ingredient Substances 0.000 claims description 2
- 238000003795 desorption Methods 0.000 claims description 2
- 238000003018 immunoassay Methods 0.000 claims description 2
- 230000000951 immunodiffusion Effects 0.000 claims description 2
- 238000000760 immunoelectrophoresis Methods 0.000 claims description 2
- 239000003446 ligand Substances 0.000 claims description 2
- 238000000670 ligand binding assay Methods 0.000 claims description 2
- 239000007788 liquid Substances 0.000 claims description 2
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 claims description 2
- 238000003127 radioimmunoassay Methods 0.000 claims description 2
- 238000001269 time-of-flight mass spectrometry Methods 0.000 claims description 2
- 238000001262 western blot Methods 0.000 claims description 2
- 238000000636 Northern blotting Methods 0.000 claims 2
- 102000006382 Ribonucleases Human genes 0.000 claims 2
- 108010083644 Ribonucleases Proteins 0.000 claims 2
- 230000002860 competitive effect Effects 0.000 claims 2
- 238000007823 electrophoretic assay Methods 0.000 claims 1
- 238000003753 real-time PCR Methods 0.000 claims 1
- 230000001225 therapeutic effect Effects 0.000 abstract description 4
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 abstract 2
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 abstract 2
- 102100036705 Interleukin-23 subunit alpha Human genes 0.000 description 51
- 210000004027 cell Anatomy 0.000 description 45
- 108010058846 Ovalbumin Proteins 0.000 description 25
- 229940092253 ovalbumin Drugs 0.000 description 25
- 238000002474 experimental method Methods 0.000 description 23
- 210000000440 neutrophil Anatomy 0.000 description 21
- 101710158214 Lymphocyte antigen 6G Proteins 0.000 description 19
- 239000008194 pharmaceutical composition Substances 0.000 description 12
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 11
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- 108020004414 DNA Proteins 0.000 description 10
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 9
- 102100022338 Integrin alpha-M Human genes 0.000 description 9
- 102000013691 Interleukin-17 Human genes 0.000 description 9
- 108050003558 Interleukin-17 Proteins 0.000 description 9
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 9
- MULKOGJHUZTANI-ADMBKAPUSA-N [(3s,4r)-3-amino-4-hydroxypiperidin-1-yl]-[2-[1-(cyclopropylmethyl)indol-2-yl]-7-methoxy-1-methylbenzimidazol-5-yl]methanone;hydrochloride Chemical compound Cl.CN1C=2C(OC)=CC(C(=O)N3C[C@H](N)[C@H](O)CC3)=CC=2N=C1C1=CC2=CC=CC=C2N1CC1CC1 MULKOGJHUZTANI-ADMBKAPUSA-N 0.000 description 9
- 210000002865 immune cell Anatomy 0.000 description 9
- 210000001519 tissue Anatomy 0.000 description 9
- 238000010172 mouse model Methods 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 101100276036 Arabidopsis thaliana CTL1 gene Proteins 0.000 description 7
- 102000004127 Cytokines Human genes 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 7
- 101100408822 Schizosaccharomyces pombe (strain 972 / ATCC 24843) pom1 gene Proteins 0.000 description 7
- 206010070834 Sensitisation Diseases 0.000 description 7
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 230000003247 decreasing effect Effects 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 210000004072 lung Anatomy 0.000 description 7
- 150000007523 nucleic acids Chemical group 0.000 description 7
- 230000008313 sensitization Effects 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 206010061218 Inflammation Diseases 0.000 description 6
- 230000004069 differentiation Effects 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 230000004054 inflammatory process Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 238000008157 ELISA kit Methods 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 102100037850 Interferon gamma Human genes 0.000 description 5
- 108010074328 Interferon-gamma Proteins 0.000 description 5
- 102100030703 Interleukin-22 Human genes 0.000 description 5
- 102100036672 Interleukin-23 receptor Human genes 0.000 description 5
- 101710195550 Interleukin-23 receptor Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 108010074109 interleukin-22 Proteins 0.000 description 5
- 210000004877 mucosa Anatomy 0.000 description 5
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 4
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 208000037883 airway inflammation Diseases 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 230000000112 colonic effect Effects 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000003472 neutralizing effect Effects 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 230000002085 persistent effect Effects 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 238000009007 Diagnostic Kit Methods 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 201000009961 allergic asthma Diseases 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 210000004443 dendritic cell Anatomy 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 210000003979 eosinophil Anatomy 0.000 description 3
- 230000002327 eosinophilic effect Effects 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 3
- 230000008595 infiltration Effects 0.000 description 3
- 238000001764 infiltration Methods 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 230000001629 suppression Effects 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 108010076561 Interleukin-23 Subunit p19 Proteins 0.000 description 2
- 108010079855 Peptide Aptamers Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- 229960003957 dexamethasone Drugs 0.000 description 2
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 210000004969 inflammatory cell Anatomy 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 210000004964 innate lymphoid cell Anatomy 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- NZWOPGCLSHLLPA-UHFFFAOYSA-N methacholine Chemical compound C[N+](C)(C)CC(C)OC(C)=O NZWOPGCLSHLLPA-UHFFFAOYSA-N 0.000 description 2
- 229960002329 methacholine Drugs 0.000 description 2
- 210000004400 mucous membrane Anatomy 0.000 description 2
- 238000002552 multiple reaction monitoring Methods 0.000 description 2
- 230000003448 neutrophilic effect Effects 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 208000023504 respiratory system disease Diseases 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 239000013076 target substance Substances 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- PIINGYXNCHTJTF-UHFFFAOYSA-N 2-(2-azaniumylethylamino)acetate Chemical group NCCNCC(O)=O PIINGYXNCHTJTF-UHFFFAOYSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 206010009137 Chronic sinusitis Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 208000003606 Congenital Rubella Syndrome Diseases 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 108091027305 Heteroduplex Proteins 0.000 description 1
- 102100033636 Histone H3.2 Human genes 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- CTQNGGLPUBDAKN-UHFFFAOYSA-N O-Xylene Chemical compound CC1=CC=CC=C1C CTQNGGLPUBDAKN-UHFFFAOYSA-N 0.000 description 1
- 108010042215 OX40 Ligand Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 241000219061 Rheum Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 208000037114 Symptom Flare Up Diseases 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000009798 acute exacerbation Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 239000000981 basic dye Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 235000013361 beverage Nutrition 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 230000005309 bone marrow development Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 208000029771 childhood onset asthma Diseases 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 208000027157 chronic rhinosinusitis Diseases 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000000942 confocal micrograph Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 230000009260 cross reactivity Effects 0.000 description 1
- 206010052015 cytokine release syndrome Diseases 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 101150047356 dec-1 gene Proteins 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 210000003595 dermal dendritic cell Anatomy 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 210000005175 epidermal keratinocyte Anatomy 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 230000005713 exacerbation Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000008098 formaldehyde solution Substances 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 230000003434 inspiratory effect Effects 0.000 description 1
- 230000003704 interleukin-23 production Effects 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000004199 lung function Effects 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000003147 molecular marker Substances 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 210000000633 nuclear envelope Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002177 osteoclastogenic effect Effects 0.000 description 1
- 229940124641 pain reliever Drugs 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- RHDXSLLGPJSSGW-VEGRVEBRSA-N phosphoric acid;(2r,3r,4r)-2,3,4,5-tetrahydroxypentanal Chemical group OP(O)(O)=O.OC[C@@H](O)[C@@H](O)[C@@H](O)C=O RHDXSLLGPJSSGW-VEGRVEBRSA-N 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 238000000575 proteomic method Methods 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 230000019254 respiratory burst Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 229950007943 risankizumab Drugs 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000012086 standard solution Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 238000011816 wild-type C57Bl6 mouse Methods 0.000 description 1
- 239000008096 xylene Substances 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4614—Monocytes; Macrophages
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
- A61K39/4622—Antigen presenting cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464429—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/12—Pulmonary diseases
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
Definitions
- the present invention relates to methods of providing information about the severity of diseases mediated by IL-23.
- Asthma refers to a chronic inflammatory disease of the airways with various endotypes and excessive morbidity.
- asthmatic airway inflammation There are several types of asthmatic airway inflammation that can be associated with TH2 cell-mediated eosinophilic, TH17 cell-mediated neutrophilic, or even agranulocyte inflammation.
- eosinophils are important inflammatory cells present in the asthmatic lung, these eosinophils do not explain the medical symptoms of eosinophilic airway inflammation, especially in patients with increased neutrophil cells in the lung lumen during acute exacerbations.
- Recently, a high correlation between asthma severity and exacerbation, steroid treatment response, and pulmonary neutrophil inflammation has been reported.
- neutrophilic airway inflammation Unlike eosinophilic airway inflammation, neutrophilic airway inflammation often does not respond to inhaled or systemic corticosteroids, is less drug responsive, and may recur. Thus, there has been a significant demand for an enhanced therapeutic approach, but development of a specific treatment for neutrophil-dominant asthma, that is, neutrophil-dominant asthma, has been difficult due to lack of evidence on the underlying mechanism.
- bone marrow cells including macrophages and dendritic cells, play an antigen-presenting role in the immune response, and in the case of asthma, instruct naive CD4+ T cells to differentiate into effector TH2 and TH17 cells, and develop resistance to inhaled antigens. to control
- TH17 differentiation is induced by low antigen dose and expression of OX40 ligand, and becomes jagged by antigen-presenting cells in a cytokine environment in which high levels of IL-4, IL-5 and IL-13 are present .
- TH17 differentiation occurs when the expression of CD40 and CD86 and the expression of pro-inflammatory cytokines including IL-6, IL-1 beta and IL-24 and TGF-beta (transforming growth factor-beta) are high. It is advantageous.
- IL-23 induces infiltration of neutrophils into the airways, activates TH17 cells, and induces severe asthma through secretion of IL-17.
- IL-23 In pediatric asthma, the serum level of IL-23 is inversely proportional to the forced expiratory volume in FEV1 (Forced Expiratory Volume in One second) value, so IL-23 can be used as an auxiliary biomarker when assessing the severity of asthma.
- FEV1 Forced Expiratory Volume in One second
- One object of the present invention is to provide a composition for predicting the severity of a disease mediated by IL-23.
- Another object of the present invention is to provide a method for providing information for predicting the severity of a disease mediated by IL-23.
- Another object of the present invention is to provide a cell therapy composition for preventing or treating IL-23 mediated diseases.
- One embodiment of the present invention provides a composition for predicting the severity of a disease mediated by IL-23.
- composition of the present invention comprises any one protein selected from the group consisting of monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen and CD11c antigen; or an agent capable of measuring the expression level of a gene encoding the same.
- the “Cluster of Differentiation 39 (CD39) antigen” of the present invention is a surface-expressed enzyme that hydrolyzes extracellular ATP (eATP), a pro-inflammatory metabolite present in high concentration in the tumor gap.
- the CD39 antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto.
- the “Cluster of Differentiation 9 (CD9) antigen” of the present invention is a molecular marker of immune cells, and the CD9 antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 2, but is not limited thereto.
- the “Lymphocyte antigen 6G (Ly6G) antigen” of the present invention is a 21-25 kD glycosyl phosphatidylinositol (GPI)-linked differentiation antigen expressed by bone marrow-derived cells. Ly6G can be transiently expressed in monocytes during bone marrow development, and Ly6G expression in granulocytes and peripheral neutrophils is directly related to the level of differentiation and maturation of the cells.
- the Ly6G antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 3, but is not limited thereto.
- the "CD11b antigen" of the present invention is involved in various adhesions between cells such as monocytes, macrophages, NK cells and granulocytes.
- the CD11b antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 4, but is not limited thereto.
- the "CD11c antigen” of the present invention is a type 1 transmembrane protein in monocytes, macrophages, neutrophils and B cells, which activates cells and causes neutrophil respiratory burst.
- the CD11c antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 5, but is not limited thereto.
- the monocytes may have CD39 antigen, CD9 antigen, and CD11b antigen expressed on the surface of monocytes, and/or the monocytes may not express Ly6G antigen and CD11c antigen on the surface of monocytes. It may be, but is not limited thereto.
- the monocytes when the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes present in the sample of interest is reduced compared to the normal control group, NETosis, a neutrophil extracellular trap, is not effectively inhibited, thereby reducing the severity of the disease. can indicate Therefore, by measuring the expression levels of the proteins of the antigens or genes encoding them, it can be predicted that the severity of the disease can be expressed when the expression level is changed compared to a normal control group, but is not limited thereto.
- the “disease mediated by IL-23” of the present invention refers to a disease caused by IL-23 or in which IL-23 may be involved in the progression of the disease, and is mediated by IL-23.
- Possible diseases include respiratory diseases; multiple sclerosis; rheumatoid arthritis; psoriasis; inflammatory bowel disease; And it may be any one selected from the group consisting of ankylosing spondylitis, but is not limited thereto.
- the respiratory disease of the present invention may be asthma or sinusitis, but is not limited thereto.
- the asthma of the present invention may be neutrophil-dominant asthma, but is not limited thereto.
- the “neutrophil-dominant asthma” of the present invention may be one in which the number of neutrophils in the lung tissue is significantly increased compared to eosinophils compared to mild asthma, the symptoms of which can be alleviated by general treatment methods, As not limited thereto, various terms such as refractory allergic asthma, steroid-dependent allergic asthma, and treatment-refractory allergic asthma may be referred to.
- the "severity" of the present invention may include the degree of increase or decrease in the risk of developing a disease, the degree of progression of a disease, and the degree of increase or decrease in the risk of recurrence.
- the degree of increase or decrease in the risk of developing the disease is meant to include the degree of risk of developing the disease or the possibility of developing the disease.
- the degree of progression of the lesion means that the disease has developed and the lesion has progressed to include a mild to severe degree of the disease.
- the degree of increase or decrease in the risk of recurrence means the degree to which there is a risk of recurrence or a possibility of recurrence after the disease is determined to be cured.
- the severity of the disease may be expressed qualitatively and/or quantitatively, and the severity may be classified according to the degree.
- the "asthma severity" can be classified through the patient's symptoms and lung function indicators, and can be classified into mild intermittent, mild persistent, moderate persistent, and severe persistent.
- moderate persistence it means that there are asthma symptoms every day, symptom exacerbations are 2 weeks a week, the FEV is 60-80%, and the PEFR diurnal variation is ⁇ 30%.
- severe persistence it means that there are persistent asthma symptoms, activity limitation and frequent worsening of symptoms, FEV is ⁇ 60%, and PEFR diurnal variation is ⁇ 30%.
- Multiple sclerosis which is a disease mediated by IL-23 of the present invention, is a Th1 type T cell-mediated autoimmune disease, and IL-23 affects the immune system in a way that polarizes the innate immune response against Th1 bias, thereby preventing multiple sclerosis.
- IL-23 composed of p19 and p40 subunits interacts with the IL-23 receptor complex to induce excessive biochemical actions, mainly IL-23. 17 and TH17 cells to exert an osteoclastogenic effect, allowing rheumatoid arthritis to be exerted (Immunopharmacol Immunotoxicol. 2019 Apr;41(2):185-191.).
- IL-23 which is mainly secreted from dendritic cells in the inflammatory skin, increases the number of cells that secrete IL-17, and produces a large amount of IL-17, resulting in upregulation of psoriasis-related genes produced by epidermal keratinocytes, leading to psoriasis.
- Inflammatory bowel disease which is a disease mediated by IL-23 of the present invention, can contribute to the onset and maintenance of IL-23 through a process in which inflammation is generated in the intestine through the Th-17 pathway (Science 2006 Dec 1;314 (5804):1461-3).
- Ankylosing spondylitis a disease mediated by IL-23 of the present invention, has been proven to be associated with an increased risk of IL-23 receptor (IL-23R) polymorphism, and IL-23 receptor (IL-23R) polymorphism is associated with an increased risk of IL-23 in the joints of patients with such a disease. It was confirmed that the number of cells producing -23 was increased (Ann Rheum Dis. 2019 Aug;78(8):1015-1018).
- the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes may be reduced compared to a normal control group, but is not limited thereto.
- An agent capable of measuring the expression level of the protein of the present invention may be at least one selected from the group consisting of primers, probes, and antisense nucleotides that complementarily bind to the gene, but is not limited thereto.
- the agent capable of measuring the expression level of the protein of the present invention is not limited as long as it can specifically bind to the protein and measure the expression level of the protein.
- the agent capable of measuring the expression level of the protein is at least selected from the group consisting of an antibody, an oligopeptide, a ligand, a peptide nucleic acid (PNA), and an aptamer that binds specifically to the protein. It may be one.
- antibody of the present invention refers to a substance that specifically binds to an antigen and causes an antigen-antibody reaction.
- antibody means an antibody that specifically binds to said protein.
- Antibodies of the present invention include both polyclonal antibodies, monoclonal antibodies and recombinant antibodies. Such antibodies can be readily prepared using techniques well known in the art. For example, polyclonal antibodies can be produced by a method well known in the art, including a process of injecting an antigen of the protein into an animal and collecting blood from the animal to obtain serum containing the antibody. Such polyclonal antibodies can be prepared from any animal, such as goat, rabbit, sheep, monkey, horse, pig, cow, dog, and the like.
- monoclonal antibodies can be prepared using the hybridoma method well known in the art (see Kohler and Milstein (1976) European Journal of Immunology 6:511-519), or the phage antibody library technique (Clackson et al, Nature, 352). :624-628, 1991; Marks et al, J. Mol. Biol., 222:58, 1-597, 1991).
- Antibodies prepared by the above methods may be separated and purified using methods such as gel electrophoresis, dialysis, salt precipitation, ion exchange chromatography, and affinity chromatography.
- the antibodies of the present invention include functional fragments of antibodies as well as complete forms having two full-length light chains and two full-length heavy chains.
- the functional fragment of the antibody of the present invention means a fragment having at least an antigen-binding function, and includes Fab, F(ab'), F(ab')2 and Fv.
- PNA Peptide Nucleic Acid
- DNA has a phosphate-ribose backbone
- PNA has a repeated N-(2-aminoethyl)-glycine backbone linked by peptide bonds, which greatly increases the binding force and stability to DNA or RNA, and is thus used in molecular biology. , diagnostic assays and antisense therapies.
- PNA is described by Nielsen PE, Egholm M, Berg RH, Buchardt O (December 1991). “Sequence-selective recognition of DNA by strand displacement with a thymine-substituted polyamide”. Science 254 (5037): 1497-1500.
- the "aptamer” of the present invention is an oligonucleic acid or peptide molecule, and the general description of aptamers is described in the literature [Bock LC et al., Nature 355(6360):5646(1992); Hoppe-Seyler F, Butz K “Peptide aptamers: powerful new tools for molecular medicine”. J Mol Med. 78(8):42630 (2000); Cohen BA, Colas P, Brent R. “An artificial cell-cycle inhibitor isolated from a combinatorial library”. Proc Natl Acad Sci USA. 95(24): 142727 (1998).
- the antibody, PNA and aptamer of the present invention can be easily prepared by a person skilled in the art based on the amino acid sequence of the protein of the present invention.
- agent capable of measuring the expression level of the gene of the present invention may be included without limitation as long as it can measure the expression level by complementary binding to the gene of the present invention.
- the agent capable of measuring the expression level of the gene may be at least one selected from the group consisting of primers, probes, and antisense nucleotides that complementarily bind to the gene.
- the "primer” of the present invention is a fragment that recognizes a target gene sequence, and includes a pair of forward and reverse primers, preferably a primer pair that provides analysis results having specificity and sensitivity. High specificity can be imparted when the nucleic acid sequence of the primer is a sequence that is inconsistent with the non-target sequence present in the sample, so that the primer amplifies only the target gene sequence containing a complementary primer binding site and does not cause non-specific amplification. .
- the "probe” of the present invention means a substance capable of complementarily binding to a target substance to be detected in a sample, and means a substance capable of specifically confirming the presence of a target substance in a sample through the binding.
- the type of probe is not limited as a material commonly used in the art, but preferably may be peptide nucleic acid (PNA), locked nucleic acid (LNA), peptide, polypeptide, protein, RNA or DNA, and most preferably Most likely it is PNA.
- the probe is a biomaterial, including one derived from or similar to a living organism or manufactured in vitro, for example, enzymes, proteins, antibodies, microorganisms, animal and plant cells and organs, nerve cells, DNA, and It may be RNA, DNA includes cDNA, genomic DNA, and oligonucleotides, and RNA includes genomic RNA, mRNA, and oligonucleotides.
