WO2023281313A1 - Anti-tnfr2 antibody and uses thereof - Google Patents
Anti-tnfr2 antibody and uses thereof Download PDFInfo
- Publication number
- WO2023281313A1 WO2023281313A1 PCT/IB2022/000409 IB2022000409W WO2023281313A1 WO 2023281313 A1 WO2023281313 A1 WO 2023281313A1 IB 2022000409 W IB2022000409 W IB 2022000409W WO 2023281313 A1 WO2023281313 A1 WO 2023281313A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- tnfr2
- antigen
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- Tumor Necrosis Factor Receptor 2 (TNFR2), also known as Tumor Necrosis Factor Receptor Superfamily Member IB (TNFRSF1B) and CD120b, is a 75-kDa Type I transmembrane protein which contains an extracellular domain (ECD, residues 1-257) with 4 cysteine-rich domains (CRD1 to CRD4), a transmembrane domain (TM, residues 258-287), and an intracellular domain (ICD, residues 288-461) with TRAF2-binding domain.
- TNFR2 share relatively low sequence identity with the other TNFa receptor - Tumor Necrosis Factor Receptor 1 (TNFR1), with the homology between their extracellular domains being only 28%.
- TNFa-TNFR2 interaction triggers cell survival signals via the NFkB signaling pathway.
- TNFa-TNFR2 interaction triggers apoptosis signals via the caspase pathways.
- Human TNFR2 shows 62% amino acid sequence homology with mouse TNFR2, but it is 97% identical to the rhesus monkey TNFR2.
- TNFR2 While TNFR1 is ubiquitously expressed, TNFR2 expression is mainly restricted to immune cells, and is predominantly and highly expressed by tumor-infiltrating immunosuppressive CD4 + FoxP3 + regulatory T cells (Tregs). Recent studies have shown that TNFR2 plays a crucial role in stimulating the activation and proliferation of Tregs, a major checkpoint of antitumor immune responses (Chen and Oppenheim, Sci Signal 10:eaal2328, 2017). Activation of TNFR2 via its ligand TNFa results in NFkB signaling activation and expansion of TNFR2 + Tregs. TNFR2 is also expressed in CD8 and CD4 Tconv cells, as well as myeloid cells. In particular, TNFR2 is expressed in exhausted CD8 T cells, similarly to clinically validated immune-checkpoints.
- T-regulatory cells are a small subset of T-lymphocytes with diverse clinical applications.
- TNFR2 + Tregs are highly immunosuppressive, with a suppressive activity more potent than that of highly suppressive CD103 + Tregs (/ Immunol 179:154-161, 2007; J Immunol 180:6467-6471, 2008).
- TNFR2 + Tregs can be used in therapy that depends on the immunosuppressive activity of Tregs, such as in transplantation, allergy, asthma, infectious diseases, graft versus host disease (GVHD), and autoimmunity.
- GVHD graft versus host disease
- CD4 + CD25 hlgh Foxp3 + thymus-derived Treg depletion could intensify GVHD (Cohen et ah, JEM 2002).
- TNFR2 is also expressed in certain cancers, such as breast cancer, cervical cancer, colon cancer, and renal cancer ⁇ Front. Immunol. 9:1170, 2018), and may be involved in immunotolerance in these cancers.
- TNFa ligands of TNFR2
- NFKB Nuclear Factor-kB
- AKT signaling has been shown to be another mediator of TNFR2 in carcinogenesis, tumor growth, and angiogenesis.