- LNA Locked nucleic acids
- the "LNA (Locked nucleic acids)" of the present invention means a nucleic acid analog containing a 2'-O, 4'-C methylene bridge [J Weiler, J Hunziker and J Hall Gene Therapy (2006) 13, 496.502 ].
- LNA nucleosides contain the common nucleic acid bases of DNA and RNA, and can base pair according to the Watson-Crick base pairing rules. However, due to molecular ‘locking’ due to methylene bridges, LNAs do not form ideal shapes in Watson-Crick bonds. When LNAs are included in DNA or RNA oligonucleotides, they can more rapidly pair with complementary nucleotide chains to increase the stability of the double helix.
- the "antisense” of the present invention is a sequence of nucleotide bases in which an antisense oligomer is hybridized with a target sequence in RNA by Watson-Crick base pairing, allowing formation of a typical mRNA and RNA: oligomeric heteroduplex in the target sequence and an oligomer having an inter-subunit backbone. Oligomers may have exact sequence complementarity or near complementarity to the target sequence.
- the agent capable of measuring the expression level of the gene of the present invention can derive the nucleotide sequence of the gene based on the amino acid sequence for the protein of the present invention, a person skilled in the art can complement the gene based on this. Binding primers, probes, etc. can be easily prepared.
- Another embodiment of the present invention provides a kit for predicting the severity of a disease mediated by IL-23.
- the kit of the present invention includes the composition for predicting the severity of a disease mediated by IL-23 according to the present invention.
- the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, and CD11c antigen are the same as described above, thereby avoiding excessive complexity of the specification. omit for
- the kit of the present invention may be an RT-PCR kit, a DNA chip kit, an ELISA kit, a protein chip kit, a rapid kit, or a multiple reaction monitoring (MRM) kit, but is not limited thereto.
- MRM multiple reaction monitoring
- the kit of the present invention may further include one or more other component compositions, solutions or devices suitable for the assay method.
- the diagnostic kit of the present invention may further include essential elements necessary for carrying out the reverse transcription polymerase reaction.
- the reverse transcription polymerase reaction kit contains a pair of primers specific for a gene encoding a protein.
- the primer is a nucleotide having a sequence specific to the nucleic acid sequence of the gene, and may have a length of about 7 bp to 50 bp, more preferably about 10 bp to 30 bp.
- a primer complementary to the nucleic acid sequence of the control gene may be included.
- reverse transcription polymerase reaction kits contain a test tube or other suitable container, reaction buffer (with varying pH and magnesium concentration), deoxynucleotides (dNTPs), enzymes such as Taq-polymerase and reverse transcriptase, DNase and RNase inhibitor DEPC. -Water (DEPC-water), sterilized water, etc. may be included.
- the diagnostic kit of the present invention may include essential elements required to perform a DNA chip.
- the DNA chip kit may include a substrate to which cDNA or oligonucleotides corresponding to genes or fragments thereof are attached, and reagents, reagents, enzymes, and the like for producing fluorescently labeled probes.
- the substrate may include a cDNA or oligonucleotide corresponding to a control gene or a fragment thereof.
- the diagnostic kit of the present invention may contain essential elements required to perform ELISA.
- ELISA kits contain antibodies specific for the protein.
- An antibody is an antibody that has high specificity and affinity for a marker protein and little cross-reactivity to other proteins, and is a monoclonal antibody, polyclonal antibody, or recombinant antibody.
- ELISA kits may also include antibodies specific for a control protein.
- Other ELISA kits include reagents capable of detecting bound antibodies, such as labeled secondary antibodies, chromophores, enzymes (eg, conjugated with antibodies) and substrates thereof or those capable of binding the antibody. may contain other substances and the like.
- Another embodiment of the present invention provides a method for providing information for predicting the severity of a disease mediated by IL-23.
- the disease compared to a normal control group, when monocytes on the surface of which the CD39 antigen, CD9 antigen and CD11b antigen are expressed, and the Ly6G antigen and CD11c antigen are not expressed on the surface of monocytes are present at low levels, the disease
- the severity of can be predicted as high, but is not limited thereto.
- the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, CD11c antigen, etc. are the same as described above, to avoid excessive complexity of the specification. omit for
- the step of measuring the expression level of the protein of the present invention is carried out using a preparation capable of measuring the expression level of the protein, protein chip analysis, immunoassay, ligand binding assay, MALDI-TOF (Matrix Assisted Laser Desorption / Ionization Time of Flight Mass Spectrometry) analysis, SELDI-TOF (Sulface Enhanced Laser Desorption/Ionization Time of Flight Mass Spectrometry) analysis, radioimmunoassay, radioimmunodiffusion method, Oukteroni immunodiffusion method, rocket immunoelectrophoresis, tissue immunostaining, complement Immobilization method, two-dimensional electrophoretic analysis, liquid chromatography-Mass Spectrometry (LC-MS), liquid chromatography-Mass Spectrometry/ Mass Spectrometry (LC-MS/MS), flow cytometry, Western blotting and It may be at least one selected from the group consisting of ELISA (enzyme linked immunosorbent assay).
- MALDI-TOF Micro
- Another embodiment of the present invention provides a cell therapy composition for preventing or treating diseases mediated by IL-23.
- composition of the present invention expresses CD39 antigen, CD9 antigen and CD11b antigen; Subtype monocytes that do not express Ly6G antigen and CD11c antigen are included as active ingredients.
- composition of the present invention the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, CD11c antigen, etc. are the same as described above, to avoid excessive complexity of the specification. omit for
- the "cell therapy agent" of the present invention refers to 'proliferating/selecting living autologous, allogenic, or xenogenic cells in vitro or using other methods to restore the tissue and function of cells. It means 'drugs used for the purpose of treatment, diagnosis, and prevention through a series of actions such as changing characteristics'.
- the cell therapy agent may be a cell having the antigen expression characteristics of the present invention, for example, monocytes, but is not limited thereto.
- the cells corresponding to the cell therapy agent in one embodiment of the present invention, are 1 ⁇ 10 5 ⁇ 5 ⁇ 10 5 , 5 ⁇ 10 5 ⁇ 1 ⁇ 10 6 , 1 ⁇ 10 6 ⁇ 2 ⁇ 10 6 2 ⁇ 10 6 ⁇ 3 ⁇ 10 6 , 3 ⁇ 10 6 ⁇ 4 ⁇ 10 6 , 4 ⁇ 10 6 ⁇ 5 ⁇ 10 6 , 5 ⁇ 10 6 ⁇ 6 ⁇ 10 6 , 6 ⁇ 10 6 ⁇ 7 ⁇ 10 6 , 7 ⁇ 10 6 ⁇ 8 ⁇ 10 6 6 to 5 ⁇ 10 6 , 5 ⁇ 10 6 to 7 ⁇ 10 6 , 2 ⁇ 10 6 to 4 ⁇ 10 6 , 1 ⁇ 10 6 to 5 ⁇ 10 6 or 5 ⁇ 10 6 to 1 ⁇ 10 7 may be administered at any one cell/subject dose, but is not limited thereto .
- the cell therapy agent of the present invention may be used for combined administration with an anti-IL-23 antibody, for example, Risankizumab.
- the anti-IL-23 antibody of the present invention may target IL-23p19, but is not limited thereto.
- the cell therapy composition of the present invention may be a pharmaceutical composition.
- prevention of the present invention means any action that suppresses or delays the onset of a disease or condition.
- the composition means to delay the onset of a disease mediated by IL-23 or to suppress the onset of the disease.
- treatment of the present invention refers to any action that delays, stops, or reverses the progression of a disease or condition, and for the purpose of the present invention, the composition is used to stop, alleviate, It means to alleviate or eliminate or reverse.
- the pharmaceutical composition of the present invention may be in the form of capsules, tablets, granules, injections, ointments, powders or beverages, and the pharmaceutical composition may be intended for humans.
- the pharmaceutical compositions of the present invention are not limited thereto, but are formulated in the form of oral formulations such as powders, granules, capsules, tablets, aqueous suspensions, external preparations, suppositories, and sterile injection solutions according to conventional methods, respectively.
- the pharmaceutical composition of the present invention may include a pharmaceutically acceptable carrier.
- the pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a colorant, a flavoring agent, etc.
- a buffer, a preservative, A pain reliever, solubilizer, isotonic agent, stabilizer, etc. may be mixed and used, and in the case of topical administration, a base, excipient, lubricant, preservative, etc. may be used.
- Formulations of the pharmaceutical composition of the present invention may be variously prepared by mixing with the pharmaceutically acceptable carrier as described above.
- the pharmaceutically acceptable carrier for example, for oral administration, it can be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, it can be prepared in unit dosage ampoules or multiple dosage forms. there is.
- it may be formulated into solutions, suspensions, tablets, capsules, sustained-release preparations, and the like.
- Examples of carriers, excipients and diluents suitable for the formulation of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate , cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or mineral oil may be used.
- fillers, anti-coagulants, lubricants, wetting agents, flavoring agents, emulsifiers, preservatives, and the like may be further included.
- the route of administration of the pharmaceutical composition of the present invention is not limited thereto, but is not limited to oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, This includes sublingual or rectal. Oral or parenteral administration is preferred.
- the "parenteral” includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques.
- the pharmaceutical composition may be administered in the form of a suppository for rectal administration.
- the pharmaceutical composition of the present invention depends on various factors including the activity of the specific compound used, age, body weight, general health, sex, diet, administration time, route of administration, excretion rate, drug combination and severity of the specific disease to be prevented or treated.
- the dosage of the pharmaceutical composition may be variously varied, and the dosage of the pharmaceutical composition varies depending on the patient's condition, body weight, disease severity, drug type, administration route and period, but may be appropriately selected by those skilled in the art, and is 0.0001 to 50 mg/day. kg or 0.001 to 50 mg/kg.
- Administration may be administered once a day, or may be administered in several divided doses. The dosage is not intended to limit the scope of the present invention in any way.
- the pharmaceutical composition according to the present invention may be formulated into a pill, dragee, capsule, liquid, gel, syrup, slurry, or suspension.
- the present invention expresses the CD39 antigen, the CD9 antigen and the CD11b antigen;
- a method for preventing or treating a disease mediated by IL-23 comprising administering subtype monocytes that do not express Ly6G antigen and CD11c antigen. Since monocytes used in the present invention and diseases mediated by IL-23 that are prevented or treated using the same have already been described above, description thereof is omitted to avoid excessive redundancy.
- SEQ ID NO: 1 CD39 antigen
- SEQ ID NO: 2 CD9 antigen
- SEQ ID NO: 4 CD11b antigen
- VLAEDAQRLF TALFPFEKNC GNDNICQDDL SITFSFMSLD CLVVGGPREF
- NVTVTVRNDG EDSYRTQVTF FFPLDLSYRK VSTLQNQRSQ RSWRLACESA
- SEQ ID NO: 5 CD11c antigen
- the present invention relates to a composition for predicting the severity of a disease mediated by IL-23 and a method for providing information for the prediction, wherein the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes present in a target sample is normal in the control group. If it is reduced compared to NETosis, the severity of the disease can be predicted by indicating the severity of the disease because NETosis is not effectively suppressed.
- CD39+CD9+Ly6G-CD11b+CD11c- monocytes can directly suppress NETosis without the help of other monocytes, diseases mediated by IL-23 can be prevented or treated very effectively if the monocytes are used.
- the therapeutic effect can be significantly increased when used in combination with an existing anti-IL-23 antibody.
- Figure 1 shows the results of confirming the NETosis phenomenon through a fluorescence microscope in the experimental group according to an embodiment of the present invention.
- Figure 2 shows the result of quantifying the area of the NETosis phenomenon clustering area in the experimental group according to an embodiment of the present invention.
- FIG. 3 is a graph showing the ratio of Ly6G+ cells among CD11b+CD11c- cells in an experimental group according to an embodiment of the present invention.
- FIG. 4 is a graph showing the ratio of Ly6G-CD39+CD9+ cells among CD11b+CD11c- cells in an experimental group according to an embodiment of the present invention.
- 5 is a graph showing the total number of cells in an experimental group according to an embodiment of the present invention.
- FIG. 6 is a graph showing the number of neutrophil cells in an experimental group according to an embodiment of the present invention.
- FIG. 7 to 9 are graphs showing the expression levels of cytokines (IL-17, IL-22, IFN-gamma) measured in the serum of the experimental group according to an embodiment of the present invention.
- FIG. 10 shows the result of confirming the degree of infiltration of inflammatory cells in tissues according to an embodiment of the present invention through H&E staining.
- 11 is a graph showing the Penh values confirmed in the experimental group according to an embodiment of the present invention.
- FIG. 12 is a graph showing the expression level of IL-23 measured in serum of an experimental group according to an embodiment of the present invention.
- FIG. 13 is a graph comparing the degree of NETosis of neutrophils according to the presence or absence of CD39+ CD9+ cells according to an embodiment of the present invention, and the degree of NETosis was measured by the area of the MPO and citH3 colonization area.
- FIG. 14 is a graph showing an inverse correlation between the severity of sinusitis and the ratio of CD39+ CD9+ cells among CD45+ cells according to an embodiment of the present invention.
- Figure 15 is a CD39 + CD9 + cell among CD45 + cells in mucosal tissue of bone (ethmoid) in the roof of the nose of sinusitis patients classified as mild and moderate-severe according to an embodiment of the present invention. ratio is shown graphically.
- Figure 16 shows the expression levels of CD9, CD39, and CD45 in Ulcerative Colitis (UC) and Crohn's Disease (CD) according to an embodiment of the present invention, relative abundance compared to the control group (HC). It is shown through a heat map.
- UC Ulcerative Colitis
- CD Crohn's Disease
- 17 is a graph showing the measurement of the relative abundance of CD9 or CD39 expression level with CD45 according to an embodiment of the present invention.
- CD9 is red
- CD39 is purple
- CD45 is green. dyed with
- Wild-type C57BL/6 mice (6-8 weeks old) were purchased from Orient Bio (Gyeonggi-do, Korea) and used as mice used in the experiment. The mice were bred under specific pathogen-free conditions until the experiment began. Such animal experiments were performed with the approval of the Institutional Review Board of Yonsei University College of Medicine.
- mice were primary sensitized by intraperitoneal injection of 200 ⁇ g of OVA (Ovalbumin) in 2.5 mg of aluminum hydroxide. Eleven days after the first sensitization, the same amount of OVA was injected intraperitoneally to sensitize, and 10 days later, on days 21, 22, and 23, respectively, the mice were anesthetized and sensitized with 50 ⁇ g of OVA intranasally. . Finally, on day 25, mice were intranasally administered with 100 ⁇ g of OVA, and mice were sacrificed 48 hours later to perform the experiment.
- mice were sensitized by intranasal injection of 100 ⁇ g of LPS (E. coli) and 75 ⁇ g of OVA. After 5 days of the third sensitization corresponding to 2 days, sensitization was performed by intranasal injection of the same amount of LPS and OVA. Thus, 7 days after the last sensitization, 14 days, 15 days, 21 days, and 22 days, respectively, 50 ⁇ g of OVA dissolved in PBS was intranasally injected into mice, and mice were sacrificed 48 hours later to experiment was performed.
- LPS E. coli
- IL-23p19 neutralizing antibody BioxCell, West Riverside, NH, USA
- an amount of 1 mg/kg per mouse was intraperitoneally injected 1 hour before the first sensitization described in Experimental Method 2 above.
- mice IgG2a isotype 400 ⁇ g of mouse IgG2a isotype was intraperitoneally injected at the same time as the neutralizing antibody, and POM1 (20 mg/kg per mouse, TOCRIS a biotechne brand), aCD9 (20 mg/kg per mouse, BD Pharmingen) and GSK484 (4 mg/kg per mouse, CAYMAN CHEMICAL COMPANY) were injected intraperitoneally at the same time as the neutralizing antibody.
- inhaled methacholine (Sigma-Aldrich, St. Louis, MO) was measured.
- Lung tissues of experimental animals were collected, fixed in a 4% formaldehyde solution, and then embedded in paraffin to make blocks. Then, the blocks were made into 3 ⁇ m thick slices.
- paraffin sections were dried at 60 °C for 30 minutes, peeled with xylene for 15 minutes, and hydrated with 100%, 95%, 80%, and 75% alcohol in that order.
- the prepared tissue slide was reacted for 3 minutes by dropping hematoxylin solution, washed with distilled water three times for 1 minute each, reacted with eosin solution for 10 minutes, and washed with distilled water. After mounting it with a permount, structural changes in the lung tissue were observed using an optical microscope.
- hematoxylin stains the chromatin and nuclear membrane in the cell nucleus with a basic dye, and appears purple, and eosin, an acidic dye, combines with basic cytoplasmic proteins and collagen, and is observed pink.
- Penh is an index representing airway resistance, and Penh was derived by quantifying the value measured using the airway resistance meter in the mouse model through the following formula.
- Penh (Te/RT-1) X PEF (peak expiratory flow rat, mL/s)/PIF (peak inspiratory flow rat, mL/s)
- RT Time taken for the expiratory volume to remain at 30% of the tidal volume during expiration (relaxation time, sec)
- the levels of IL-17, IL-22, IFN-gamma, and IL-23 present in the serum of the mouse model were measured using an ELISA kit. Specifically, 100 ⁇ l of the primary antibody diluted in 0.1 M sodium carbonate solution was added to a 96-well ELISA plate and reacted at 4° C. overnight. Thereafter, the plate was washed three times with 1X washing buffer, and then 1X PBS containing 10% BSA was put into each well and allowed to stand at room temperature for 1 hour to block the plate.
- Bronchoalveolar lavage fluid was obtained from the mouse model, washed once with PBS, mixed with fluorescent substance-conjugated antibodies, reacted at 4° C. for 1 hour, and analyzed by flow cytometry to detect The phenotype of the immune cells was confirmed.
- NETosis was increased in Experimental Group 2 compared to Experimental Group 1, and NETosis was significantly reduced in Experimental Groups 3 and 4. Furthermore, NETosis decreased in Experimental Group 4 was increased again in Experimental Group 5 treated with POM1 as in Experimental Group 1, and decreased again in Experimental Group 6 treated with GSK484. Also, as shown in Experimental Group 7, NETosis was increased in the same way as POM1 treatment when treated with anti-CD9 antibody. In addition, as shown in Experimental Group 8, the effect of increasing NETosis by treatment with anti-CD9 antibody was reduced by treatment with GSK484.
- IL-23-dependent NETosis in neutrophil-dominant asthma was reduced by dendritic cell and IL-23-producing immune cells can be activated to induce inflammation, and it can be seen that CD9 is involved in the suppression of NETosis induced in this way.
- LyG + CD11b + CD11c-, Ly6G-CD39 + CD9 + CD11b + CD11c-, total cell count, neutrophil count and cytokine (IL -23, IL-17, IL-22 and IFN-gamma) were measured, and the results are shown in FIGS. 3 to 10.
- the CD39+CD9+Ly6G-CD11b+CD11c- monocyte ratio which was reduced in Experimental Group 2 was anti-IL- It was increased in experimental groups 3 and 4 treated with 23p19 and GSK484.
- the CD39+CD9+Ly6G-CD11b+CD11c- monocytes decreased in Experimental Group 5 were increased in Experimental Groups 6 and 8 treated with GSK484.
- the total number of cells in BALF (FIG. 5), the number of neutrophils (FIG. 6), IL-17 (FIG. 7), and IL-22 (FIG. 7) increased in experimental groups 2, 5, and 7. 8), IFN-gamma (FIG. 9), immune cell infiltration (FIG. 10), and Pehn value (FIG. 11) were decreased in experimental group 3, experimental group 4, experimental group 6, and experimental group 8.
- the level of IL-23 present is IL-17, IL-22, and Th-1 cell-mediated cytokine. Similar to IFN-gamma, it was increased in Experimental Group 2 compared to Experimental Group 1, and this increased value was decreased in Experimental Groups 3 and 4. Furthermore, the expression level of IL-23 decreased in Experimental Group 3 was increased to the same level as Experimental Group 2 in Experimental Groups 5 and 7 treated with POM1 and anti-CD9 antibody.
- both CD39 and CD9 can suppress IL-23-dependent neutrophil inflammation through inhibition of NETosis in a neutrophil-dominant mouse animal model.
- CD39+CD9+Ly6G-CD11b+CD11c- monocytes directly suppress NETosis of Ly6G+CD11b+CD11c- neutrophils
- NETosis of CD39-CD9-Ly6G+CD11b+CD11c- neutrophils was compared with CD39+ CD11c- isolated from Experimental Group 4.
- CD9+Ly6G-CD11b+CD11c- monocytes were stained with MPO, Cit histone H3, and DAPI, followed by fluorescence microscopy analysis, and the results are shown in FIG. 13 .
- CD39+CD9+ Ly6G-CD11b+CD11c- monocytes excluding other CD39+CD9+ immune cells, directly suppress NETosis of Ly6G+CD11b+CD11c- neutrophils in a manner dependent on CD39 and CD9.
- Sinusitis patients are classified into mild symptoms and moderate-severe, and the ratio of CD39+CD9+ cells among CD45+ cells in the tissue is measured by collecting the bone (ethmoid) mucous membrane on the ceiling of the patient's nose, The results are shown in Figures 14 and 15.
- CD39+CD9+CD45+ cells were observed in the colonic mucosa of healthy controls (HC), but not in UC and CD patients (FIG. 18).
- the immune cells can be used as an important target for the treatment of IL-23-Th17 cell-associated immune diseases. I was able to confirm that it could.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Mycology (AREA)
- Analytical Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Food Science & Technology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- General Physics & Mathematics (AREA)
- Pulmonology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The present invention relates to a composition for predicting the severity of a disease mediated by IL-23, and to a method for providing information for prediction. The severity of the disease can be predicted on the basis that NETosis is not effectively inhibited, thus showing that the disease is severe, when the number of CD39+CD9+Ly6G-CD11b+CD11c-monocytes present in a sample of interest is reduced as compared to a normal control group. Furthermore, CD39+CD9+Ly6G-CD11b+CD11c-monocytes can directly inhibit NETosis without the help of other monocytes, and thus can not only be used to highly effectively prevent or treat diseases mediated by IL-23, but can also be used in combination with existing anti-IL-23 antibodies to significantly increase the therapeutic effect.
Description
본 발명은 IL-23에 의해 매개되는 질환의 중증도에 대한 정보를 제공하는 방법에 관한 것이다.The present invention relates to methods of providing information about the severity of diseases mediated by IL-23.
천식은 다양한 내형(endotype)과 과도한 이환율을 가지는 기도의 만성 염증 질환을 의미한다. TH2 세포 매개 호산 구성, TH17 세포 매개 호중구 또는 심지어 무과립구 염증과 관련될 수 있는 여러 유형의 천식기도 염증이 있다. 호산구는 천식성 폐에 존재하는 중요한 염증 세포이지만, 이러한 호산구는 호산구 기도 염증, 특히 급성 악화 시 폐 내강에서 호중구 세포가 증가한 환자의 의학적 증상을 설명하지 못한다. 최근, 천식 중증도 및 악화, 스테로이드 치료 반응과 폐 호중구 염증의 높은 상관관계가 보고되었다. 호산구 기도 염증과는 달리 호중구 기도 염증은 종종 흡입 또는 전신 코르티코스테로이드(corticosteroids)에 반응하지 않아, 약물에 의한 반응성이 낮고, 재발될 수 있다. 이에, 강화된 치료적 접근에 대한 상당한 요구가 있었으나, 호중구가 우세한 천식, 즉 호중구 우세 천식에 대한 특정 치료의 개발은 근본적인 메커니즘에 대한 근거가 부족하여 어려운 실정이었다.Asthma refers to a chronic inflammatory disease of the airways with various endotypes and excessive morbidity. There are several types of asthmatic airway inflammation that can be associated with TH2 cell-mediated eosinophilic, TH17 cell-mediated neutrophilic, or even agranulocyte inflammation. Although eosinophils are important inflammatory cells present in the asthmatic lung, these eosinophils do not explain the medical symptoms of eosinophilic airway inflammation, especially in patients with increased neutrophil cells in the lung lumen during acute exacerbations. Recently, a high correlation between asthma severity and exacerbation, steroid treatment response, and pulmonary neutrophil inflammation has been reported. Unlike eosinophilic airway inflammation, neutrophilic airway inflammation often does not respond to inhaled or systemic corticosteroids, is less drug responsive, and may recur. Thus, there has been a significant demand for an enhanced therapeutic approach, but development of a specific treatment for neutrophil-dominant asthma, that is, neutrophil-dominant asthma, has been difficult due to lack of evidence on the underlying mechanism.
한편, 대식세포 및 수지상세포를 포함한 골수 세포는 면역반응에서 항원제시 역할을 하며, 천식의 경우, 나이브 CD4+T 세포가 이펙터 TH2 및 TH17 세포로 분화될 수 있도록 지시하고, 흡입된 항원에 대한 내성을 제어한다. On the other hand, bone marrow cells, including macrophages and dendritic cells, play an antigen-presenting role in the immune response, and in the case of asthma, instruct naive CD4+ T cells to differentiate into effector TH2 and TH17 cells, and develop resistance to inhaled antigens. to control
상기 TH17 세포의 경우, 낮은 항원 용량과 OX40 리간드의 발현에 의해 분화가 유도되고, 높은 수준의 IL-4, IL-5 및 IL-13이 존재하는 사이토카인 환경에서 항원 제시세포에 의해 들쭉날쭉하게 된다. 대조적으로, CD40 및 CD86의 발현 및 IL-6, IL-1 베타 및 IL-24 및 TGF-베타(transforming growth factor-beta)를 포함하는 전염증성사이토카인의 발현 수준이 높은 경우에 TH17이 분화되는데 유리하다. 특히, IL-23의 경우, 기도에 호중구의 침윤을 유도하여 TH17 세포를 활성화시키고, IL-17의 분비를 통해 중증도의 천식을 유발한다.In the case of the TH17 cells, differentiation is induced by low antigen dose and expression of OX40 ligand, and becomes jagged by antigen-presenting cells in a cytokine environment in which high levels of IL-4, IL-5 and IL-13 are present . In contrast, TH17 differentiation occurs when the expression of CD40 and CD86 and the expression of pro-inflammatory cytokines including IL-6, IL-1 beta and IL-24 and TGF-beta (transforming growth factor-beta) are high. It is advantageous. In particular, IL-23 induces infiltration of neutrophils into the airways, activates TH17 cells, and induces severe asthma through secretion of IL-17.
소아 천식에서IL-23의 혈청 수준은 FEV1(Forced Expiratory Volume in One second) 값에서 강제 호기량과 반비례하여, IL-23이 천식의 중증도를 평가할 때 보조적인 바이오마커로 사용될 수 있다. 또한, 최근IL-23 길항제 또는 억제제를 이용하여 IL-23의 잠재적인 치료 효과를 입증하기 위한 실험이 천식 환자 및 천식 마우스 모델에서 시험되었다. 그러나, IL-23의 조절 메커니즘과 다양한 천식 상태에서의 특정 역할이 명확하지 않기 때문에 이를 표적으로 하는 치료제의 개발은 지연되고 있는 실정이다.In pediatric asthma, the serum level of IL-23 is inversely proportional to the forced expiratory volume in FEV1 (Forced Expiratory Volume in One second) value, so IL-23 can be used as an auxiliary biomarker when assessing the severity of asthma. In addition, recent experiments to demonstrate the potential therapeutic effect of IL-23 using IL-23 antagonists or inhibitors have been tested in asthmatic patients and asthmatic mouse models. However, development of therapeutic agents targeting IL-23 has been delayed because its regulatory mechanism and its specific role in various asthmatic conditions are not clear.
본 발명의 일 목적은 IL-23에 의해 매개되는 질환의 중증도 예측용 조성물을 제공하는 것이다.One object of the present invention is to provide a composition for predicting the severity of a disease mediated by IL-23.
본 발명의 다른 목적은 IL-23에 의해 매개되는 질환의 중증도 예측을 위한 정보를 제공하는 방법을 제공하는 것이다.Another object of the present invention is to provide a method for providing information for predicting the severity of a disease mediated by IL-23.
본 발명의 또 다른 목적은 IL-23 매개 질환의 예방 또는 치료용 세포치료제 조성물을 제공하는 것이다.Another object of the present invention is to provide a cell therapy composition for preventing or treating IL-23 mediated diseases.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당 업계에서 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다. However, the technical problem to be achieved by the present invention is not limited to the above-mentioned problems, and other problems not mentioned will be clearly understood by those skilled in the art from the following description.
본 발명의 일 구현 예에서는 IL-23에 의해 매개되는 질환의 중증도 예측용 조성물을 제공한다.One embodiment of the present invention provides a composition for predicting the severity of a disease mediated by IL-23.
본 발명의 상기 조성물은 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원으로 이루어진 군으로부터 선택되는 어느 하나의 단백질; 또는 이를 암호화하는 유전자의 발현 수준을 측정할 수 있는 제제를 포함한다.The composition of the present invention comprises any one protein selected from the group consisting of monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen and CD11c antigen; or an agent capable of measuring the expression level of a gene encoding the same.
본 발명의 상기 “CD39(Cluster of Differentiation 39) 항원”은 종양 간극에 고농도로 존재하는 전 염증성 대사 산물인 세포 외 ATP (eATP)를 가수 분해하는 표면 발현 효소이다. 본 발명의 상기 CD39 항원은 서열번호 1로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.The “Cluster of Differentiation 39 (CD39) antigen” of the present invention is a surface-expressed enzyme that hydrolyzes extracellular ATP (eATP), a pro-inflammatory metabolite present in high concentration in the tumor gap. The CD39 antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 1, but is not limited thereto.
본 발명의 상기 “CD9(Cluster of Differentiation 9) 항원”은 면역 세포의 분자 마커로서, 본 발명의 상기 CD9 항원은 서열번호 2로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.The “Cluster of Differentiation 9 (CD9) antigen” of the present invention is a molecular marker of immune cells, and the CD9 antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 2, but is not limited thereto.
본 발명의 상기 “Ly6G(Lymphocyte antigen 6G) 항원”은 골수 유래 세포에 의해 발현되는 21-25kD 글리코실 포스파티딜 이노시톨(GPI) 연결된 분화 항원이다. 골수 발달 동안 일시적으로 단핵구에서 Ly6G가 발현될 수 있고, 과립구 및 말초 호중구에서 Ly6G 발현은 세포의 분화 및 성숙 수준과 직접적으로 관련되어 있다. 본 발명의 상기 Ly6G 항원은 서열번호 3으로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.The “Lymphocyte antigen 6G (Ly6G) antigen” of the present invention is a 21-25 kD glycosyl phosphatidylinositol (GPI)-linked differentiation antigen expressed by bone marrow-derived cells. Ly6G can be transiently expressed in monocytes during bone marrow development, and Ly6G expression in granulocytes and peripheral neutrophils is directly related to the level of differentiation and maturation of the cells. The Ly6G antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 3, but is not limited thereto.
본 발명의 상기 “CD11b 항원”은 단핵구, 대식세포, NK 세포 및 과립구와 같은 세포 사이의 다양한 접착에 관여한다. 본 발명의 상기 CD11b 항원은 서열번호 4로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.The "CD11b antigen" of the present invention is involved in various adhesions between cells such as monocytes, macrophages, NK cells and granulocytes. The CD11b antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 4, but is not limited thereto.
본 발명의 상기 “CD11c 항원”은 단핵구, 대식세포, 호중구 및 B 세포에 있는 제1형 막 관통 단백질로서, 세포를 활성화하고 호중구 호흡폭발을 일으킨다. 본 발명의 상기 CD11c 항원은 서열번호 5로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.The "CD11c antigen" of the present invention is a type 1 transmembrane protein in monocytes, macrophages, neutrophils and B cells, which activates cells and causes neutrophil respiratory burst. The CD11c antigen of the present invention may consist of the amino acid sequence represented by SEQ ID NO: 5, but is not limited thereto.
본 발명의 일 구체 예에서, 상기 단핵구는 CD39 항원, CD9 항원 및 CD11b 항원이 단핵구의 표면에 발현되는 것일 수 있고, 및/또는 상기 단핵구는 Ly6G 항원 및 CD11c 항원이 단핵구의 표면에 발현되지 않는 것일 수 있으나, 이에 제한되는 것은 아니다. 본 발명의 목적상, 목적하는 시료 내 존재하는 CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 수가 정상 대조군과 비교하여 감소되어 있는 경우 호중구 세포 외 트랩인 NETosis가 효과적으로 억제되지 않아 상기 질환이 중증도를 나타낼 수 있다. 따라서, 상기 항원들의 단백질 또는 이를 암호화하는 유전자의 발현 수준을 측정함으로써, 정상 대조군과 비교하여 그 발현 수준이 변화되어 있는 경우 상기 질환이 중증도를 나타낼 수 있다고 예측할 수 있으나, 이에 제한되는 것은 아니다.In one embodiment of the present invention, the monocytes may have CD39 antigen, CD9 antigen, and CD11b antigen expressed on the surface of monocytes, and/or the monocytes may not express Ly6G antigen and CD11c antigen on the surface of monocytes. It may be, but is not limited thereto. For the purpose of the present invention, when the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes present in the sample of interest is reduced compared to the normal control group, NETosis, a neutrophil extracellular trap, is not effectively inhibited, thereby reducing the severity of the disease. can indicate Therefore, by measuring the expression levels of the proteins of the antigens or genes encoding them, it can be predicted that the severity of the disease can be expressed when the expression level is changed compared to a normal control group, but is not limited thereto.
본 발명의 상기 “IL-23에 의해 매개되는 질환”은 IL-23에 의해 발병되거나, 또는 그 질환이 진행되는데 IL-23이 관여할 수 있는 질환을 의미하는 것으로서, 상기 IL-23에 의해 매개되는 질환은 호흡기 질환; 다발성 경화증; 류마티스 성 관절염; 건선; 염증성 장 질환; 및 강직성 척추염으로 이루어진 군으로부터 선택되는 어느 하나일 수 있으나, 이에 제한되는 것은 아니다.The “disease mediated by IL-23” of the present invention refers to a disease caused by IL-23 or in which IL-23 may be involved in the progression of the disease, and is mediated by IL-23. Possible diseases include respiratory diseases; multiple sclerosis; rheumatoid arthritis; psoriasis; inflammatory bowel disease; And it may be any one selected from the group consisting of ankylosing spondylitis, but is not limited thereto.
본 발명의 상기 호흡기 질환은 천식 또는 부비동염일 수 있으나, 이에 제한되는 것은 아니다.The respiratory disease of the present invention may be asthma or sinusitis, but is not limited thereto.
본 발명의 상기 천식은 호중구 우세 천식인 것일 수 있으나, 이에 제한되는 것은 아니다.The asthma of the present invention may be neutrophil-dominant asthma, but is not limited thereto.
본 발명의 상기 “호중구 우세 천식”은 일반적인 치료 방법에 의해 증상이 완화될 수 있는 경증 천식과 비교하여 폐 조직에 호중구(Neutrophil)의 수가 호산구(Eosinophil)에 비하여 현저하게 증가되어 있는 것일 수 있으나, 이에 제한되지 않는 것으로서, 난치성 알레르기성 천식, 스테로이드 의존성 알레르기성 천식, 치료 불응성 알레르기성 천식(Refractory allergic asthma) 등의 다양한 용어로 일컬어질 수 있다.The “neutrophil-dominant asthma” of the present invention may be one in which the number of neutrophils in the lung tissue is significantly increased compared to eosinophils compared to mild asthma, the symptoms of which can be alleviated by general treatment methods, As not limited thereto, various terms such as refractory allergic asthma, steroid-dependent allergic asthma, and treatment-refractory allergic asthma may be referred to.
본 발명의 상기 “중증도”는 질환의 발병 위험의 증감 정도, 병변의 진행 정도 및 재발 위험의 증감 정도를 포함하는 의미일 수 있다. 상기 발병 위험의 증감 정도는 질환이 발병할 위험이 있거나, 발병한 가능성이 있는 정도를 포함하는 의미이다. 상기 병변의 진행 정도라 함은 질환이 발병하여 병변이 진행되어 질환이 경미한 정도 내지 심각한 정도를 포함하는 의미이다. 또한, 상기 재발 위험의 증감 정도라 함은 질환 완치 판정 후 재발 위험이 있거나 재발된 가능성이 있는 정도를 의미한다. 상기 질환의 중증도는 정성적 및/또는 정량적으로 나타낼 수 있으며, 중증도는 그 정도에 따라 분류될 수 있다.The "severity" of the present invention may include the degree of increase or decrease in the risk of developing a disease, the degree of progression of a disease, and the degree of increase or decrease in the risk of recurrence. The degree of increase or decrease in the risk of developing the disease is meant to include the degree of risk of developing the disease or the possibility of developing the disease. The degree of progression of the lesion means that the disease has developed and the lesion has progressed to include a mild to severe degree of the disease. In addition, the degree of increase or decrease in the risk of recurrence means the degree to which there is a risk of recurrence or a possibility of recurrence after the disease is determined to be cured. The severity of the disease may be expressed qualitatively and/or quantitatively, and the severity may be classified according to the degree.
본 발명의 일 구체 예에서, 상기 “천식 중증도”는 환자의 증상, 폐기능 지표를 통해 분류할 수 있으며, 경증 간헐성, 경증 지속성, 중등증 지속성 및 중증 지속성에 해당하는 분류에 의해 구분될 수 있다. 여기서, 중등증 지속성의 경우, 매일 천식 증상이 있으며, 증상 악화가 주에 2주 있고, FEV가 60~80%이고, PEFR 일중 변동률이 ≥30%인 경우를 의미한다. 또한, 여기서, 중증 지속성의 경우 지속적인 천식 증상이 있고, 활동 제한 및 잦은 증상 악화와 FEV가 ≤60% 이고, PEFR 일중 변동률이 ≥30%인 경우를 의미한다.In one embodiment of the present invention, the "asthma severity" can be classified through the patient's symptoms and lung function indicators, and can be classified into mild intermittent, mild persistent, moderate persistent, and severe persistent. . Here, in the case of moderate persistence, it means that there are asthma symptoms every day, symptom exacerbations are 2 weeks a week, the FEV is 60-80%, and the PEFR diurnal variation is ≥30%. In addition, here, in the case of severe persistence, it means that there are persistent asthma symptoms, activity limitation and frequent worsening of symptoms, FEV is ≤60%, and PEFR diurnal variation is ≥30%.
본 발명의 상기 IL-23에 의해 매개되는 질환인 다발성 경화증은 Th1 유형 T 세포 매개 자가 면역 질환으로, IL-23은 Th1 편향에 대한 선천적 면역 반응을 분극화하는 방식으로 면역계에 영향을 미침으로써 다발성 경화증의 병인에 중요한 역할을 할 수 있다(J Immunol 2006 년6 월15 일, 176 (12) 7768-7774).Multiple sclerosis, which is a disease mediated by IL-23 of the present invention, is a Th1 type T cell-mediated autoimmune disease, and IL-23 affects the immune system in a way that polarizes the innate immune response against Th1 bias, thereby preventing multiple sclerosis. (J Immunol 15 June 2006, 176 (12) 7768-7774).
본 발명의 상기 IL-23에 의해 매개되는 질환인 류마티스 성 관절염의 경우, p19 및 p40 서브 유닛으로 구성된 IL-23이 IL-23 수용체 복합체와 상호작용하여 과다한 생화학적 작용을 유발하고, 주로 IL-17 및 TH17 세포를 통해 파골 세포 생성 효과를 발휘하여 류마티스 성 관절염이 발휘되도록 할 수 있다(Immunopharmacol Immunotoxicol. 2019 Apr;41(2):185-191.).In the case of rheumatoid arthritis, which is a disease mediated by the IL-23 of the present invention, IL-23 composed of p19 and p40 subunits interacts with the IL-23 receptor complex to induce excessive biochemical actions, mainly IL-23. 17 and TH17 cells to exert an osteoclastogenic effect, allowing rheumatoid arthritis to be exerted (Immunopharmacol Immunotoxicol. 2019 Apr;41(2):185-191.).
본 발명의 상기 IL-23에 의해 매개되는 질환인 건선의 경우, 진피 수지상세포에서 IL-23의 생산이 증가되면 TH17(CD4+ 헬퍼T 세포) 세포, TC17(독성CD8+ T 세포), ILC3(innate lymphoid 세포) 및γδT 세포를 포함하여 IL-17를 생산하는 세포를 활성화한다. 이렇게 주로 염증성 피부의 수지상 세포에서 분비되는 IL-23은 IL-17을 분비하는 세포의 수가 증가되며, 많은 양의 IL-17을 생성하여 표피 각질 세포에 의해 생성된 건선 관련 유전자가 상향조절 됨으로써 건선의 발병 및 유지에 기여할 수 있다(Ther Adv Chronic Dis. 2018 May; 9(5): 111-119.).In the case of psoriasis, which is a disease mediated by the IL-23 of the present invention, when IL-23 production is increased in dermal dendritic cells, TH17 (CD4+ helper T cells) cells, TC17 (toxic CD8+ T cells), ILC3 (innate lymphoid cells) cells) and γδ T cells that produce IL-17. IL-23, which is mainly secreted from dendritic cells in the inflammatory skin, increases the number of cells that secrete IL-17, and produces a large amount of IL-17, resulting in upregulation of psoriasis-related genes produced by epidermal keratinocytes, leading to psoriasis. (Ther Adv Chronic Dis. 2018 May; 9(5): 111-119.).