- MLCK Myosin Light-Chain Kinase
- ERK Extracellular signal-Regulated Kinase
- the invention provides an isolated monoclonal antibody, or an antigen binding fragment thereof, wherein said monoclonal antibody or antigen-binding fragment thereof is specific for human TNFR2, and wherein said monoclonal antibody comprises: (la) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 1, a HCVR CDR2 sequence of SEQ ID NO: 2, and a HCVR CDR3 sequence of SEQ ID NO: 3; and, (lb) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 4, a LCVR CDR2 sequence of SEQ ID NO: 5, and a LCVR CDR3 sequence of SEQ ID NO: 6; or (2a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 14, a HCVR CDR2 sequence of SEQ ID NO: 15, and a HCVR CDR3 sequence of SEQ ID NO:
- the HCVR sequence in the isolated monoclonal antibody or antigen-binding fragment thereof, (1A) the HCVR sequence is SEQ ID NO: 7; and/or, (IB) the LCVR sequence is SEQ ID NO: 8, or, (2A) the HCVR sequence is SEQ ID NO: 20; and/or, (2B) the LCVR sequence is SEQ ID NO: 21, or, (3A)the HCVR sequence is SEQ ID NO: 32; and/or, (3B) the LCVR sequence is SEQ ID NO: 33, or, (4A) the HCVR sequence is SEQ ID NO: 45; and/or, (4B) the LCVR sequence is SEQ ID NO: 46, or, (5A) the HCVR sequence is SEQ ID NO: 57; and/or, (5B) the LCVR sequence is SEQ ID NO: 58, or, (6A) the HCVR sequence is SEQ ID NO: 69; and/or, (6B) the LCVR sequence is SEQ ID NO: 70.
- the monoclonal antibody has: (la) a heavy chain sequence of SEQ ID NO: 9; and/or, (lb) a light chain sequence of SEQ ID NO: 10, or, (2a) a heavy chain sequence of SEQ ID NO: 22; and/or, (2b) a light chain sequence of SEQ ID NO: 23, or, (3a) a heavy chain sequence of SEQ ID NO: 34; and/or, (3b) a light chain sequence of SEQ ID NO: 35, or, (4a) a heavy chain sequence of SEQ ID NO: 47; and/or, (4b) a light chain sequence of SEQ ID NO: 48, or, (5a) a heavy chain sequence of SEQ ID NO: 59; and/or, (5b) a light chain sequence of SEQ ID NO: 60, or, (6a) a heavy chain sequence of SEQ ID NO:
- the isolated monoclonal antibody or antigen -binding fragment thereof is a human-mouse chimeric antibody, a humanized antibody, a human antibody, a CDR-grafted antibody, or a resurfaced antibody.
- the antigen-binding fragment thereof is an Fab, Fab’,
- the monoclonal antibody or antigen-binding fragment thereof cross-reacts with rhesus monkey TNFR2, but does not substantially cross-react with mouse TNFR2.
- the monoclonal antibody or antigen-binding fragment thereof of the invention includes one or more point mutations of its amino acid sequence that are designed to improve developability of the antibody.
- the one or more point mutations make the antibody more stable during its expression in a host cell, its purification during the manufacturing, and/or the formulation processes, and/or its administration to a subject patient.
- the one or more point mutations make the antibody less likely to aggregate during the manufacturing and/or formulation processes.
- the invention provides a therapeutic antibody with minimized or reduced developability issues, such as removed or reduced hydrophobicity and/or optimized charges by replacing one or more amino acids in its sequence (e.g., in one or more of its CDRs).
- the monoclonal antibody or antigen-binding fragment thereof does not substantially cross-react with TNFR1.
- the monoclonal antibody or antigen-binding fragment thereof binds TNFa with a K d of less than about 25 nM, 20 nM, 15 nM, 10 nM, 5 nM, 2 nM, or 1 nM.
- the isolated monoclonal antibody or antigen -binding fragment thereof enhances binding between TNFa and TNFR2; enhances TNFa-mediated or -co- stimulated NFKB signaling (e.g., in TCR-activated CD8 and/or CD4 Tconv T cells); and/or promotes TCR-activated effector T cell (e.g., CD8 and/or CD4 Tconv T cell) proliferation in the presence of Treg.
- the isolated monoclonal antibody or antigen -binding fragment thereof enhances TNFa-mediated CD25 expression on Tregs.