본 발명의 상기 IL-23에 의해 매개되는 질환인 염증성 장 질환은 IL-23가 Th-17 경로를 통해 장에 염증이 발생되는 과정을 통해 발병 및 유지에 기여할 수 있다(Science 2006 Dec 1;314(5804):1461-3).Inflammatory bowel disease, which is a disease mediated by IL-23 of the present invention, can contribute to the onset and maintenance of IL-23 through a process in which inflammation is generated in the intestine through the Th-17 pathway (Science 2006 Dec 1;314 (5804):1461-3).
본 발명의 상기 IL-23에 의해 매개되는 질환인 강직성 척추염은 IL-23 수용체(IL-23R) 다형성이 해당 발생 위험 증가와 관련이 있음이 입증되었으며, 이와 같은 질환이 발생된 환자의 관절에서 IL-23을 생산하는 세포의 수가 증가되어 있는 것이 확인되었다(Ann Rheum Dis. 2019 Aug;78(8):1015-1018).Ankylosing spondylitis, a disease mediated by IL-23 of the present invention, has been proven to be associated with an increased risk of IL-23 receptor (IL-23R) polymorphism, and IL-23 receptor (IL-23R) polymorphism is associated with an increased risk of IL-23 in the joints of patients with such a disease. It was confirmed that the number of cells producing -23 was increased (Ann Rheum Dis. 2019 Aug;78(8):1015-1018).
본 발명의 목적상 상기 IL-23에 의해 매개되는 질환들이 중증도를 나타내는 경우, CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 수가 정상 대조군과 비교하여 감소되어 있는 것일 수 있으나, 이에 제한되는 것은 아니다.For the purpose of the present invention, when the disease mediated by IL-23 exhibits severity, the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes may be reduced compared to a normal control group, but is not limited thereto. .
본 발명의 상기 단백질의 발현 수준을 측정할 수 있는 제제는 상기 유전자에 상보적으로 결합하는 프라이머, 프로브 및 안티센스 뉴클레오티드로 이루어진 군으로부터 선택되는 적어도 하나인 것일 수 있으나, 이에 제한되는 것은 아니다.An agent capable of measuring the expression level of the protein of the present invention may be at least one selected from the group consisting of primers, probes, and antisense nucleotides that complementarily bind to the gene, but is not limited thereto.
본 발명의 상기 단백질의 발현 수준을 측정할 수 있는 제제는 상기 단백질에 특이적으로 결합하여 그 단백질의 발현 수준을 측정할 수 있는 제제라면 제한되지 않는다. 예를 들면, 상기 단백질의 발현 수준을 측정할 수 있는 제제는 상기 단백질에 특이적으로 결합하는 항체, 올리고펩타이드, 리간드, PNA(Peptide nucleic acid) 및 앱타머(aptamer)로 이루어진 군으로부터 선택되는 적어도 하나인 것일 수 있다.The agent capable of measuring the expression level of the protein of the present invention is not limited as long as it can specifically bind to the protein and measure the expression level of the protein. For example, the agent capable of measuring the expression level of the protein is at least selected from the group consisting of an antibody, an oligopeptide, a ligand, a peptide nucleic acid (PNA), and an aptamer that binds specifically to the protein. It may be one.
본 발명의 상기 “항체”는 항원과 특이적으로 결합하여 항원-항체 반응을 일으키는 물질을 가리킨다. 본 발명의 목적상, 항체는 상기 단백질에 대해 특이적으로 결합하는 항체를 의미한다. 본 발명의 항체는 다클론 항체, 단클론 항체 및 재조합 항체를 모두 포함한다. 상기 항체는 당업계에 널리 공지된 기술을 이용하여 용이하게 제조될 수 있다. 예를 들어, 다클론 항체는 상기 단백질의 항원을 동물에 주사하고 동물로부터 채혈하여 항체를 포함하는 혈청을 수득하는 과정을 포함하는 당업계에 널리 공지된 방법에 의해 생산될 수 있다. 이러한 다클론 항체는 염소, 토끼, 양, 원숭이, 말, 돼지, 소, 개 등의 임의의 동물로부터 제조될 수 있다. 또한, 단클론 항체는 당업계에 널리 공지된 하이브리도마 방법(hybridoma method; Kohler 및Milstein (1976) European Journal of Immunology 6:511-519 참조), 또는 파지 항체 라이브러리 기술(Clackson et al, Nature, 352:624-628, 1991; Marks et al, J. Mol. Biol., 222:58, 1-597, 1991 참조)을 이용하여 제조될 수 있다. 상기 방법으로 제조된 항체는 겔 전기영동, 투석, 염 침전, 이온교환 크로마토그래피, 친화성 크로마토그래피 등의 방법을 이용하여 분리, 정제될 수 있다. 또한, 본 발명의 항체는 2개의 전장의 경쇄 및 2개의 전장의 중쇄를 갖는 완전한 형태뿐만 아니라, 항체의 기능적인 단편을 포함한다.The "antibody" of the present invention refers to a substance that specifically binds to an antigen and causes an antigen-antibody reaction. For the purposes of the present invention, antibody means an antibody that specifically binds to said protein. Antibodies of the present invention include both polyclonal antibodies, monoclonal antibodies and recombinant antibodies. Such antibodies can be readily prepared using techniques well known in the art. For example, polyclonal antibodies can be produced by a method well known in the art, including a process of injecting an antigen of the protein into an animal and collecting blood from the animal to obtain serum containing the antibody. Such polyclonal antibodies can be prepared from any animal, such as goat, rabbit, sheep, monkey, horse, pig, cow, dog, and the like. In addition, monoclonal antibodies can be prepared using the hybridoma method well known in the art (see Kohler and Milstein (1976) European Journal of Immunology 6:511-519), or the phage antibody library technique (Clackson et al, Nature, 352). :624-628, 1991; Marks et al, J. Mol. Biol., 222:58, 1-597, 1991). Antibodies prepared by the above methods may be separated and purified using methods such as gel electrophoresis, dialysis, salt precipitation, ion exchange chromatography, and affinity chromatography. In addition, the antibodies of the present invention include functional fragments of antibodies as well as complete forms having two full-length light chains and two full-length heavy chains.
본 발명의 상기 항체의 기능적인 단편이란, 적어도 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab'), F(ab')2 및 Fv 등이 있다.The functional fragment of the antibody of the present invention means a fragment having at least an antigen-binding function, and includes Fab, F(ab'), F(ab')2 and Fv.
본 발명에 상기 “PNA(Peptide Nucleic Acid)”는 인공적으로 합성된, DNA 또는 RNA와 비슷한 중합체를 가리키며, 1991년 덴마크 코펜하겐 대학교의 Nielsen, Egholm, Berg와Buchardt 교수에 의해 처음으로 소개되었다. DNA는 인산-리보스당 골격을 갖는데 반해, PNA는 펩타이드 결합에 의해 연결된 반복된 N-(2-아미노에틸)-글리신 골격을 가지며, 이로 인해 DNA 또는 RNA에 대한 결합력과 안정성이 크게 증가되어 분자 생물학, 진단 분석 및 안티센스 치료법에 사용되고 있다. PNA는 문헌[Nielsen PE, Egholm M, Berg RH, Buchardt O (December 1991). “Sequence-selective recognition of DNA by strand displacement with a thymine-substituted polyamide”. Science 254 (5037): 1497-1500]에 상세하게 개시되어 있다.In the present invention, the "PNA (Peptide Nucleic Acid)" refers to an artificially synthesized polymer similar to DNA or RNA, and was first introduced in 1991 by Professors Nielsen, Egholm, Berg and Buchardt of the University of Copenhagen, Denmark. Whereas DNA has a phosphate-ribose backbone, PNA has a repeated N-(2-aminoethyl)-glycine backbone linked by peptide bonds, which greatly increases the binding force and stability to DNA or RNA, and is thus used in molecular biology. , diagnostic assays and antisense therapies. PNA is described by Nielsen PE, Egholm M, Berg RH, Buchardt O (December 1991). “Sequence-selective recognition of DNA by strand displacement with a thymine-substituted polyamide”. Science 254 (5037): 1497-1500.
본 발명의 상기 “앱타머”는 올리고핵산 또는 펩타이드 분자이며, 앱타머의 일반적인 내용은 문헌[Bock LC et al., Nature 355(6360):5646(1992); Hoppe-Seyler F, Butz K “Peptide aptamers: powerful new tools for molecular medicine”. J Mol Med. 78(8):42630(2000); Cohen BA, Colas P, Brent R. “An artificial cell-cycle inhibitor isolated from a combinatorial library”. Proc Natl Acad Sci USA. 95(24): 142727(1998)]에 상세하게 개시되어 있다.The "aptamer" of the present invention is an oligonucleic acid or peptide molecule, and the general description of aptamers is described in the literature [Bock LC et al., Nature 355(6360):5646(1992); Hoppe-Seyler F, Butz K “Peptide aptamers: powerful new tools for molecular medicine”. J Mol Med. 78(8):42630 (2000); Cohen BA, Colas P, Brent R. “An artificial cell-cycle inhibitor isolated from a combinatorial library”. Proc Natl Acad Sci USA. 95(24): 142727 (1998).
본 발명의 상기 항체, PNA 및 앱타머는 본 발명의 상기 단백질의 아미노산 서열을 기초로 통상의 기술자가 쉽게 제작할 수 있다.The antibody, PNA and aptamer of the present invention can be easily prepared by a person skilled in the art based on the amino acid sequence of the protein of the present invention.
본 발명의 상기 유전자의 발현 수준을 측정할 수 있는 제제는 본 발명의 상기 유전자와 상보적으로 결합하여 그 발현 수준을 측정할 수 있는 것이라면 제한되지 않고 모두 포함될 수 있다. 예를 들면, 상기 유전자의 발현 수준을 측정할 수 있는 제제는 상기 유전자에 상보적으로 결합하는 프라이머, 프로브 및 안티센스 뉴클레오티드로 이루어진 군으로부터 선택되는 적어도 하나인 것일 수 있다.Any agent capable of measuring the expression level of the gene of the present invention may be included without limitation as long as it can measure the expression level by complementary binding to the gene of the present invention. For example, the agent capable of measuring the expression level of the gene may be at least one selected from the group consisting of primers, probes, and antisense nucleotides that complementarily bind to the gene.
본 발명의 상기 “프라이머”는 표적 유전자 서열을 인지하는 단편으로서, 정방향 및 역방향의 프라이머 쌍을 포함하나, 바람직하게는, 특이성 및 민감성을 가지는 분석 결과를 제공하는 프라이머 쌍이다. 프라이머의 핵산 서열이 시료 내 존재하는 비-표적 서열과 불일치하는 서열이어서, 상보적인 프라이머 결합 부위를 함유하는 표적 유전자 서열만 증폭하고 비특이적 증폭을 유발하지 않는 프라이머일 때, 높은 특이성이 부여될 수 있다.The "primer" of the present invention is a fragment that recognizes a target gene sequence, and includes a pair of forward and reverse primers, preferably a primer pair that provides analysis results having specificity and sensitivity. High specificity can be imparted when the nucleic acid sequence of the primer is a sequence that is inconsistent with the non-target sequence present in the sample, so that the primer amplifies only the target gene sequence containing a complementary primer binding site and does not cause non-specific amplification. .
본 발명의 상기 “프로브”란 시료 내의 검출하고자 하는 표적 물질과 상보적으로 결합할 수 있는 물질을 의미하며, 상기 결합을 통하여 특이적으로 시료 내의 표적 물질의 존재를 확인할 수 있는 물질을 의미한다. 프로브의 종류는 당업계에서 통상적으로 사용되는 물질로서 제한은 없으나, 바람직하게는 PNA(peptide nucleic acid), LNA(locked nucleic acid), 펩타이드, 폴리펩타이드, 단백질, RNA 또는 DNA일 수 있으며, 가장 바람직하게는 PNA이다. 보다 구체적으로, 상기 프로브는 바이오 물질로서 생물에서 유래되거나 이와 유사한 것 또는 생체 외에서 제조된 것을 포함하는 것으로, 예를 들어, 효소, 단백질, 항체, 미생물, 동식물 세포 및 기관, 신경세포, DNA, 및 RNA일 수 있으며, DNA는 cDNA, 게놈DNA, 올리고뉴클레오타이드를 포함하며, RNA는 게놈RNA, mRNA, 올리고뉴클레오타이드를 포함한다.The "probe" of the present invention means a substance capable of complementarily binding to a target substance to be detected in a sample, and means a substance capable of specifically confirming the presence of a target substance in a sample through the binding. The type of probe is not limited as a material commonly used in the art, but preferably may be peptide nucleic acid (PNA), locked nucleic acid (LNA), peptide, polypeptide, protein, RNA or DNA, and most preferably Most likely it is PNA. More specifically, the probe is a biomaterial, including one derived from or similar to a living organism or manufactured in vitro, for example, enzymes, proteins, antibodies, microorganisms, animal and plant cells and organs, nerve cells, DNA, and It may be RNA, DNA includes cDNA, genomic DNA, and oligonucleotides, and RNA includes genomic RNA, mRNA, and oligonucleotides.
본 발명의 상기 “LNA(Locked nucleic acids)”란, 2'-O, 4'-C 메틸렌 브릿지를 포함하는 핵산 아날로그를 의미한다[J Weiler, J Hunziker and J Hall Gene Therapy (2006) 13, 496.502]. LNA 뉴클레오사이드는 DNA와 RNA의 일반적 핵산 염기를 포함하며, Watson-Crick 염기 쌍 규칙에 따라 염기쌍을 형성할 수 있다. 하지만, 메틸렌 브릿지로 인한 분자의 ‘locking’으로 인해, LNA는 왓슨-크릭 결합에서 이상적 형상을 형성하지 못하게 된다. LNA가DNA 또는RNA 올리고뉴클레오티드에 포함되면, LNA는 보다 빠르게 상보적 뉴클레오티드 사슬과 쌍을 이루어 이중 나선의 안정성을 높일 수 있다.The "LNA (Locked nucleic acids)" of the present invention means a nucleic acid analog containing a 2'-O, 4'-C methylene bridge [J Weiler, J Hunziker and J Hall Gene Therapy (2006) 13, 496.502 ]. LNA nucleosides contain the common nucleic acid bases of DNA and RNA, and can base pair according to the Watson-Crick base pairing rules. However, due to molecular ‘locking’ due to methylene bridges, LNAs do not form ideal shapes in Watson-Crick bonds. When LNAs are included in DNA or RNA oligonucleotides, they can more rapidly pair with complementary nucleotide chains to increase the stability of the double helix.
본 발명의 상기 “안티센스”는 안티센스 올리고머가 왓슨-크릭 염기쌍 형성에 의해 RNA 내의 표적 서열과 혼성화되어, 표적서열 내에서 전형적으로 mRNA와 RNA : 올리고머 헤테로이중체의 형성을 허용하는, 뉴클레오티드 염기의 서열 및 서브유닛간 백본을 갖는 올리고머를 의미한다. 올리고머는 표적 서열에 대한 정확한 서열 상보성 또는 근사 상보성을 가질 수 있다.The "antisense" of the present invention is a sequence of nucleotide bases in which an antisense oligomer is hybridized with a target sequence in RNA by Watson-Crick base pairing, allowing formation of a typical mRNA and RNA: oligomeric heteroduplex in the target sequence and an oligomer having an inter-subunit backbone. Oligomers may have exact sequence complementarity or near complementarity to the target sequence.
본 발명의 상기 유전자의 발현 수준을 측정할 수 있는 제제는 본 발명의 상기 단백질에 대한 아미노산 서열을 토대로 그 유전자의 염기 서열을 도출할 수 있으므로, 통상의 기술자는 이를 바탕으로 상기 유전자에 상보적으로 결합하는 프라이머, 프로브 등을 쉽게 제작할 수 있다.Since the agent capable of measuring the expression level of the gene of the present invention can derive the nucleotide sequence of the gene based on the amino acid sequence for the protein of the present invention, a person skilled in the art can complement the gene based on this. Binding primers, probes, etc. can be easily prepared.
본 발명의 다른 구현 예에서는 IL-23에 의해 매개되는 질환의 중증도 예측용 키트를 제공한다.Another embodiment of the present invention provides a kit for predicting the severity of a disease mediated by IL-23.
본 발명의 상기 키트는 본 발명에 따른 상기 IL-23에 의해 매개되는 질환의 중증도 예측용 조성물을 포함한다.The kit of the present invention includes the composition for predicting the severity of a disease mediated by IL-23 according to the present invention.
본 발명의 상기 키트에서, IL-23에 의해 매개되는 질환, 중증도, 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원 등과 관련된 내용은 앞서 기재된 바와 동일하여, 명세서의 과도한 복잡성을 피하기 위해 생략한다.In the kit of the present invention, the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, and CD11c antigen are the same as described above, thereby avoiding excessive complexity of the specification. omit for
본 발명의 상기 키트는 RT-PCR 키트, DNA 칩 키트, ELISA 키트, 단백질 칩 키트, 래피드(rapid) 키트 또는 MRM(Multiple reaction monitoring) 키트일 수 있으나, 이에 제한되는 것은 아니다.The kit of the present invention may be an RT-PCR kit, a DNA chip kit, an ELISA kit, a protein chip kit, a rapid kit, or a multiple reaction monitoring (MRM) kit, but is not limited thereto.
본 발명의 상기 키트는 분석 방법에 적합한 한 종류 또는 그 이상의 다른 구성 성분 조성물, 용액 또는 장치를 더 포함할 수 있다. 예를 들면, 본 발명의 진단용 키트는 역전사 중합효소반응을 수행하기 위해 필요한 필수 요소를 더 포함할 수 있다. 역전사 중합효소반응 키트는 단백질을 코딩하는 유전자에 대해 특이적인 프라이머 쌍을 포함한다. 프라이머는 상기 유전자의 핵산서열에 특이적인 서열을 가지는 뉴클레오티드로서, 약 7bp 내 지 50bp의 길이, 보다 바람직하게는 약 10bp 내지 30bp의 길이를 가질 수 있다. 또한 대조군 유전자의 핵산 서열에 상보적인 프라이머를 포함할 수 있다. 그 외 역전사 중합효소반응 키트는 테스트 튜브 또는 다른 적절한 용기, 반응 완충액(pH 및 마그네슘 농도는 다양), 데옥시뉴클레오타이드(dNTPs), Taq-폴리머라아제 및 역전사효소와 같은 효소, DNase, RNase 억제제 DEPC-수(DEPC-water), 멸균수 등을 포함할 수 있다.The kit of the present invention may further include one or more other component compositions, solutions or devices suitable for the assay method. For example, the diagnostic kit of the present invention may further include essential elements necessary for carrying out the reverse transcription polymerase reaction. The reverse transcription polymerase reaction kit contains a pair of primers specific for a gene encoding a protein. The primer is a nucleotide having a sequence specific to the nucleic acid sequence of the gene, and may have a length of about 7 bp to 50 bp, more preferably about 10 bp to 30 bp. In addition, a primer complementary to the nucleic acid sequence of the control gene may be included. Other reverse transcription polymerase reaction kits contain a test tube or other suitable container, reaction buffer (with varying pH and magnesium concentration), deoxynucleotides (dNTPs), enzymes such as Taq-polymerase and reverse transcriptase, DNase and RNase inhibitor DEPC. -Water (DEPC-water), sterilized water, etc. may be included.
본 발명의 진단용 키트는 DNA 칩을 수행하기 위해 필요한 필수 요소를 포함할 수 있다. DNA 칩 키트는 유전자 또는 그의 단편에 해당하는 cDNA 또는 올리고뉴클레오티드(oligonucleotide)가 부착되어 있는 기판, 및 형광표지 프로브를 제작하기 위한 시약, 제제, 효소 등을 포함할 수 있다. 또한 기판은 대조군 유전자 또는 그의 단편에 해당하는 cDNA 또는 올리고뉴클레오티드를 포함할 수 있다.The diagnostic kit of the present invention may include essential elements required to perform a DNA chip. The DNA chip kit may include a substrate to which cDNA or oligonucleotides corresponding to genes or fragments thereof are attached, and reagents, reagents, enzymes, and the like for producing fluorescently labeled probes. In addition, the substrate may include a cDNA or oligonucleotide corresponding to a control gene or a fragment thereof.
본 발명의 진단용 키트는 ELISA를 수행하기 위해 필요한 필수 요소를 포함할 수 있다. ELISA 키트는 상기 단백질에 대해 특이적인 항체를 포함한다. 항체는 마커 단백질에 대한 특이성 및 친화성이 높고 다른 단백질에 대한 교차 반응성이 거의 없는 항체로, 단클론 항체, 다클론 항체 또는 재조합 항체이다. 또한 ELISA 키트는 대조군 단백질에 특이적인 항체를 포함할 수 있다. 그 외 ELISA 키트는 결합된 항체를 검출할 수 있는 시약, 예를 들면, 표지된2차 항체, 발색단(chromophores), 효소(예: 항체와 컨주게이트됨) 및 그의 기질 또는 항체와 결합할 수 있는 다른 물질 등을 포함할 수 있다.The diagnostic kit of the present invention may contain essential elements required to perform ELISA. ELISA kits contain antibodies specific for the protein. An antibody is an antibody that has high specificity and affinity for a marker protein and little cross-reactivity to other proteins, and is a monoclonal antibody, polyclonal antibody, or recombinant antibody. ELISA kits may also include antibodies specific for a control protein. Other ELISA kits include reagents capable of detecting bound antibodies, such as labeled secondary antibodies, chromophores, enzymes (eg, conjugated with antibodies) and substrates thereof or those capable of binding the antibody. may contain other substances and the like.
본 발명의 또 다른 구현 예에서는 IL-23에 의해 매개되는 질환의 중증도 예측을 위한 정보를 제공하는 방법을 제공한다.Another embodiment of the present invention provides a method for providing information for predicting the severity of a disease mediated by IL-23.
본 발명의 상기 방법은 목적하는 개체로부터 분리된 시료에서, 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원으로 이루어진 군으로부터 선택되는 어느 하나의 단백질; 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계;를 포함한다.In the method of the present invention, any one protein selected from the group consisting of CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen and CD11c antigen of monocytes in a sample isolated from a subject of interest; Or measuring the expression level of the gene encoding it; includes.
본 발명의 상기 방법에서, 정상 대조군과 비교하여 CD39 항원, CD9 항원 및 CD11b 항원은 표면에 발현되고, Ly6G 항원 및 CD11c 항원은 단핵구의 표면에 발현되지 않는 단핵구가 낮은 수준으로 존재하는 경우, 상기 질환의 중증도가 높은 것으로 예측할 수 있으나, 이에 제한되는 것은 아니다.In the method of the present invention, compared to a normal control group, when monocytes on the surface of which the CD39 antigen, CD9 antigen and CD11b antigen are expressed, and the Ly6G antigen and CD11c antigen are not expressed on the surface of monocytes are present at low levels, the disease The severity of can be predicted as high, but is not limited thereto.
본 발명의 상기 방법에서, IL-23에 의해 매개되는 질환, 중증도, 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원 등과 관련된 내용은 앞서 기재된 바와 동일하여, 명세서의 과도한 복잡성을 피하기 위해 생략한다.In the method of the present invention, the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, CD11c antigen, etc. are the same as described above, to avoid excessive complexity of the specification. omit for
본 발명의 상기 단백질의 발현 수준을 측정하는 단계는 단백질의 발현 수준을 측정할 수 있는 제제를 이용하여, 단백질 칩 분석, 면역측정법, 리간드 바인딩 어세이, MALDI-TOF(Matrix Assisted Laser Desorption/Ionization Time of Flight Mass Spectrometry) 분석, SELDI-TOF(Sulface Enhanced Laser Desorption/Ionization Time of Flight Mass Spectrometry) 분석, 방사선 면역 분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 로케트 면역전기영동, 조직면역 염색, 보체 고정 분석법, 2차원 전기영동 분석, 액상 크로마토그래피-질량분석(liquid chromatography-Mass Spectrometry, LC-MS), LC-MS/MS(liquid chromatography-Mass Spectrometry/ Mass Spectrometry), 유세포 분석, 웨스턴 블랏팅 및 ELISA(enzyme linked immunosorbentassay)로 이루어진 군으로부터 선택되는 적어도 하나인 것일 수 있다.The step of measuring the expression level of the protein of the present invention is carried out using a preparation capable of measuring the expression level of the protein, protein chip analysis, immunoassay, ligand binding assay, MALDI-TOF (Matrix Assisted Laser Desorption / Ionization Time of Flight Mass Spectrometry) analysis, SELDI-TOF (Sulface Enhanced Laser Desorption/Ionization Time of Flight Mass Spectrometry) analysis, radioimmunoassay, radioimmunodiffusion method, Oukteroni immunodiffusion method, rocket immunoelectrophoresis, tissue immunostaining, complement Immobilization method, two-dimensional electrophoretic analysis, liquid chromatography-Mass Spectrometry (LC-MS), liquid chromatography-Mass Spectrometry/ Mass Spectrometry (LC-MS/MS), flow cytometry, Western blotting and It may be at least one selected from the group consisting of ELISA (enzyme linked immunosorbent assay).
본 발명의 또 다른 구현 예에서는 IL-23에 의해 매개되는 질환의 예방 또는 치료용 세포치료제 조성물을 제공한다.Another embodiment of the present invention provides a cell therapy composition for preventing or treating diseases mediated by IL-23.
본 발명의 상기 조성물은 CD39 항원, CD9 항원 및 CD11b 항원을 발현하고; Ly6G 항원 및 CD11c 항원을 발현하지 않는 아형의 단핵구를 유효성분으로 포함한다.The composition of the present invention expresses CD39 antigen, CD9 antigen and CD11b antigen; Subtype monocytes that do not express Ly6G antigen and CD11c antigen are included as active ingredients.
본 발명의 상기 조성물에서, IL-23에 의해 매개되는 질환, 중증도, 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원 등과 관련된 내용은 앞서 기재된 바와 동일하여, 명세서의 과도한 복잡성을 피하기 위해 생략한다.In the composition of the present invention, the contents related to IL-23-mediated disease, severity, monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, CD11c antigen, etc. are the same as described above, to avoid excessive complexity of the specification. omit for
본 발명의 상기 “세포치료제”는 ‘세포의 조직과 기능을 복원시키기 위하여 살아있는 자가(autologus), 동종(allogenic), 또는 이종(xenogenic) 세포를 체외에서 증식·선별하거나 여타한 방법으로 세포의 생물학적 특성을 변화시키는 등의 일련의 행위를 통하여 치료, 진단 및 예방의 목적으로 사용되는 의약품’을 의미한다. 본 발명의 목적상 상기 세포치료제는 본 발명의 상기 항원의 발현 특성을 갖는 세포, 예를 들면 단핵구일 수 있으나, 이에 제한되는 것은 아니다.The "cell therapy agent" of the present invention refers to 'proliferating/selecting living autologous, allogenic, or xenogenic cells in vitro or using other methods to restore the tissue and function of cells. It means 'drugs used for the purpose of treatment, diagnosis, and prevention through a series of actions such as changing characteristics'. For the purpose of the present invention, the cell therapy agent may be a cell having the antigen expression characteristics of the present invention, for example, monocytes, but is not limited thereto.
본 발명의 일 구체 예에서, 상기 세포치료제에 해당하는 세포는 본 발명의 일실시 형태에서, 세포(예컨대, 단핵구)는 1Х105~5Х105, 5Х105~1Х106, 1Х106~2×106, 2Х106~3Х106, 3Х106~4Х106, 4Х106~5Х106, 5Х106~6Х106, 6Х106~7Х106, 7Х106~8Х106, 8Х106~1Х108, 1Х106~3Х106, 3Х106~5Х106, 5Х106~7Х106, 2Х106~4Х106, 1Х106~5Х106 또는 5Х106~1Х107개 중 어느 하나의 세포/개체의 투여량으로 투여될 수 있으나, 이에 제한되는 것은 아니다.In one embodiment of the present invention, the cells corresponding to the cell therapy agent, in one embodiment of the present invention, the cells (eg, monocytes) are 1Х10 5 ~ 5Х10 5 , 5Х10 5 ~ 1Х10 6 , 1Х10 6 ~ 2×10 6 2х10 6 ~ 3х10 6 , 3х10 6 ~ 4х10 6 , 4х10 6 ~ 5х10 6 , 5х10 6 ~ 6х10 6 , 6 ~ 10 6 ~ 7х10 6 , 7х10 6 ~ 8х10 6 6 to 5Х10 6 , 5Х10 6 to 7Х10 6 , 2Х10 6 to 4Х10 6 , 1Х10 6 to 5Х10 6 or 5Х10 6 to 1Х10 7 may be administered at any one cell/subject dose, but is not limited thereto .
본 발명의 상기 세포치료제는 항-IL-23 항체, 예를 들면 리산키주맙(Risankizumab)등과 병용 투여를 위해 사용될 수 있다.The cell therapy agent of the present invention may be used for combined administration with an anti-IL-23 antibody, for example, Risankizumab.
본 발명의 상기 항-IL-23 항체는 IL-23p19를 표적하는 것일 수 있으나, 이에 제한되는 것은 아니다.The anti-IL-23 antibody of the present invention may target IL-23p19, but is not limited thereto.
본 발명의 상기 세포치료제 조성물은 약학 조성물일 수 있다.The cell therapy composition of the present invention may be a pharmaceutical composition.
본 발명의 상기 “예방”은 질병 또는 병증의 발병을 억제하거나 지연시키는 모든 행위를 의미한다. 본 발명의 목적상 상기 조성물은 IL-23에 의해 매개되는 질환의 발병 시기를 지연시키거나, 발병을 억제하는 것을 의미한다.The above "prevention" of the present invention means any action that suppresses or delays the onset of a disease or condition. For the purpose of the present invention, the composition means to delay the onset of a disease mediated by IL-23 or to suppress the onset of the disease.
본 발명의 상기 “치료”는 질병 또는 병증의 진행을 지연, 중단 또는 역전시키는 모든 행위를 의미하는 것으로서, 본 발명의 목적상 상기 조성물은 IL-23에 의해 매개되는 질환의 진행을 중단, 경감, 완화 또는 없애거나 역전시키는 것을 의미한다.The "treatment" of the present invention refers to any action that delays, stops, or reverses the progression of a disease or condition, and for the purpose of the present invention, the composition is used to stop, alleviate, It means to alleviate or eliminate or reverse.
본 발명의 상기 약학 조성물은 캡슐, 정제, 과립, 주사제, 연고제, 분말 또는 음료 형태임을 특징으로 할 수 있으며, 상기 약학 조성물은 인간을 대상으로 하는 것을 특징으로 할 수 있다. The pharmaceutical composition of the present invention may be in the form of capsules, tablets, granules, injections, ointments, powders or beverages, and the pharmaceutical composition may be intended for humans.
본 발명의 상기 약학 조성물은 이들로 한정되는 것은 아니지만, 각각 통상의 방법에 따라 산제, 과립제, 캡슐, 정제, 수성 현탁액 등의 경구형 제형, 외용제, 좌제 및 멸균 주사 용액의 형태로 제형화하여 사용될 수 있다. 본 발명의 약학 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다. 상기 약학적으로 허용되는 담체는 경구 투여 시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있고, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다.The pharmaceutical compositions of the present invention are not limited thereto, but are formulated in the form of oral formulations such as powders, granules, capsules, tablets, aqueous suspensions, external preparations, suppositories, and sterile injection solutions according to conventional methods, respectively. can The pharmaceutical composition of the present invention may include a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier may be a binder, a lubricant, a disintegrant, an excipient, a solubilizer, a dispersant, a stabilizer, a suspending agent, a colorant, a flavoring agent, etc. for oral administration, and in the case of an injection, a buffer, a preservative, A pain reliever, solubilizer, isotonic agent, stabilizer, etc. may be mixed and used, and in the case of topical administration, a base, excipient, lubricant, preservative, etc. may be used.
본 발명의 상기 약학 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여시에는 정제, 트로키, 캡슐, 엘릭서(Elixir), 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수 회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 캡슐, 서방형 제제 등으로 제형화 할 수 있다.Formulations of the pharmaceutical composition of the present invention may be variously prepared by mixing with the pharmaceutically acceptable carrier as described above. For example, for oral administration, it can be prepared in the form of tablets, troches, capsules, elixirs, suspensions, syrups, wafers, etc., and in the case of injections, it can be prepared in unit dosage ampoules or multiple dosage forms. there is. In addition, it may be formulated into solutions, suspensions, tablets, capsules, sustained-release preparations, and the like.
본 발명의 상기 제제화에 적합한 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.Examples of carriers, excipients and diluents suitable for the formulation of the present invention include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate , cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or mineral oil may be used. In addition, fillers, anti-coagulants, lubricants, wetting agents, flavoring agents, emulsifiers, preservatives, and the like may be further included.
본 발명의 상기 약학 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 경구 또는 비경구 투하가 바람직하다. 본 발명에서 상기 “비경구”는 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골내 주사 또는 주입 기술을 포함한다. 또한, 상기 약학 조성물은 직장 투여를 위한 좌제의 형태로 투여될 수 있다.The route of administration of the pharmaceutical composition of the present invention is not limited thereto, but is not limited to oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intracardiac, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, This includes sublingual or rectal. Oral or parenteral administration is preferred. In the present invention, the "parenteral" includes subcutaneous, intradermal, intravenous, intramuscular, intraarticular, intrasynovial, intrasternal, intrathecal, intralesional and intracranial injection or infusion techniques. In addition, the pharmaceutical composition may be administered in the form of a suppository for rectal administration.
본 발명의 상기 약학 조성물은 사용된 특정 화합물의 활성, 연령, 체중, 일반적인 건강, 성별, 정식, 투여 시간, 투여 경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있고, 상기 약학 조성물의 투여량은 환자의 상태, 체중, 질병의 정도, 약무 형태, 투여 경로 및 기간에 따라 다르지만 당업자에 의해 적절하게 선택될 수 있고, 1일 0.0001 내지 50 mg/kg 또는 0.001 내지 50 mg/kg으로 투여할 수 있다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명에 따른 약학 조성물은 환제, 당의정, 캡슐, 액제, 겔, 시럽, 슬러리, 현탁제로 제형화될 수 있다.The pharmaceutical composition of the present invention depends on various factors including the activity of the specific compound used, age, body weight, general health, sex, diet, administration time, route of administration, excretion rate, drug combination and severity of the specific disease to be prevented or treated. The dosage of the pharmaceutical composition may be variously varied, and the dosage of the pharmaceutical composition varies depending on the patient's condition, body weight, disease severity, drug type, administration route and period, but may be appropriately selected by those skilled in the art, and is 0.0001 to 50 mg/day. kg or 0.001 to 50 mg/kg. Administration may be administered once a day, or may be administered in several divided doses. The dosage is not intended to limit the scope of the present invention in any way. The pharmaceutical composition according to the present invention may be formulated into a pill, dragee, capsule, liquid, gel, syrup, slurry, or suspension.
본 발명의 또 다른 구현 예에 따르면, 본 발명은 CD39 항원, CD9 항원 및 CD11b 항원을 발현하고; Ly6G 항원 및 CD11c 항원을 발현하지 않는 아형의 단핵구를 투여하는 단계를 포함하는 IL-23에 의해 매개되는 질환의 예방 또는 치료 방법을 제공한다. 본 발명에서 이용되는 단핵구 및 이를 이용하여 예방 또는 치료되는 IL-23에 의해 매개되는 질환에 대해서는 이미 상술하였으므로, 과도한 중복을 피하기 위해 그 기재를 생략한다.According to another embodiment of the present invention, the present invention expresses the CD39 antigen, the CD9 antigen and the CD11b antigen; Provided is a method for preventing or treating a disease mediated by IL-23 comprising administering subtype monocytes that do not express Ly6G antigen and CD11c antigen. Since monocytes used in the present invention and diseases mediated by IL-23 that are prevented or treated using the same have already been described above, description thereof is omitted to avoid excessive redundancy.