- the isolated monoclonal antibody or antigen -binding fragment thereof binds to an epitope of SEQ ID NO: 13 and/or 101.
- the isolated monoclonal antibody or antigen -binding fragment thereof promotes TNFa binding to TNFR2; inhibits TNFa binding to TNFR2; or has no apparent effect on TNFa binding to TNFR2.
- the isolated monoclonal antibody or antigen -binding fragment thereof does not block, inhibit, or otherwise substantially antagonize TNFa binding to TNFR2.
- the isolated monoclonal antibody or antigen -binding fragment thereof is an agonist of TNFR2, or stimulates TNFR2 signaling (such as in the presence of TNFa), wherein the agonist function is preferably Fc-independent.
- the isolated monoclonal antibody or antigen -binding fragment thereof activates CD4 + effector T cells, CD8 + effector T cells, other effector T cells, and/or NK cells in vitro.
- Another aspect of the invention provides an isolated monoclonal antibody or an antigen-binding fragment thereof, which competes with the isolated monoclonal antibody or antigen-binding fragment thereof of any one of the subject antibodies for binding to the epitope of SEQ ID NO: 13 and/or 101.
- Another aspect of the invention provides an isolated monoclonal antibody or an antigen-binding fragment thereof, which specifically binds to the epitope of SEQ ID NO: 13 and/or 101.
- the isolated monoclonal antibody or antigen -binding fragment thereof enhances binding between TNFa and TNFR2; enhances TNFa-mediated or -co- stimulated NFKB signaling (e.g., in TCR-activated CD8 and/or CD4 Tconv T cells); and/or promotes TCR-activated effector T cell (e.g., CD8 and/or CD4 Tconv T cell) proliferation in the presence of Treg.
- the isolated monoclonal antibody or antigen -binding fragment thereof inhibits binding between TNFa and TNFR2; inhibits TNFa-mediated or - co-stimulated NFKB signaling (e.g., in TCR-activated CD8 and/or CD4 Tconv T cells); and/or inhibits TCR-activated effector T cell (e.g., CD8 and/or CD4 Tconv T cell) proliferation in the presence of Treg.
- the isolated monoclonal antibody or antigen -binding fragment thereof promotes Treg expansion.
- Another aspect of the invention provides an isolated monoclonal antibody or an antigen-binding fragment thereof, which competes with the isolated monoclonal antibody or antigen-binding fragment thereof of the invention for binding to the same epitope.
- Another aspect of the invention provides an isolated monoclonal antibody, or an antigen-binding fragment thereof, wherein said monoclonal antibody or antigen-binding fragment thereof specifically binds human TNFR2 at an epitope comprising, consisting essentially of, or consisting of SEQ ID NO: 101, optinally, said isolated monoclonal antibody or antigen-binding fragment thereof does not bind human TNFR2 at an epitope consisting essentially of or consisting of SEQ ID NO: 13.
- the isolated monoclonal antibody, or antigen-binding fragment thereof of claim 19 (1) promotes activation and proliferation of CD4 + T cells but not regulatory T cells (Tregs) in tumor infiltrating lymphocytes (TIE) (e.g., in an in vivo hTNFR2 knock-in MC38 mouse tumor model); and/or (2) promotes NK cell activation in vitro and/or in vivo.
- TIE tumor infiltrating lymphocytes
- the isolated monoclonal antibody, or antigen-binding fragment thereof of the invention has a maximal tolerance dose (MTD) of about 150 mg/kg in cynomolgus monkey.
- MTD maximal tolerance dose
- Another aspect of the invention provides a method of treating cancer in a patient in need thereof, the method comprising administering to the patient an effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the patient (e.g ., the cancer of the patient) has: (a) a higher level of TNFR2 expression compared to the average TNFR2 expression level in prostate cancer patients; optionally, said TNFR2 expression is assessed in effector T cells (e.g., CD4 + and/or CD8 + T cells), tumor- infiltrating CD8 + T cells, and/or NK cells; and (b) a higher level of CD8A expression compared to the average CD8A expression level in AML patients.