[서열목록][Sequence Listing]
서열번호 1: CD39 항원SEQ ID NO: 1: CD39 antigen
MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTMEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHT
SLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQ
HQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWIHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWI
TINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRTINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFR
LYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTPLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRDPCFHPGYKKVVNVSDLYKTP
CTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAF
SAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL
SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFL
MVLFSLVLFTVAIIGLLIFHKPSYFWKDMVMVLFSLVLFTVAIIGLLIFHKPSYFWKDMV
서열번호 2: CD9 항원SEQ ID NO: 2: CD9 antigen
MPVKGGTKCI KYLLFGFNFI FWLAGIAVLA IGLWLRFDSQ TKSIFEQETN MPVKGGTKCI KYLLFGFNFI FWLAGIAVLA IGLWLRFDSQ TKSIFEQETN
NNNSSFYTGV YILIGAGALM MLVGFLGCCG AVQESQCMLG LFFGFLLVIF NNNSSFYTGV YILIGAGALM MLVGFLGCCG AVQESQCMLG LFFGFLLVIF
AIEIAAAIWG YSHKDEVIKE VQEFYKDTYN KLKTKDEPQR ETLKAIHYAL AIEIAAAIWG YSHKDEVIKE VQEFYKDTYN KLKTKDEPQR ETLKAIHYAL
NCCGLAGGVE QFISDICPKK DVLETFTVKS CPDAIKEVFD NKFHIIGAVG NCCGLAGGVE QFISDICPKK DVLETFTVKS CPDAIKEVFD NKFHIIGAVG
IGIAVVMIFG MIFSMILCCA IRRNREMVIGIAVVMIFG MIFSMILCCA IRRNREMV
서열번호 3: Ly6G 항원SEQ ID NO: 3: Ly6G antigen
MDTCHIAKSC VLILLVVLLC AERAQGLECY NCIGVPPETS CNTTTCPFSD MDTCHIAKSC VLILLVVLLC AERAQGLECY NCIGVPPETS CNTTTCPFSD
GFCVALEIEV IVDSHRSKVK SNLCLPICPT TLDNTEITGN AVNVKTYCCK GFCVALEIEV IVDSHRSKVK SNLCLPICPT TLDNTEITGN AVNVKTYCCK
EDLCNAAVPT GGSSWTMAGV LLFSLVSVLL QTFLEDLCNAAVPT GGSSWTMAGV LLFSLVSVLL QTFL
서열번호 4: CD11b 항원SEQ ID NO: 4: CD11b antigen
MALRVLLLTA LTLCHGFNLD TENAMTFQEN ARGFGQSVVQ LQGSRVVVGA MALRVLLLTA LTLCHGFNLD TENAMTFQEN ARGFGQSVVQ LQGSRVVVGA
PQEIVAANQR GSLYQCDYST GSCEPIRLQV PVEAVNMSLG LSLAATTSPP PQEIVAANQR GSLYQCDYST GSCEPIRLQV PVEAVNMSLG LSLAATTSPP
QLLACGPTVH QTCSENTYVK GLCFLFGSNL RQQPQKFPEA LRGCPQEDSD QLLACGPTVH QTCSENTYVK GLCFLFGSNL RQQPQKFPEA LRGCPQEDSD
IAFLIDGSGS IIPHDFRRMK EFVSTVMEQL KKSKTLFSLM QYSEEFRIHF IAFLIDGSGS IIPHDFRRMK EFVSTVMEQL KKSKTLFSLM QYSEEFRIHF
TFKEFQNNPN PRSLVKPITQ LLGRTHTATG IRKVVRELFN ITNGARKNAF TFKEFQNNPN PRSLVKPITQ LLGRTHTATG IRKVVRELFN ITNGARKNAF
KILVVITDGE KFGDPLGYED VIPEADREGV IRYVIGVGDA FRSEKSRQEL KILVVITDGE KFGDPLGYED VIPEADREGV IRYVIGVGDA FRSEKSRQEL
NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM NTIASKPPRD HVFQVNNFEA LKTIQNQLRE KIFAIEGTQT GSSSSFEHEM
SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN SQEGFSAAIT SNGPLLSTVG SYDWAGGVFL YTSKEKSTFI NMTRVDSDMN
DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG DAYLGYAAAI ILRNRVQSLV LGAPRYQHIG LVAMFRQNTG MWESNANVKG
TQIGAYFGAS LCSVDVDSNG STDLVLIGAP HYYEQTRGGQ VSVCPLPRGR TQIGAYFGAS LCSVDVDSNG STDLVLIGAP HYYEQTRGGQ VSVCPLPRGR
ARWQCDAVLY GEQGQPWGRF GAALTVLGDV NGDKLTDVAI GAPGEEDNRG ARWQCDAVLY GEQGQPWGRF GAALTVLGDV NGDKLTDVAI GAPGEEDNRG
AVYLFHGTSG SGISPSHSQR IAGSKLSPRL QYFGQSLSGG QDLTMDGLVD AVYLFHGTSG SGISPSHSQR IAGSKLSPRL QYFGQSLSGG QDLTMDGLVD
LTVGAQGHVL LLRSQPVLRV KAIMEFNPRE VARNVFECND QVVKGKEAGE LTVGAQGHVL LLRSQPVLRV KAIMEFNPRE VARNVFECND QVVKGKEAGE
VRVCLHVQKS TRDRLREGQI QSVVTYDLAL DSGRPHSRAV FNETKNSTRR VRVCLHVQKS TRDRLREGQI QSVVTYDLAL DSGRPHSRAV FNETKNSTRR
QTQVLGLTQT CETLKLQLPN CIEDPVSPIV LRLNFSLVGT PLSAFGNLRP QTQVLGLTQT CETLKLQLPN CIEDPVSPIV LRLNFSLVGT PLSAFGNLRP
VLAEDAQRLF TALFPFEKNC GNDNICQDDL SITFSFMSLD CLVVGGPREF VLAEDAQRLF TALFPFEKNC GNDNICQDDL SITFSFMSLD CLVVGGPREF
NVTVTVRNDG EDSYRTQVTF FFPLDLSYRK VSTLQNQRSQ RSWRLACESA NVTVTVRNDG EDSYRTQVTF FFPLDLSYRK VSTLQNQRSQ RSWRLACESA
SSTEVSGALK STSCSINHPI FPENSEVTFN ITFDVDSKAS LGNKLLLKAN SSTEVSGALK STSCSINHPI FPENSEVTFN ITFDVDSKAS LGNKLLLKAN
VTSENNMPRT NKTEFQLELP VKYAVYMVVT SHGVSTKYLN FTASENTSRV VTSENNMPRT NKTEFQLELP VKYAVYMVVT SHGVSTKYLN FTASENTSRV
MQHQYQVSNL GQRSLPISLV FLVPVRLNQT VIWDRPQVTF SENLSSTCHT MQHQYQVSNL GQRSLPISLV FLVPVRLNQT VIWDRPQVTF SENLSSTCHT
KERLPSHSDF LAELRKAPVV NCSIAVCQRI QCDIPFFGIQ EEFNATLKGN KERLPSHSDF LAELRKAPVV NCSIAVCQRI QCDIPFFGIQ EEFNATLKGN
LSFDWYIKTS HNHLLIVSTA EILFNDSVFT LLPGQGAFVR SQTETKVEPF LSFDWYIKTS HNHLLIVSTA EILFNDSVFT LLPGQGAFVR SQTETKVEPF
EVPNPLPLIV GSSVGGLLLL ALITAALYKL GFFKRQYKDM MSEGGPPGAE EVPNPLPLIV GSSVGGLLLL ALITAALYKL GFFKRQYKDM MSEGGPPGAE
PQPQ
서열번호 5: CD11c 항원SEQ ID NO: 5: CD11c antigen
MTRTRAALLL FTALATSLGF NLDTEELTAF RVDSAGFGDS VVQYANSWVV MTRTRAALLL FTALATSLGF NLDTEELTAF RVDSAGFGDS VVQYANSWVV
VGAPQKITAA NQTGGLYQCG YSTGACEPIG LQVPPEAVNM SLGLSLASTT VGAPQKITAA NQTGGLYQCG YSTGACEPIG LQVPPEAVNM SLGLSLASTT
SPSQLLACGP TVHHECGRNM YLTGLCFLLG PTQLTQRLPV SRQECPRQEQ SPSQLLACGP TVHHECGRNM YLTGLCFLLG PTQLTQRLPV SRQECPRQEQ
DIVFLIDGSG SISSRNFATM MNFVRAVISQ FQRPSTQFSL MQFSNKFQTH DIVFLIDGSG SISSRNFATM MNFVRAVISQ FQRPSTQFSL MQFSNKFQTH
FTFEEFRRSS NPLSLLASVH QLQGFTYTAT AIQNVVHRLF HASYGARRDA FTFEEFRRSS NPLSLLASVH QLQGFTYTAT AIQNVVHRLF HASYGARRDA
AKILIVITDG KKEGDSLDYK DVIPMADAAG IIRYAIGVGL AFQNRNSWKE AKILIVITDG KKEGDSLDYK DVIPMADAAG IIRYAIGVGL AFQNRNSWKE
LNDIASKPSQ EHIFKVEDFD ALKDIQNQLK EKIFAIEGTE TTSSSSFELE LNDIASKPSQ EHIFKVEDFD ALKDIQNQLK EKIFAIEGTE TTSSSSFELE
MAQEGFSAVF TPDGPVLGAV GSFTWSGGAF LYPPNMSPTF INMSQENVDM MAQEGFSAVF TPDGPVLGAV GSFTWSGGAF LYPPNMSPTF INMSQENVDM
RDSYLGYSTE LALWKGVQSL VLGAPRYQHT GKAVIFTQVS RQWRMKAEVT RDSYLGYSTE LALWKGVQSL VLGAPRYQHT GKAVIFTQVS RQWRMKAEVT
GTQIGSYFGA SLCSVDVDSD GSTDLVLIGA PHYYEQTRGG QVSVCPLPRG GTQIGSYFGA SLCSVDVDSD GSTDLVLIGA PHYYEQTRGG QVSVCPLPRG
WRRWWCDAVL YGEQGHPWGR FGAALTVLGD VNGDKLTDVV IGAPGEEENR WRRWWCDAVL YGEQGHPWGR FGAALTVLGD VNGDKLTDVV IGAPGEEENR
GAVYLFHGVL GPSISPSHSQ RIAGSQLSSR LQYFGQALSG GQDLTQDGLV GAVYLFHGVL GPSISPSHSQ RIAGSQLSSR LQYFGQALSG GQDLTQDGLV
DLAVGARGQV LLLRTRPVLW VGVSMQFIPA EIPRSAFECR EQVVSEQTLV DLAVGARGQV LLLRTRPVLW VGVSMQFIPA EIPRSAFECR EQVVSEQTLV
QSNICLYIDK RSKNLLGSRD LQSSVTLDLA LDPGRLSPRA TFQETKNRSL QSNICLYIDK RSKNLLGSRD LQSSVTLDLA LDPGRLSPRA TFQETKNRSL
SRVRVLGLKA HCENFNLLLP SCVEDSVTPI TLRLNFTLVG KPLLAFRNLR SRVRVLGLKA HCENFNLLLP SCVEDSVTPI TLRLNFTLVG KPLLAFRNLR
PMLAADAQRY FTASLPFEKN CGADHICQDN LGISFSFPGL KSLLVGSNLE PMLAADAQRY FTASLPFEKN CGADHICQDN LGISFSFPGL KSLLVGSNLE
LNAEVMVWND GEDSYGTTIT FSHPAGLSYR YVAEGQKQGQ LRSLHLTCDS LNAEVMVWND GEDSYGTTIT FSHPAGLSYR YVAEGQKQGQ LRSLHLTCDS
APVGSQGTWS TSCRINHLIF RGGAQITFLA TFDVSPKAVL GDRLLLTANV APVGSQGTWS TSCRINHLIF RGGAQITFLA TFDVSPKAVL GDRLLLTANV
SSENNTPRTS KTTFQLELPV KYAVYTVVSS HEQFTKYLNF SESEEKESHV SSENNTPRTS KTTFQLELPV KYAVYTVVSS HEQFTKYLNF SESEEKESHV
AMHRYQVNNL GQRDLPVSIN FWVPVELNQE AVWMDVEVSH PQNPSLRCSS AMHRYQVNNL GQRDLPVSIN FWVPVELNQE AVWMDVEVSH PQNPSLRCSS
EKIAPPASDF LAHIQKNPVL DCSIAGCLRF RCDVPSFSVQ EELDFTLKGN EKIAPPASDF LAHIQKNPVL DCSIAGCLRF RCDVPSFSVQ EELDFTLKGN
LSFGWVRQIL QKKVSVVSVA EITFDTSVYS QLPGQEAFMR AQTTTVLEKY LSFGWVRQIL QKKVSVVSVA EITFDTSVYS QLPGQEAFMR AQTTTVLEKY
KVHNPTPLIV GSSIGGLLLL ALITAVLYKV GFFKRQYKEM MEEANGQIAP KVHNPTPLIV GSSIGGLLLL ALITAVLYKV GFFKRQYKEM MEEANGQIAP
ENGTQTPSPP SEKENGTQTPSPP SEK
본 발명은 IL-23에 의해 매개되는 질환의 중증도 예측용 조성물 및 예측을 위한 정보를 제공하는 방법에 관한 것으로서, 목적하는 시료 내 존재하는 CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 수가 정상 대조군과 비교하여 감소되어 있는 경우 NETosis가 효과적으로 억제되지 않아 상기 질환이 중증도를 나타내는 것을 통해 질환의 중증도를 예측할 수 있다.The present invention relates to a composition for predicting the severity of a disease mediated by IL-23 and a method for providing information for the prediction, wherein the number of CD39+CD9+Ly6G-CD11b+CD11c- monocytes present in a target sample is normal in the control group. If it is reduced compared to NETosis, the severity of the disease can be predicted by indicating the severity of the disease because NETosis is not effectively suppressed.
나아가, CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 경우 다른 단핵구의 도움 없이 직접 NETosis를 억제할 수 있기 때문에, 해당 단핵구를 사용하는 경우 IL-23에 의해 매개되는 질환을 매우 효과적으로 예방 또는 치료할 수 있을 뿐만 아니라, 기존의 항-IL-23 항체와 병용 투여를 위해 사용되는 경우 치료 효과를 현저하게 증가시킬 수 있다.Furthermore, since CD39+CD9+Ly6G-CD11b+CD11c- monocytes can directly suppress NETosis without the help of other monocytes, diseases mediated by IL-23 can be prevented or treated very effectively if the monocytes are used. In addition, the therapeutic effect can be significantly increased when used in combination with an existing anti-IL-23 antibody.
도1은 본 발명의 일 실시예에 따른 실험군에서 NETosis 현상을 형광 현미경을 통해 확인한 결과를 나타낸 것이다.Figure 1 shows the results of confirming the NETosis phenomenon through a fluorescence microscope in the experimental group according to an embodiment of the present invention.
도 2는 본 발명의 일 실시예에 따른 실험군에서 NETosis 현상을 군집화 지역의 면적을 수치화한 결과를 나타낸 것이다.Figure 2 shows the result of quantifying the area of the NETosis phenomenon clustering area in the experimental group according to an embodiment of the present invention.
도 3은 본 발명의 일 실시예에 따른 실험군에서 CD11b+CD11c- 세포 중에서 Ly6G+인 세포의 비율을 그래프로 나타낸 것이다.3 is a graph showing the ratio of Ly6G+ cells among CD11b+CD11c- cells in an experimental group according to an embodiment of the present invention.
도 4는 본 발명의 일 실시예에 따른 실험군에서 CD11b+CD11c- 세포 중에서 Ly6G-CD39+CD9+인 세포의 비율을 그래프로 나타낸 것이다.4 is a graph showing the ratio of Ly6G-CD39+CD9+ cells among CD11b+CD11c- cells in an experimental group according to an embodiment of the present invention.
도 5는 본 발명의 일 실시예에 따른 실험군에서 전체 세포 수를 개수하여 그래프로 나타낸 것이다.5 is a graph showing the total number of cells in an experimental group according to an embodiment of the present invention.
도 6은 본 발명의 일 실시예에 따른 실험군에서 호중구 세포 수를 개수하여 그래프로 나타낸 것이다.6 is a graph showing the number of neutrophil cells in an experimental group according to an embodiment of the present invention.
도 7 내지 9는 본 발명의 일 실시예에 따른 실험군의 혈청에서 측정된 사이토카인(IL-17, IL-22, IFN-감마)의 발현 수준을 그래프로 나타낸 것이다.7 to 9 are graphs showing the expression levels of cytokines (IL-17, IL-22, IFN-gamma) measured in the serum of the experimental group according to an embodiment of the present invention.
도 10은 본 발명의 일 실시예에 따른 조직 내 염증 세포의 침윤 정도를 H&E 염색을 통해 확인한 결과를 나타낸 것이다.10 shows the result of confirming the degree of infiltration of inflammatory cells in tissues according to an embodiment of the present invention through H&E staining.
도 11은 본 발명의 일 실시예에 따른 실험군에서 확인된 Penh 값을 그래프로 나타낸 것이다.11 is a graph showing the Penh values confirmed in the experimental group according to an embodiment of the present invention.
도 12는 본 발명의 일 실시예에 따른 실험군의 혈청에서 측정된 IL-23의 발현 수준을 그래프로 나타낸 것이다.12 is a graph showing the expression level of IL-23 measured in serum of an experimental group according to an embodiment of the present invention.
도 13은 본 발명의 일 실시예에 따른 CD39+ CD9+ 세포 유무에 따른 호중구의 NETosis 정도를 비교한 그래프이며, NETosis 정도는 MPO와 citH3의 군집화 지역의 면적에 의하여 측정되었다. 13 is a graph comparing the degree of NETosis of neutrophils according to the presence or absence of CD39+ CD9+ cells according to an embodiment of the present invention, and the degree of NETosis was measured by the area of the MPO and citH3 colonization area.
도 14은 본 발명의 일 실시예에 따른 부비동염의 중증도와 CD45+ 세포 중 CD39+ CD9+ 세포의 비율이 역상관 관계에 있음을 나타내는 그래프이다.14 is a graph showing an inverse correlation between the severity of sinusitis and the ratio of CD39+ CD9+ cells among CD45+ cells according to an embodiment of the present invention.
도 15는 본 발명의 일 실시예에 따른 가벼운 증상(mild) 및 중증(moderate-severe)으로 분류된 부비동염 환자의 코안의 천정에 있는 뼈(ethmoid) 점막 조직 내에 CD45 + 세포 중CD39 + CD9 + 세포의 비율을 그래프로 나타낸 것이다.Figure 15 is a CD39 + CD9 + cell among CD45 + cells in mucosal tissue of bone (ethmoid) in the roof of the nose of sinusitis patients classified as mild and moderate-severe according to an embodiment of the present invention. ratio is shown graphically.
도 16은 본 발명의 일 실시예에 따른 궤양성 대장염(Ulcerative Colitis, UC) 및 크론병(Crohn’s Disease, CD)에서 CD9, CD39 및 CD45의 발현량을 대조군(HC)와 비교한 상대적 풍부도로 히트맵(heat map)을 통하여 도시한 것이다.Figure 16 shows the expression levels of CD9, CD39, and CD45 in Ulcerative Colitis (UC) and Crohn's Disease (CD) according to an embodiment of the present invention, relative abundance compared to the control group (HC). It is shown through a heat map.
도 17은 본 발명의 일 실시예에 따라, CD9 또는 CD39의 발현량을 CD45와의 상대적인 풍부도로 측정한 것을 도시한 그래프이다.17 is a graph showing the measurement of the relative abundance of CD9 or CD39 expression level with CD45 according to an embodiment of the present invention.
도 18은 대조군, 궤양성 대장염(UC) 및 크론병(CD) 환자의 대장 점막에 대한 면역염색결과의 공초점 현미경 이미지(Confocal Microscopy Image)로써, CD9은 붉은색, CD39는 보라색, CD45는 녹색으로 염색되었다.18 is a confocal microscopy image of the immunostaining results of the colonic mucosa of control, ulcerative colitis (UC) and Crohn's disease (CD) patients, CD9 is red, CD39 is purple, and CD45 is green. dyed with
이하, 본 발명을 하기의 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 의해 한정되는 것은 아니다.Hereinafter, the present invention will be described in detail by the following examples. However, the following examples are only to illustrate the present invention, and the content of the present invention is not limited by the following examples.
실시예Example
실험방법Experiment method
[실험 방법 1] [Experiment method 1]
실험동물 마우스lab animal mouse
실험에 사용한 마우스는 야생형 C57BL/6 마우스(6-8 주령)를 오리엔트 바이오(경기도, 한국)에서 구입하여 사용하였다. 상기 마우스는 실험이 시작될 때까지 특정 병원체가 없는 조건에서 사육하였다. 이와 같은 동물 실험은 연세대학교 의과대학교 기관 심의위원회의 승인을 받아 수행하였다.Wild-type C57BL/6 mice (6-8 weeks old) were purchased from Orient Bio (Gyeonggi-do, Korea) and used as mice used in the experiment. The mice were bred under specific pathogen-free conditions until the experiment began. Such animal experiments were performed with the approval of the Institutional Review Board of Yonsei University College of Medicine.
[실험 방법 2] [Experiment method 2]
호산구 우세 및 호중구 우세 마우스 모델 제작Construction of eosinophil-dominant and neutrophil-dominant mouse models
호산구 우세 마우스 모델 제작은 다음과 같은 과정을 통해 수행하였다. 구체적으로, 0일에 수산화 알루미늄 2.5 mg에 200 ㎍의 OVA(Ovalbumin)을 복강 내 주사하여 마우스를 1차 감작하였다. 1차 감작을 수행한지 11일 후에, 동일한 양의 OVA를 복강 내 주사하여 감작하고, 10일 이후에 21일, 22일, 23일 각각에 상기 마우스를 마취시키고 50 ㎍의 OVA를 비강 내에 감작하였다. 마지막으로, 25일이 되는 때에 마우스에 100 ㎍의 OVA를 비강 내로 투여하고 48시간 이후에 마우스를 희생시켜 실험을 수행하였다.The production of the eosinophil-dominant mouse model was performed through the following process. Specifically, on day 0, mice were primary sensitized by intraperitoneal injection of 200 μg of OVA (Ovalbumin) in 2.5 mg of aluminum hydroxide. Eleven days after the first sensitization, the same amount of OVA was injected intraperitoneally to sensitize, and 10 days later, on days 21, 22, and 23, respectively, the mice were anesthetized and sensitized with 50 μg of OVA intranasally. . Finally, on day 25, mice were intranasally administered with 100 μg of OVA, and mice were sacrificed 48 hours later to perform the experiment.
호중구 우세 마우스 모델 제작은 다음과 같은 과정을 통해 수행하였다. 구체적으로, 0일, 1일 및 2일에 100 ㎍의 LPS(E. coli) 및 75 ㎍의 OVA를 비강 내 주사하여 마우스를 감작하였다. 2일에 해당하는 3차 감작 5일 후, 동일한 양의 LPS 및 OVA를 비강 내 주사하는 과정을 통해 감작을 수행하였다. 이렇게, 마지막 감작한지 7일 후, 14일, 15일, 21일 및 22일 각각에 PBS에 녹인 50 ㎍의 OVA를 마우스의 비강 내 주사하는 과정을 통해 감작하고 48시간 이후에 마우스를 희생시켜 실험을 수행하였다.The production of the neutrophil-dominant mouse model was performed through the following process. Specifically, on days 0, 1 and 2, mice were sensitized by intranasal injection of 100 μg of LPS (E. coli) and 75 μg of OVA. After 5 days of the third sensitization corresponding to 2 days, sensitization was performed by intranasal injection of the same amount of LPS and OVA. Thus, 7 days after the last sensitization, 14 days, 15 days, 21 days, and 22 days, respectively, 50 μg of OVA dissolved in PBS was intranasally injected into mice, and mice were sacrificed 48 hours later to experiment was performed.
[실험 방법 3] [Experiment method 3]
중화 항체 및 덱사메타손 억제제 처리Treatment with neutralizing antibodies and dexamethasone inhibitors
IL-23p19 중화항체(BioxCell, West Lebanon, NH, USA)는 마우스 한 마리당 400 ㎍의 양을 상기 실험 방법 2에 기재된 최초 감작 1시간 전에 복강 내로 주사하였다. 또한, 덱사메타손(Dexamethasone, Sigma-Aldrich, St. Louis, MO)의 경우, 마우스 한 마리당 1 mg/kg의 양으로 상기 실험 방법 2에 기재된 최초 감작 1시간 전에 복강 내로 주사하였다.IL-23p19 neutralizing antibody (BioxCell, West Lebanon, NH, USA) was intraperitoneally injected in an amount of 400 μg per mouse 1 hour before the first sensitization described in Experimental Method 2 above. In addition, in the case of dexamethasone (Sigma-Aldrich, St. Louis, MO), an amount of 1 mg/kg per mouse was intraperitoneally injected 1 hour before the first sensitization described in Experimental Method 2 above.
대조군의 경우, 400 ㎍의 마우스 IgG2a 아이소타입을 이용하여 상기 중화항체와 동일한 시간대에 복강 내로 주사하였으며, POM1 (20 mg/kg per mouse, TOCRIS a biotechne brand), aCD9 (20 mg/kg per mouse, BD Pharmingen) 및 GSK484(4 mg/kg per mouse, CAYMAN CHEMICAL COMPANY)는 모두 상기 중화항체와 동일한 시간대에 복강 내로 주사하였다.In the case of the control group, 400 μg of mouse IgG2a isotype was intraperitoneally injected at the same time as the neutralizing antibody, and POM1 (20 mg/kg per mouse, TOCRIS a biotechne brand), aCD9 (20 mg/kg per mouse, BD Pharmingen) and GSK484 (4 mg/kg per mouse, CAYMAN CHEMICAL COMPANY) were injected intraperitoneally at the same time as the neutralizing antibody.
[실험 방법 4] [Experiment method 4]
메타콜린(methacholine) AHR 측정 방법How to measure methacholine AHR
상기 실험 방법 2에 기재된 OVA 감작 반응을 수행한지 24시간 후에, 의식이 있는 마우스에서 전신 혈량 측정법(WBP; Buxco Research Systems, Wilmington, NC)을 이용하여 흡입 메타 콜린(Sigma-Aldrich, St. Louis, MO)에 대한 반응을 측정하였다.24 hours after performing the OVA sensitization reaction described in Test Method 2 above, inhaled methacholine (Sigma-Aldrich, St. Louis, MO) was measured.
[실험 방법 5] [Experiment method 5]
H&E 염색 방법H&E staining method
실험 동물의 폐 조직을 수집하고, 4% 포름알데히드 용액에 고정한 후, 파라핀으로 포매하여 블록을 제작하였다. 그런 다음, 상기 블록을 3 ㎛ 두께의 절편을 제작하였다. 폐 조직의 H&E 염색을 위해 파라핀 절편을 60 ℃에서 30분간 말린 후, 자일렌으로 15분간 탈피시키고 100%, 95%, 80%, 75% 알코올 순서대로 함수시켰다. 준비된 조직 슬라이드를 헤마톡실린(hematoxylin) 용액을 떨어뜨려 3분간 반응시키고 증류수로 1분씩 3회 세척한 후 에오신(eosin) 용액으로 10분간 반응시키고 증류수로 세척하였다. 이를 퍼마운트로 마운팅(mounting)한 후 광학현미경을 이용하여 폐조직의 구조적 변화를 관찰하였다. 이때 헤마톡실린은 염기성으로 세포 핵 내 염색질과 핵 막을 염색하여 보라색으로 나타나며, 산성 염색약인 에오신은 염기를 띠는 세포질 단백질과 콜라겐 등과 결합하여 분홍색으로 관찰된다.Lung tissues of experimental animals were collected, fixed in a 4% formaldehyde solution, and then embedded in paraffin to make blocks. Then, the blocks were made into 3 μm thick slices. For H&E staining of lung tissue, paraffin sections were dried at 60 °C for 30 minutes, peeled with xylene for 15 minutes, and hydrated with 100%, 95%, 80%, and 75% alcohol in that order. The prepared tissue slide was reacted for 3 minutes by dropping hematoxylin solution, washed with distilled water three times for 1 minute each, reacted with eosin solution for 10 minutes, and washed with distilled water. After mounting it with a permount, structural changes in the lung tissue were observed using an optical microscope. At this time, hematoxylin stains the chromatin and nuclear membrane in the cell nucleus with a basic dye, and appears purple, and eosin, an acidic dye, combines with basic cytoplasmic proteins and collagen, and is observed pink.
[실험 방법 6] [Experiment method 6]
Penh 측정방법Penh measurement method
Penh는 기도저항을 나타내는 지표로서, 상기 마우스 모델에서 기도저항 측정기를 이용하여 측정된 값을 다음과 같은 공식을 통해 수치화하여 Penh를 도출하였다.Penh is an index representing airway resistance, and Penh was derived by quantifying the value measured using the airway resistance meter in the mouse model through the following formula.
[식 1][Equation 1]
Penh = (Te/RT-1) X PEF(peak expiratory flow rat, mL/s)/PIF(peak inspiratory flow rat, mL/s)Penh = (Te/RT-1) X PEF (peak expiratory flow rat, mL/s)/PIF (peak inspiratory flow rat, mL/s)
Te: 흡기 끝에서 다음 흡기까지(expiratory time, sec)Te: from the end of inspiration to the next inspiration (expiratory time, sec)
RT: 호기동안 호기양이 일회호흡양의 30%가 남을 때까지 걸리는 시간(relaxation time, sec)RT: Time taken for the expiratory volume to remain at 30% of the tidal volume during expiration (relaxation time, sec)
[실험 방법 7] [Experiment method 7]
사이토카인농도측정Measurement of cytokine concentration
상기 마우스 모델의 혈청에서 IL-17, IL-22, IFN-감마 및 IL-23이 존재하는 수준을 ELISA 키트를 이용하여 측정하였다. 구체적으로 96-웰ELISA 플레이트에0.1 M 소듐 카르보네이트 용액으로 희석한 1차 항체를 100 ㎕씩 넣은 후 4℃에서 하룻밤 반응시켰다. 이후, 상기 플레이트를 1 X 세척 완충액으로 3회 세척한 후 10% BSA가 함유된 1 X PBS를 각 웰에 넣어 실온에서 1시간 동안 정치함으로써 차단하였다. 그런 다음, 상기 각 웰에 혈청을 100 ㎕씩 넣어 실온에서 2시간 반응시킨 후 5회 1 X 세척 완충액으로 세척하고 퍼옥시다제(peroxidase)가 결합된HRP-결합 2차 항체를 넣고 실온에서 1시간 반응시켰다. 이를 다시 5회 세척한 다음 기질용액(TMB)을 넣어 10분 동안 암실조건에서 반응시킴으로써 발색을 유도하였다. 반응종료 후 각 웰에 정지액을 50 ㎕씩 넣어 효소반응을 정지시킨 후 마이크로플레이트 리더를 이용하여 450 nm에서 흡광도를 측정하였다. 혈청 내 사이토카인의 농도는 표준용액의 정량곡선을 기준으로 계산하였다.The levels of IL-17, IL-22, IFN-gamma, and IL-23 present in the serum of the mouse model were measured using an ELISA kit. Specifically, 100 μl of the primary antibody diluted in 0.1 M sodium carbonate solution was added to a 96-well ELISA plate and reacted at 4° C. overnight. Thereafter, the plate was washed three times with 1X washing buffer, and then 1X PBS containing 10% BSA was put into each well and allowed to stand at room temperature for 1 hour to block the plate. Then, 100 μl of serum was added to each well, reacted at room temperature for 2 hours, washed 5 times with 1X washing buffer, and peroxidase-conjugated HRP-conjugated secondary antibody was added and incubated for 1 hour at room temperature. reacted After washing it again 5 times, color development was induced by adding substrate solution (TMB) and reacting in the dark for 10 minutes. After completion of the reaction, 50 μl of the stop solution was added to each well to stop the enzyme reaction, and the absorbance was measured at 450 nm using a microplate reader. The concentration of cytokines in serum was calculated based on the quantification curve of the standard solution.
[실험 방법 8] [Experiment method 8]
면역세포 표현형 확인Immune cell phenotype confirmation
상기 마우스 모델로부터 기관지 폐포 세척액을 수득한 뒤, PBS를 이용하여 1회 세척하고, 형광 물질이 결합된 항체들과 혼합한 뒤에 4℃에서 1시간 동안 반응시키고 유세포 분석기를 사용하여 폐 세포에 존재하는 면역 세포의 표현형을 확인하였다.Bronchoalveolar lavage fluid was obtained from the mouse model, washed once with PBS, mixed with fluorescent substance-conjugated antibodies, reacted at 4° C. for 1 hour, and analyzed by flow cytometry to detect The phenotype of the immune cells was confirmed.
실험 결과Experiment result
[실험 결과 1] [Experiment Result 1]
NETosis 억제에서 단핵구의 역할 확인Confirmation of the role of monocytes in suppressing NETosis
NDA(neutrophil-dominant asthma) 모델에서 CD39 및 CD9가 호중구 염증의 항-IL-23p19 매개 억제를 어떻게 조절하는지 확인하였다. 이를 위해 citH3 및 MPO가 포함된 이중 양성 세포 계수를 하기 표 1에 표시된 것과 같은 실험군에서 확인하여, NETosis 정도를 비교하고 그 결과를 도 1 및 2에 나타내었다.In the neutrophil-dominant asthma (NDA) model, we confirmed how CD39 and CD9 regulate anti-IL-23p19-mediated inhibition of neutrophil inflammation. To this end, double-positive cell counts including citH3 and MPO were confirmed in the experimental groups as shown in Table 1 below, and the degree of NETosis was compared, and the results are shown in FIGS. 1 and 2 .
구분division | 표기Mark | 내용detail |
실험군 1 |
■■ | OVA + LPS / PBSOVA + LPS / PBS |
실험군 2 |
▼▼ | OVA + LPS / OVAOVA + LPS / OVA |
실험군 3 |
△△ | OVA + LPS / OVA + GSK484OVA + LPS / OVA + GSK484 |
실험군 4experimental group 4 | XX | OVA + LPS / OVA + αIL23p19OVA + LPS / OVA + αIL23p19 |
실험군 5 |
** | OVA + LPS / OVA + αIL23p19 + POM1OVA + LPS / OVA + αIL23p19 + POM1 |
실험군 6 |
++ | OVA + LPS / OVA +αIL23p19 + POM1 +GSK484OVA + LPS / OVA + αIL23p19 + POM1 + GSK484 |
실험군 7experimental group 7 | ●● | OVA + LPS / OVA + αIL23p19 + αCD9OVA + LPS / OVA + αIL23p19 + αCD9 |
실험군 8 |
○○ | OVA + LPS / OVA + αIL23p19 + αCD + GSK484OVA + LPS / OVA + αIL23p19 + αCD + GSK484 |
* OVA + LPS: 호중구 우세 동물 모델 유도 * GSK484: NETosis 억제제 ** αIL23p19: 항-IL-23p19 항체 *** POM1: Ecto-NTPDases 억제제 **** αCD9: 항-CD9 항체* OVA + LPS: Induction of a neutrophil-dominant animal model * GSK484: NETosis inhibitor ** αIL23p19: anti-IL-23p19 antibody ***POM1: Inhibitor of Ecto-NTPDases **** αCD9: anti-CD9 antibody |
도 1 및 도 2에서 보는 바와 같이, 실험군 1과 비교하여 실험군 2에서 NETosis가 증가되었으며, 실험군 3 및 실험군 4에서 NETosis가 현저하게 감소되었다. 나아가, 실험군 4에서 감소된 NETosis가 POM1을 처리한 실험군 5에서 다시 실험군 1과 같이 증가되었으며, 여기에 GSK484를 다시 처리한 실험군 6에서 다시 감소되었다. 또한, 실험군 7에서 보는 바와 같이, 항-CD9 항체를 처리하였을 때 POM1 처리와 동일하게 NETosis가 증가되었다. 이에 더하여, 실험군 8에서 보는 바와 같이, 항-CD9 항체를 처리하여 NETosis가 증가된 효과는 GSK484의 처리에 의해 감소되었다.상기 결과를 통해, 호중구 우세 천식에서 IL-23에 의존적인 NETosis가 수지상세포와 IL-23을 생성하는 면역 세포를 활성화시켜 염증을 유발할 수 있고, 이렇게 유발된 NETosis의 억제에 CD9가 관여하는 것을 알 수 있다.As shown in FIGS. 1 and 2 , NETosis was increased in Experimental Group 2 compared to Experimental Group 1, and NETosis was significantly reduced in Experimental Groups 3 and 4. Furthermore, NETosis decreased in Experimental Group 4 was increased again in Experimental Group 5 treated with POM1 as in Experimental Group 1, and decreased again in Experimental Group 6 treated with GSK484. Also, as shown in Experimental Group 7, NETosis was increased in the same way as POM1 treatment when treated with anti-CD9 antibody. In addition, as shown in Experimental Group 8, the effect of increasing NETosis by treatment with anti-CD9 antibody was reduced by treatment with GSK484. Through the above results, IL-23-dependent NETosis in neutrophil-dominant asthma was reduced by dendritic cell and IL-23-producing immune cells can be activated to induce inflammation, and it can be seen that CD9 is involved in the suppression of NETosis induced in this way.
상기 표 1에 표시된 실험군으로부터 수득된 기관지 폐포 세척액(bronchoalveolar lavage fluid, BALF) 내에서 LyG+CD11b+CD11c-, Ly6G-CD39+CD9+CD11b+CD11c-, 전체 세포 수, 호중구 수 및 사이토카인(IL-23, IL-17, IL-22 및 IFN-감마)이 존재하는 수준을 측정하여, 그 결과를 도 3 내지 10에 나타내었다.LyG + CD11b + CD11c-, Ly6G-CD39 + CD9 + CD11b + CD11c-, total cell count, neutrophil count and cytokine (IL -23, IL-17, IL-22 and IFN-gamma) were measured, and the results are shown in FIGS. 3 to 10.
도 3 및 4에서 보는 바와 같이, Ly6G+CD11b+CD11c- 호중구 비율 (도 3)과는 대조적으로, 실험군 2에서 감소되어 있던 CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 비율이 항-IL-23p19 및 GSK484를 처리한 실험군 3 및 4에서 증가되었다. 또한, 실험군 5에서 감소된 CD39+CD9+Ly6G-CD11b+CD11c- 단핵구는 GSK484가 처리된 실험군 6 및 실험군 8에서 증가되었다.As shown in FIGS. 3 and 4, in contrast to the Ly6G+CD11b+CD11c- neutrophil ratio (FIG. 3), the CD39+CD9+Ly6G-CD11b+CD11c- monocyte ratio, which was reduced in Experimental Group 2, was anti-IL- It was increased in experimental groups 3 and 4 treated with 23p19 and GSK484. In addition, the CD39+CD9+Ly6G-CD11b+CD11c- monocytes decreased in Experimental Group 5 were increased in Experimental Groups 6 and 8 treated with GSK484.
상기 결과를 통해, CD39 및 CD9 모두 IL-23에 의존되는 호중구의 확장을 억제하고 호중구 우세 마우스 동물 모델의 폐에서 NETosis의 억제를 유도할 수 있음을 알 수 있다. Through the above results, it can be seen that both CD39 and CD9 inhibit IL-23-dependent expansion of neutrophils and induce suppression of NETosis in the lung of a neutrophil-dominant mouse animal model.
도 5 내지 11에서 보는 바와 같이, 실험군 2, 실험군 5 및 실험군 7에서 증가된 BALF 내 전체 세포 수(도 5)와, 호중구 수(도 6), IL-17(도 7), IL-22(도 8), IFN-감마(도 9), 면역세포 침윤(도 10) 및 Pehn 값(도 11) 이 실험군 3, 실험군 4, 실험군 6 및 실험군 8에서 감소되었다.As shown in FIGS. 5 to 11, the total number of cells in BALF (FIG. 5), the number of neutrophils (FIG. 6), IL-17 (FIG. 7), and IL-22 (FIG. 7) increased in experimental groups 2, 5, and 7. 8), IFN-gamma (FIG. 9), immune cell infiltration (FIG. 10), and Pehn value (FIG. 11) were decreased in experimental group 3, experimental group 4, experimental group 6, and experimental group 8.
도 12에서 보는 바와 같이, 실험군 1 내지 4에서 IL-23이 존재하는 수준을 확인한 결과, IL-23이 존재하는 수준은 IL-17, IL-22 및 Th-1 세포를 매개로하는 사이토카인인 IFN-감마와 유사하게 실험군 1과 비교하여 실험군 2에서 증가되었으며, 이렇게 증가된 값은 실험군 3 및 실험군 4에서 감소되었다. 나아가, 실험군 3에서 감소된 IL-23의 발현 수준은 POM1 및 항-CD9 항체를 처리한 실험군 5 및 실험군 7에서 다시 실험군 2와 동일한 수준으로 증가되었다.As shown in FIG. 12, as a result of confirming the level of IL-23 present in Experimental Groups 1 to 4, the level of IL-23 present is IL-17, IL-22, and Th-1 cell-mediated cytokine. Similar to IFN-gamma, it was increased in Experimental Group 2 compared to Experimental Group 1, and this increased value was decreased in Experimental Groups 3 and 4. Furthermore, the expression level of IL-23 decreased in Experimental Group 3 was increased to the same level as Experimental Group 2 in Experimental Groups 5 and 7 treated with POM1 and anti-CD9 antibody.
상기 결과를 통해 CD39와 CD9 모두 호중구 우세 마우스 동물 모델에서 NETosis의 억제를 통해 IL-23에 의존되는 호중구 염증을 억제할 수 있음을 알 수 있다.From the above results, it can be seen that both CD39 and CD9 can suppress IL-23-dependent neutrophil inflammation through inhibition of NETosis in a neutrophil-dominant mouse animal model.
[실험 결과 2] [Experiment Result 2]
CD39+CD9+Ly6G-CD11b+CD11c- 단핵구의 NETosis 억제 방식 확인CD39+CD9+Ly6G-CD11b+CD11c- Identification of NETosis suppression method of monocytes
CD39+CD9+Ly6G-CD11b+CD11c- 단핵구가 Ly6G+CD11b+CD11c- 호중구의 NETosis를 직접 억제하는지 확인하기 위해, CD39-CD9-Ly6G+CD11b+CD11c- 호중구의 NETosis를 실험군 4로부터 분리된 CD39+CD9+Ly6G-CD11b+CD11c- 단핵구가 존재 또는 존재하지 않는 호중구 우세 마우스 모델에서 MPO, Cit 히스톤 H3 및 DAPI를 이용하여 염색한 뒤에 형광 현미경을 통해 분석하여, 그 결과를 도13에 나타내었다.To confirm that CD39+CD9+Ly6G-CD11b+CD11c- monocytes directly suppress NETosis of Ly6G+CD11b+CD11c- neutrophils, NETosis of CD39-CD9-Ly6G+CD11b+CD11c- neutrophils was compared with CD39+ CD11c- isolated from Experimental Group 4. In a neutrophil-dominant mouse model with or without monocytes, CD9+Ly6G-CD11b+CD11c- monocytes were stained with MPO, Cit histone H3, and DAPI, followed by fluorescence microscopy analysis, and the results are shown in FIG. 13 .
도 13에서 보는 바와 같이, CD39-CD9-Ly6G+CD11b+CD11c- 호중구 (neutrophil only)에서 확인되는 다량의 NETosis가CD39+CD9+Ly6G-CD11b+CD11c- 단핵구(anti cell)를 추가하자 완전히 감소되는 것을 확인하였다.As shown in FIG. 13, CD39-CD9-Ly6G+CD11b+CD11c-a large amount of NETosis found in neutrophils (neutrophil only) was completely reduced when CD39+CD9+Ly6G-CD11b+CD11c-monocytes (anti cells) were added. confirmed that
상기 결과를 통해, 다른 CD39+CD9+ 면역 세포를 제외한 CD39+CD9+ Ly6G-CD11b+CD11c- 단핵구가 CD39 및 CD9에 의존적인 방식으로Ly6G+CD11b+CD11c- 호중구의 NETosis를 직접 억제하는 것을 알 수 있다.Through the above results, it can be seen that CD39+CD9+ Ly6G-CD11b+CD11c- monocytes, excluding other CD39+CD9+ immune cells, directly suppress NETosis of Ly6G+CD11b+CD11c- neutrophils in a manner dependent on CD39 and CD9.