- effector T cells e.g., CD4 + and/or
- the patient e.g., the cancer of the patient
- the patient has EBV + gastric cancer (e.g., stomach adenocarcinoma, which tend to be high in PD-L1/CD274 expression), clear cell renal cell carcinoma, kidney renal clear cell carcinoma (such as the KIRC.2, KIRC.3 and KIRC.4 subtypes, or clear cell type B (ccB) subtypes or ccA/ccB unclassified subtypes), cutaneous melanoma (e.g., skin cutaneous melanoma, such as the so-called triple- wt subtype that lacks hot-spot BRAF, N/H/K-RAS, or NF1 mutations; the subtype with BRAF hotspot mutations (including V600E, V600K, and V600R mutations and hotspot mutations at K601), the subtype with RAS hot-spot mutations (including Q61R, Q61K, Q61L, Q61H, 61_62QE >
- EBV + gastric cancer e.g.
- the cancer expresses higher than average level of PD-L1.
- the cancer is cervical cancer (e.g., cervical squamous cell carcinoma or endocervical adenocarcinoma), pleural mesothelioma, lung adenocarcinoma, or head and neck squamous cell carcinoma (HNSC, such as the atypical subtype (about 40% of which are HPV positive) and the mesenchymal subtype (which tends to have high PD- L1/CD274 expression)).
- cervical cancer e.g., cervical squamous cell carcinoma or endocervical adenocarcinoma
- pleural mesothelioma pleural mesothelioma
- lung adenocarcinoma pleural mesothelioma
- HNSC head and neck squamous cell carcinoma
- the method further comprises administering to the patient: (a) an antibody or antigen-binding fragment thereof specific for PD-1, such as cemiplimab, nivolumab, pembrolizumab, spartalizumab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, and INCMGA00012; (b) an antibody or antigen-binding fragment thereof specific for PD-L1, such as avelumab, durvalumab, atezolizumab, KN035, or CK- 301, and/or (c) an antibody or antigen-binding fragment thereof specific for PD-L2.
- the patient has relapsed or refractory cancer, and/or has previously been treated with (and optionally has failed to respond to or relapsed from) a standard of care treatment.
- the method further comprises administering to the patient the effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof once every 3 weeks (Q3W), 4 weeks (Q4W), or 5 weeks (Q5W) (e.g., once every 4 weeks or Q4W).
- the method comprises administering to the patient the isolated monoclonal antibody or antigen-binding fragment thereof once every 4 weeks (Q4W) at a dose of about 5 mg, 15 mg, 50 mg, 100 mg, or 150 mg (e.g., administered intravenuously over 60 minutes).
- the method further comprises: (1) prior to the administration step, selecting for patient with said higher level of TNFR2 expression and CD8A expression; or (2) prior to the administration step, verifying that the patient has said higher level of TNFR2 expression and CD8A expression.
- Another aspect of the invention provides a method of treating cancer in a patient in need thereof, the method comprising administering to the patient an effective amount of an isolated monoclonal antibody or an antigen-binding fragment thereof that specifically binds to human TNFR2 at an epitope comprising, consisting essentially of, or consisting of SEQ ID NO: 101, optinally, said isolated monoclonal antibody or antigen-binding fragment thereof does not bind human TNFR2 at an epitope consisting essentially of or consisting of SEQ ID NO: 13.
- Another aspect of the invention provides a method of treating cancer, or autoimmune disorder (AID, such as GVHD (graft-vs-host disease) and Rheumatoid Arthritis) in a patient in need thereof, the method comprising administering to the patient an effective amount of the isolated monoclonal antibody or antigen-binding fragment thereof of the invention.
- AID autoimmune disorder
- the method is for treating AID, wherein the method further comprises administering a second agent, such as low dose anti-IL2 agent in treating chronic GVHD, or an anti-TNFa agent (such as adalimumab, infliximab, etenercept, golimumab, etc) in treating rheumatoid arthritis, chronic plaque psoriasis, Crohn’s disease, ankylosing spondylitis, psoriatic arthritis, polyarticular juvenile idiopathic arthritis, IBS, EAE, and non- infectious uveitis.
- a second agent such as low dose anti-IL2 agent in treating chronic GVHD, or an anti-TNFa agent (such as adalimumab, infliximab, etenercept, golimumab, etc) in treating rheumatoid arthritis, chronic plaque psoriasis, Crohn’s disease, ankylosing spondylitis, ps
- the method is for treating cancer, wherein the method further comprises administering an antagonist of an immune checkpoint.
- the immune checkpoint is PD-1/PD-L1 immune checkpoint.
- the antagonist of the immune checkpoint is an antibody or antigen -binding fragment thereof specific for PD-1 or PD-L1.
- the antibody is an anti-PD-1 antibody, such as cemiplimab, nivolumab, pembrolizumab, spartalizumab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, and INCMGA00012.
- anti-PD-1 antibody such as cemiplimab, nivolumab, pembrolizumab, spartalizumab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, and INCMGA00012.
- the antibody is an anti-PD-Ll antibody, such as avelumab, durvalumab, atezolizumab, KN035, or CK-301.
- the antagonist of the immune checkpoint is a (non- antibody) peptide inhibitor of PD-1/PD-L1, such as AUNP12; a small molecule inhibitor of PD-L1 such as CA-170, or a macrocyclic peptide such as BMS-986189.
- the cancer is breast cancer, colon cancer, cervical cancer, renal cancer, liver cancer (e.g., heptocellular carcinoma), lung cancer (e.g., NSCLC), ovarian cancer, melanoma, skin cancer (e.g., squamous cell carcinoma or basal cell carcinoma), lymphoma, or leukemia.
- the cancer is melanoma.
- the method further comprises administering to the patient a chemotherapeutic agent, an anti-angiogenesis agent, a growth inhibitory agent, an immune- oncology agent, and/or an anti-neoplastic composition.
- Another aspect of the invention provides a polynucleotide encoding the heavy chain or the light chain or the antigen-binding portion thereof of the invention.
- the polynucleotide is codon optimized for expression in a human cell.
- Another aspect of the invention provides a vector comprising the polynucleotide of the invention.
- the vector is an expression vector (e.g., a mammalian expression vector, a yeast expression vector, an insect expression vector, or a bacterial expression vector).
- an expression vector e.g., a mammalian expression vector, a yeast expression vector, an insect expression vector, or a bacterial expression vector.
- FIG. 1 shows sequence alignments for the VH and VL regions of human-mouse chimeric monoclonal antibodies HFB3-1, -3, -6, -14, -18, -19, -20, -21, -22, -23, -24, and HFB3-25, as well as the consensus sequences thereof.
- FIG. 2A shows binding affinity of selected human-mouse chimeric monoclonal antibodies raised against the extracellular domain of recombinant human TNFR2.
- EC50 and E max values for the test antibodies and isotype matched negative control antibody were measured against CHO cells expressing human TNFR2 (CHO.hHFB3) or rhesus monkey TNFR2 (CHO.mkHFB3).
- FIG. 2B shows that different anti-TNFR2 monoclonal antibodies may promote (HFB3-1) or inhibit (HFB3-18) TNFa binding to TNFR2, or have no effect (HFB3-6) on the binding.
- FIG. 3 shows no binding of the human-mouse chimeric monoclonal antibodies to the parental CHO cell line, and no binding to CHO cells expressing mouse TNFR2 (except for marginal binding by HFB3-18 and HFB3-19 antibodies).
- FIG. 4A shows binding specificity of the human-mouse chimeric antibodies specifically towards TNFR2 but not TNFR1.
- FIG. 4B shows K d , k on and k tract jj values of human-mouse chimeric antibodies, HFB3-1, - 14 and -18, to His-tagged recombinant human TNFR2.
- FIG. 5 shows expression of TNFR2 on T cell subtypes in tumor infiltrating lymphocytess, particularly exhausted CD8 T cells.
- FIG. 6 shows cellular binding of anti-TNFR2 chimeric monoclonal antibodies on TCR-activated (bottom panel) and non-TCR-activated (top panel) primary Tregs, CD8, and CD4 Tconv.
- Primary T cells activated by CD3/CD28 co- stimulation (TCR activation) can be preferentially recognized by HFB3 antibodies.
- FIG. 7 shows that certain HFB3 antibodies of the invention, including HFB3-1, -14, - 18, -23, -24, and -25, trigger NFKB signaling, and the effect can be enhanced in the presence of TNFa ligand.
- FIG. 8 shows that the co- stimulation by certain subject monoclonal antibodies, including HFB3-1, -14, -18 and -25, and CD3/CD28 led to proliferation of CD8 and CD4 Tconv in a dose-dependent manner.
- FIG. 9 shows that the anti-TNFR2 monoclonal antibody of the invention (e.g., HFB3- lhz6-hGlAA, a humanized version of HFB3-1) dose-dependently favored cell proliferation on effector T cells (CD8 and CD4 Tconv) in the presence of Tregs.
- FIG. 10 shows the lack of ADCC effect for the subject anti-TNFR2 antibodies.
- FIG. 11A and FIG. 11B show various features of the His-tagged extracellular domain (ECD) of TNFR2 (referred to as HFB2003), including TNFa binding sites, and results of epitope mapping for the monoclonal antibodies HFB3-1 and HFB3-14, as well as either HFB3-18 (FIG. 11A) or HFB3-6 (FIG. 1 IB). These are mouse chimeric antibodies with human IgGl Fc region, and are thus also referred to as HFB3-l-hGl, HFB3-14-hGl, HFB3- 18-hGl, or HFB3-6-hGl, respectively.
- FIG. 11B also includes epitope mapping data for benchmark antibodies SBT-1 and SBT-4 (benchmark 1 and 2).
- FIG. 11C shows more refined epitope mapping data for HFB3-1; highlighted is a potential HFB3-lhGl epitope region (SEQ ID NO: 101), confirmed in 2 independent experiments.
- FIG. 11D provides 3-D models showing binding sites of HFB3-1, HFB3-14, HFB3-6, as well as HFB-3-18 on TNFR2-TNFa complex.
- FIG. 12A shows binding of humanized variants of the chimeric monoclonal antibodies HFB3-1, -14 and -18 to CHO cells expressing human TNFR2 (CHO.hTNFR2) but not to parental CHO cells.
- FIG. 12B shows binding affinity of selected humanized anti-TNFR2 monoclonal antibodies. EC50 values for the test humanized antibodies and the parental chimeric antibodies were measured against CHO cells expressing human TNFR2 (CHO.hHFB3).
- FIG. 13 shows binding affinity of selected humanized anti-TNFR2 monoclonal antibodies. EC50 values for the test humanized antibodies and the parental chimeric antibodies were measured against CHO cells expressing rhesus monkey TNFR2 (CHO.mkHFB3).
- FIG. 14A shows binding of humanized anti-TNFR2 antibodies to recombinant human and cynomolgus TNFR2 but not to recombinant human TNFR1 in ELISA assay.
- FIG. 14B shows results of binding affinity towards recombinant human TNFR2 by humanized variants and the parental chimeric monoclonal antibodies HFB3-1 and -14, based on AHC (Anti-Human IgG Fc Capture) biosensor measurements. Values were averages of two experiments obtained from two different days.
- FIG. 14C shows binding specificity of an exemplary humanized antibody HFB3- lhz6-hGl to TNRF2-expressing / -positive CHO cells (CHO.hTNFR2) as compared to parental CHO cells (Bmk 1: Benchmark antibody 1).
- FIG. 15 shows cellular binding of humanized anti-TNFR2 monoclonal antibodies to TCR- activated CD8 T cells.
- FIG. 16 shows co- stimulatory effect of humanized anti-TNFR2 monoclonal antibodies to proliferate TCR- activated CD4 T cells.
- FIG. 17A shows that co- stimulation of Tregs using certain humanized variant anti- TNFR2 antibodies and TNFa led to NFKB downstream signaling.
- FIG. 17B shows activation of NFKB signaling in CD8 T cells using certain humanized variant of HFB3-1 antibody with and without recombinant human TNFa. indicates statistical significance.
- FIG. 18 shows that the subject humanized variant anti-TNFR2 antibodies are stable in storage.
- FIG. 19 shows FcyR crosslinking dependency for anti-TNFR2 monoclonal antibody HFB3-18 (but not HFB3-1 and -14) on co- stimulating primary T cells.
- FIG. 20 shows confirmatory co-stimulation effect of selected humanized anti-TNFR2 antibodies to proliferate CD8 T cells, either in the presence or absence of TNFa.
- FIG. 21 A shows that the subject anti-TNFR2 monoclonal antibodies co-stimulate downstream NFKB signaling ex vivo in humanized TNFR2 knock-in CD8 and CD4 Tconv cells, in the presence of CD3/CD28-mediated TCR activation and 25 ng/mL TNFa.
- FIG. 2 IB shows that humanized HFB3-lhz6 binds to peripheral CD4 and CD8 T cells (top panels) and stimulates T cell proliferation in vitro (bottom panels) in the presence of CD3/CD28-mediated TCR activation in a dose dependent manner.
- FIG. 22 shows ex vivo activation of isolated natural killer (NK) cells by humanized HFB3-lhz6-hGl antibody and the parental HFB3-l-hGl antibody after stimulation with soluble IL-2 (10 ng/mL) and IL-15 (10 ng/mL).
- soluble IL-2 10 ng/mL
- IL-15 10 ng/mL
- FIG. 23 shows ex vivo activation of natural killer (NK) cells in whole peripheral blood mononuclear cell fraction by HFB3-lhz6-hGl and parental mouse HFB3-l-hGl after stimulation with plate-bound anti-CD3 (1 pg/mL) and soluble anti-CD28 (1 pg/mL).
- NK natural killer
- FIG. 23 shows ex vivo activation of natural killer (NK) cells in whole peripheral blood mononuclear cell fraction by HFB3-lhz6-hGl and parental mouse HFB3-l-hGl after stimulation with plate-bound anti-CD3 (1 pg/mL) and soluble anti-CD28 (1 pg/mL).
- Timeline of the experiment is shown in the top panel.
- CD37CD56 + cells CD 107a expression was up-regulated by HFB3-lhz6-hGl and HFB3-l-hGl in a dose dependent manner, but control anti-OX40 antibody (MBS) is
- FIG. 24A shows timeline of pharmacodynamic experiment in mouse MC38 tumor model. 2 doses of HFB3-l-hGl at 0.1 mg/kg, lmg/kg and 10 mg/kg dosage or isotype- matched control antibody (TT) at 10 mg/kg were administered intraperionatally 3 days apart.
- TT isotype- matched control antibody
- FIG. 24B shows in vivo effects of the antibody administration on total immune cell counts in MC38 tumor.
- Administration of HFB3-l-hGl at 10 mg/kg increased absolute cell numbers of CD45 + cells.
- FIG. 24C shows in vivo effects on cell counts of different immune cells in MC38 tumor.
- Adminstration of HFB3-l-hGl at 10 mg/kg increased absolute cell numbers of CD8 + , conventional CD4 + T and NK cells in tumor microenvironment, but did not change the number of T-regulatory cells.
- FIG. 25A shows percentage of TNFR2 receptor occupied by the injected antibody, HFB3-l-hGl at 0.1 mg/kg, lmg/kg and 10 mg/kg dosage or control antibody at 10 mg/kg, on tumor-infiltrating leukocytes. Only HFB3-l-hGl at 10 mg/kg