[실험 결과 3] [Experiment Result 3]
부비동염 환자에서 CD39+CD9+ 세포의 비율 확인Identification of the percentage of CD39+CD9+ cells in patients with sinusitis
부비동염 환자를 가벼운 증상(mild) 및 중증(moderate-severe)으로 분류하고, 환자의 코안의 천정에 있는 뼈(ethmoid) 점막을 채취하여 해당 조직 내에 CD45+ 세포 중 CD39+CD9+ 세포의 비율을 측정하여, 그 결과를 도 14 및 15에 나타내었다.Sinusitis patients are classified into mild symptoms and moderate-severe, and the ratio of CD39+CD9+ cells among CD45+ cells in the tissue is measured by collecting the bone (ethmoid) mucous membrane on the ceiling of the patient's nose, The results are shown in Figures 14 and 15.
도 14 및 15에서 보는 바와 같이, 중증으로 분류된 만성 부비동염 환자의 코안의 천정에 있는 뼈 점막에서 내에 CD45+ 세포 중 CD39+CD9+ 세포의 비율이 가벼운 증상의 경우와 비교하여 매우 낮은 수준으로 존재, 즉 역상관관계가 있는 것을 확인하였다.As shown in Figures 14 and 15, the ratio of CD39 + CD9 + cells among CD45 + cells in the bone mucosa at the ceiling of the nose of patients with chronic sinusitis classified as severe is at a very low level compared to the case of mild symptoms, that is, It was confirmed that there is an inverse correlation.
상기 결과를 통해, 천식 이외에도 IL-23에 의해 매개되는 질환인 부비동염에서 CD39+CD9+ 세포의 비율이 감소되어 있는 경우에는 그 질환이 중증인 것을 알 수 있다.Through the above results, it can be seen that, in addition to asthma, when the ratio of CD39+CD9+ cells is decreased in sinusitis, a disease mediated by IL-23, the disease is severe.
[실험 결과 4] [Experiment Result 4]
염증성 장 질환 환자에서 CD39+CD9+ 세포의 비율 확인Determination of the percentage of CD39+CD9+ cells in patients with inflammatory bowel disease
IL-23-Th17 신호전달 경로의 과도한 활성화가 염증성 장 질환(Inflammatory Bowel Disease, IBD)의 발생의 원인인 것에 착안하여, IBD환자의 대장 점막에서 CD39+CD9+ 면역 세포의 숫자가 적을 것이라고 가정하였다. 이를 확인하기 위하여 IBD환자 14명을 포함하여, 궤양성 대장염(Ulcerative Colitis, UC) 7명, 크론병(Chrohn’s Disease, CD) 7명 및 정상 대조군(HC) 7명의 대장 점막에서 CD9 또는 CD39의 CD45에 대한 단백질 발현 비율을 확인하였다. 이를 확인하는데 본 발명자들의 이전 실험에서 사용하였던 단백질체 분석(Proteomics Analysis) 결과을 이용하였다. 건강한 대조군(HC)와 비교하여 UC와 CD에서 CD9의 CD45에 대한 발현율이 1/3 수준을 보였다. 반면, CD39의 CD45에 대한 발현율은 UC/CD와 건강한 대조군을 비교했을 때 유의한 차이가 없었다(도 16 및 17). 이러한 단백질체 분석 결과와 일관되게, CD39+CD9+CD45+ 세포는 건강한 대조군(HC)의 대장 점막에서 관찰되었지만, UC와 CD 환자에서는 관찰되지 않았다(도 18).Considering that excessive activation of the IL-23-Th17 signaling pathway is the cause of inflammatory bowel disease (IBD), it was hypothesized that the number of CD39+CD9+ immune cells in the colonic mucosa of IBD patients would be low. To confirm this, CD45 of CD9 or CD39 in the colonic mucosa of 7 patients with Ulcerative Colitis (UC), 7 patients with Crohn's Disease (CD) and 7 healthy controls (HC), including 14 patients with IBD. The protein expression ratio for was confirmed. To confirm this, the results of proteomics analysis used in previous experiments by the present inventors were used. Compared to the healthy control group (HC), the expression rate of CD9 on CD45 was 1/3 in UC and CD. On the other hand, there was no significant difference in the expression rate of CD39 to CD45 when comparing UC/CD and healthy controls (FIG. 16 and 17). Consistent with these proteomic analysis results, CD39+CD9+CD45+ cells were observed in the colonic mucosa of healthy controls (HC), but not in UC and CD patients (FIG. 18).
상기 실험 결과에서 관찰된 NDA 모델, 중증 CRS 환자, IBD 환자에서의 낮은 CD39+CD9+ 면역 세포수를 통하여, 해당 면역세포가 IL-23-Th17 세포-연관 면역 질환의 치료에 대한 중요한 타겟으로 활용될 수 있음을 확인할 수 있었다. Through the low number of CD39+CD9+ immune cells in the NDA model, severe CRS patients, and IBD patients observed in the above experimental results, the immune cells can be used as an important target for the treatment of IL-23-Th17 cell-associated immune diseases. I was able to confirm that it could.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.Having described specific parts of the present invention in detail above, it is clear that these specific techniques are only preferred embodiments for those skilled in the art, and the scope of the present invention is not limited thereto. Accordingly, the substantial scope of the present invention will be defined by the appended claims and equivalents thereof.
Claims (20)
- 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원으로 이루어진 군으로부터 선택되는 어느 하나의 단백질; 또는 이를 암호화하는 유전자의 발현 수준을 측정할 수 있는 제제를 포함하는 IL-23에 의해 매개되는 질환의 중증도 예측용 조성물.any one protein selected from the group consisting of monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen and CD11c antigen; Or a composition for predicting the severity of a disease mediated by IL-23 comprising an agent capable of measuring the expression level of a gene encoding the same.
- 제1항에 있어서,According to claim 1,상기 단핵구는 CD39 항원, CD9 항원 및 CD11b 항원은 단핵구의 표면에 발현되는 것인, 조성물.Wherein the monocytes are CD39 antigen, CD9 antigen and CD11b antigen are expressed on the surface of monocytes, the composition.
- 제1항에 있어서,According to claim 1,상기 단핵구는 Ly6G 항원 및 CD11c 항원은 단핵구의 표면에 발현되지 않는 것인, 조성물.Wherein the monocyte is not expressed on the surface of the monocyte Ly6G antigen and CD11c antigen, the composition.
- 제1항에 있어서,According to claim 1,상기 단백질의 발현 수준을 측정할 수 있는 제제는 상기 유전자에 상보적으로 결합하는 프라이머, 프로브 및 안티센스 뉴클레오티드로 이루어진 군으로부터 선택되는 적어도 하나인 것인, 조성물.An agent capable of measuring the expression level of the protein is at least one selected from the group consisting of primers, probes, and antisense nucleotides that complementarily bind to the gene, the composition.
- 제1항에 있어서, According to claim 1,상기 유전자의 발현 수준을 측정할 수 있는 제제는 상기 단백질에 특이적으로 결합하는 항체, 올리고펩타이드, 리간드, PNA(Peptide nucleic acid) 및 앱타머(aptamer)로 이루어진 군으로부터 선택되는 적어도 하나인 것인, 조성물.The agent capable of measuring the expression level of the gene is at least one selected from the group consisting of an antibody, an oligopeptide, a ligand, a peptide nucleic acid (PNA), and an aptamer that binds specifically to the protein. , composition.
- 제1항에 있어서,According to claim 1,상기 IL-23에 의해 매개되는 질환은 천식, 부비동염, 다발성 경화증, 류마티스 성 관절염, 건선, 염증성 장 질환 및 강직성 척추염으로 이루어진 군으로부터 선택되는 어느 하나인 것인, 조성물.The disease mediated by IL-23 is any one selected from the group consisting of asthma, sinusitis, multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory bowel disease and ankylosing spondylitis, the composition.
- 제6항에 있어서,According to claim 6,상기 천식은 호중구 우세 천식인 것인, 조성물.Wherein the asthma is neutrophil-dominant asthma, the composition.
- 제1항 내지 제7항 중 어느 한 항의 조성물을 포함하는, IL-23에 의해 매개되는 질환의 중증도 예측용 키트.A kit for predicting the severity of a disease mediated by IL-23, comprising the composition of any one of claims 1 to 7.
- 목적하는 개체로부터 분리된 시료에서, 단핵구의 CD39 항원, CD9 항원, Ly6G 항원, CD11b 항원 및 CD11c 항원으로 이루어진 군으로부터 선택되는 어느 하나의 단백질; 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계;를 포함하는 IL-23에 의해 매개되는 질환의 중증도 예측을 위한 정보를 제공하는 방법.Any one protein selected from the group consisting of monocyte CD39 antigen, CD9 antigen, Ly6G antigen, CD11b antigen, and CD11c antigen in a sample isolated from a subject of interest; Or measuring the expression level of a gene encoding the same; a method for providing information for predicting the severity of a disease mediated by IL-23, including.
- 제9항에 있어서,According to claim 9,상기 IL-23에 의해 매개되는 질환은 천식, 부비동염, 다발성 경화증, 류마티스 성 관절염, 건선, 염증성 장 질환 및 강직성 척추염으로 이루어진 군으로부터 선택되는 어느 하나인 것인, 방법.The disease mediated by IL-23 is any one selected from the group consisting of asthma, sinusitis, multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory bowel disease and ankylosing spondylitis.
- 제10항에 있어서,According to claim 10,상기 천식은 호중구 우세 천식인 것인, 방법.Wherein the asthma is neutrophil-dominant asthma, the method.
- 제9항에 있어서,According to claim 9,상기 단백질의 발현 수준을 측정하는 단계는 단백질 칩 분석, 면역측정법, 리간드 바인딩 어세이, MALDI-TOF(Matrix Assisted Laser Desorption/Ionization Time of Flight Mass Spectrometry) 분석, SELDI-TOF(Sulface Enhanced Laser Desorption/Ionization Time of Flight Mass Spectrometry) 분석, 방사선 면역 분석, 방사 면역 확산법, 오우크테로니 면역 확산법, 로케트 면역전기영동, 조직면역 염색, 보체 고정 분석법, 2차원 전기영동 분석, 액상 크로마토그래피-질량분석(liquid chromatography-Mass Spectrometry, LC-MS), LC-MS/MS(liquid chromatography-Mass Spectrometry/ Mass Spectrometry), 유세포 분석, 웨스턴 블랏팅 및 ELISA(enzyme linked immunosorbentassay)로 이루어진 군으로부터 선택되는 적어도 하나인 것인, 방법.The step of measuring the expression level of the protein is protein chip analysis, immunoassay, ligand binding assay, MALDI-TOF (Matrix Assisted Laser Desorption/Ionization Time of Flight Mass Spectrometry) analysis, SELDI-TOF (Sulface Enhanced Laser Desorption/Ionization Time of Flight Mass Spectrometry) analysis, radioimmunoassay, radioimmunodiffusion method, Oukteroni immunodiffusion method, rocket immunoelectrophoresis, tissue immunostaining, complement fixation assay, two-dimensional electrophoretic assay, liquid chromatography-mass spectrometry (liquid At least one selected from the group consisting of chromatography-Mass Spectrometry, LC-MS), LC-MS/MS (liquid chromatography-Mass Spectrometry/ Mass Spectrometry), flow cytometry, Western blotting, and ELISA (enzyme linked immunosorbentassay) , Way.
- 제9항에 있어서,According to claim 9,상기 유전자의 발현 수준을 측정하는 단계는 역전사 중합효소반응(RT-PCR), 경쟁적 역전사 중합효소반응(Competitive RT-PCR), 실시간 역전사 중합효소반응(Real-time RT-PCR), RNase 보호 분석법(RPA; RNase protection assay), 노던 블랏팅(Northern blotting) 및 DNA 칩으로 이루어진 군으로부터 선택되는 적어도 하나인 것인, 방법.The step of measuring the expression level of the gene is reverse transcription polymerase reaction (RT-PCR), competitive reverse transcription polymerase reaction (Competitive RT-PCR), real-time reverse transcription polymerase reaction (Real-time RT-PCR), RNase protection assay ( RPA; RNase protection assay), Northern blotting (Northern blotting) and at least one method selected from the group consisting of a DNA chip.
- CD39 항원, CD9 항원 및 CD11b 항원을 발현하고; Ly6G 항원 및 CD11c 항원을 발현하지 않는 아형의 단핵구를 유효성분으로 포함하는 IL-23에 의해 매개되는 질환의 예방 또는 치료용 세포치료제 조성물.expresses CD39 antigen, CD9 antigen and CD11b antigen; A cell therapy composition for preventing or treating diseases mediated by IL-23, comprising as an active ingredient subtype monocytes that do not express Ly6G antigen and CD11c antigen.
- 제14항에 있어서,According to claim 14,상기 IL-23에 의해 매개되는 질환은 천식, 부비동염, 다발성 경화증, 류마티스 성 관절염, 건선, 염증성 장 질환 및 강직성 척추염으로 이루어진 군으로부터 선택되는 어느 하나인 것인, 조성물.The disease mediated by IL-23 is any one selected from the group consisting of asthma, sinusitis, multiple sclerosis, rheumatoid arthritis, psoriasis, inflammatory bowel disease and ankylosing spondylitis, the composition.
- 제15항에 있어서,According to claim 15,상기 천식은 호중구 우세 천식인 것인, 조성물.Wherein the asthma is neutrophil-dominant asthma, the composition.
- 제15항에 있어서,According to claim 15,상기 조성물은 항-IL-23 항체를 더 포함하는 것인, 조성물.Wherein the composition further comprises an anti-IL-23 antibody.
- 제 6 항에 있어서,According to claim 6,상기 염증성 장 질환은 궤양성 대장염(Ulcerative Colitis, UC) 또는 크론병(Chrohn’s Disease, CD) 인 것을 특징으로 하는 조성물.The composition, characterized in that the inflammatory bowel disease is ulcerative colitis (Ulcerative Colitis, UC) or Crohn's Disease (CD).
- 제 10 항에 있어서,According to claim 10,상기 염증성 장 질환은 궤양성 대장염(Ulcerative Colitis, UC) 또는 크론병(Chrohn’s Disease, CD) 인 것을 특징으로 하는 방법.The method of claim 1, wherein the inflammatory bowel disease is ulcerative colitis (UC) or Crohn's Disease (CD).
- 제 15 항에 있어서,According to claim 15,상기 염증성 장 질환은 궤양성 대장염(Ulcerative Colitis, UC) 또는 크론병(Chrohn’s Disease, CD) 인 것을 특징으로 하는 조성물.The composition, characterized in that the inflammatory bowel disease is ulcerative colitis (Ulcerative Colitis, UC) or Crohn's Disease (CD).
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20210090089 | 2021-07-09 | ||
KR10-2021-0090089 | 2021-07-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2023282654A1 true WO2023282654A1 (en) | 2023-01-12 |
Family
ID=84800788
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/009830 WO2023282654A1 (en) | 2021-07-09 | 2022-07-07 | Composition for predicting severity of disease mediated by il-23 |
Country Status (2)
Country | Link |
---|---|
KR (1) | KR20230009815A (en) |
WO (1) | WO2023282654A1 (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130273566A1 (en) * | 2007-03-30 | 2013-10-17 | Lee Denson | Serological Markers of Inflammatory Bowel Disease Phenotype and Disease Progression |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2635601B1 (en) | 2010-11-04 | 2016-07-20 | Boehringer Ingelheim International GmbH | Anti-il-23 antibodies |
-
2022
- 2022-05-04 KR KR1020220055562A patent/KR20230009815A/en not_active Application Discontinuation
- 2022-07-07 WO PCT/KR2022/009830 patent/WO2023282654A1/en unknown
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130273566A1 (en) * | 2007-03-30 | 2013-10-17 | Lee Denson | Serological Markers of Inflammatory Bowel Disease Phenotype and Disease Progression |
Non-Patent Citations (4)
Title |
---|
ARNOLD I C, MATHISEN S, SCHULTHESS J, DANNE C, HEGAZY A N, POWRIE F: "CD11c+ monocyte/macrophages promote chronic Helicobacter hepaticus-induced intestinal inflammation through the production of IL-23", MUCOSAL IMMUNOLOGY, NATURE PUBLISHING GROUP US, NEW YORK, vol. 9, no. 2, 1 March 2016 (2016-03-01), New York, pages 352 - 363, XP093020433, ISSN: 1933-0219, DOI: 10.1038/mi.2015.65 * |
MIKKEL CARSTENSEN; TOVE CHRISTENSEN; MORTEN STILUND; HOLGER J MØLLER; EVA L PETERSEN; THOR PETERSEN: "Activated monocytes and markers of inflammation in newly diagnosed multiple sclerosis", IMMUNOLOGY AND CELL BIOLOGY, CARLTON, AU, vol. 98, no. 7, 5 May 2020 (2020-05-05), AU , pages 549 - 562, XP071705079, ISSN: 0818-9641, DOI: 10.1111/imcb.12337 * |
TOKER A., C.Y. SLANEY, B.T. BÄCKSTRÖM, J.L. HARPER: "Glatiramer acetate treatment directly targets CD11b+Ly6G- monocytes and enhances the suppression of autoreactive T cells in experimental autoimmune encephalomyelitis", SCANDINAVIAN JOURNAL OF IMMUNOLOGY, vol. 74, no. 3, 30 September 2011 (2011-09-30), pages 235 - 243, XP093020434, DOI: 10.1111/j.1365-3083.2011.02575.x * |
VALAPERTI ALAN, MARTY RENÉ R., KANIA GABRIELA, GERMANO DAVIDE, MAUERMANN NORA, DIRNHOFER STEFAN, LEIMENSTOLL BERND, BLYSZCZUK PRZ: "CD11b+ Monocytes Abrogate Th17 CD4+ T Cell-Mediated Experimental Autoimmune Myocarditis", THE JOURNAL OF IMMUNOLOGY, WILLIAMS & WILKINS CO., US, vol. 180, no. 4, 15 February 2008 (2008-02-15), US , pages 2686 - 2695, XP093020435, ISSN: 0022-1767, DOI: 10.4049/jimmunol.180.4.2686 * |
Also Published As
Publication number | Publication date |
---|---|
KR20230009815A (en) | 2023-01-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2013122408A1 (en) | Pharmaceutical use of fam19a5 involved in regulating gliogenesis | |
WO2018074758A2 (en) | Method for sorting highly effective stem cells for treating immune disorder | |
WO2017022962A1 (en) | Composition for preventing or treating immune disease, comprising ripk inhibitor as active ingredient | |
WO2010087594A9 (en) | Cd93 or use of soluble fragment thereof | |
Ng et al. | CITED2 limits pathogenic inflammatory gene programs in myeloid cells | |
WO2013119033A1 (en) | Biomarker composition for osteoporosis diagnosis and treatment effect evaluation containing ubap2 | |
WO2023282654A1 (en) | Composition for predicting severity of disease mediated by il-23 | |
WO2021002735A1 (en) | Cell surface antigen of t cell and various uses thereof | |
WO2010036031A2 (en) | Pauf-specific human monoclonal antibody, pharmaceutical composition for treating cancer comprising the same and method for detecting cancer using the same | |
WO2022169279A1 (en) | Composition for prevention or treatment of kidney disease | |
WO2019235876A1 (en) | Pharmaceutical composition comprising expression or activity inhibitor of c-src for preventing or treating synucleinopathy | |
WO2022203314A2 (en) | Composition for differential diagnosis of malignant peripheral nerve sheath tumor | |
WO2018117647A1 (en) | Mutated tau protein fragment and use thereof | |
WO2022098118A1 (en) | Composition for regulating osteoclast differentiation, and use thereof | |
WO2022240251A1 (en) | Biomarker for prognosis prediction of neurodegenerative diseases, comprising mirnas, and use thereof | |
WO2018212503A1 (en) | Cotl1 protein involved in maintaining homeostasis of hematopoietic stem cell, and use thereof | |
WO2006006722A1 (en) | Method of controlling cell functions | |
WO2022055334A1 (en) | Composition for preventing or treating pulmonary fibrosis disease | |
WO2021071219A1 (en) | Biomarker for diagnosis of neurodegenerative disease | |
WO2016209013A1 (en) | Tm4sf19 as marker for diagnosing obesity and method using same | |
WO2013133472A1 (en) | Activating transcription factor 3 (atf3) for toxicity prediction and as therapeutic target | |
WO2020130467A2 (en) | Pharmaceutical composition for prevention or treatment of cd8+ memory t cell-mediated disease | |
WO2022086197A1 (en) | Cell surface antigen of activated immune cell and various uses thereof | |
WO2017023001A1 (en) | Non-alcoholic fatty liver regulator 14-3-3 protein | |
WO2017023002A1 (en) | Non-alcoholic fatty liver regulating factor 14-3-3 protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22838006 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |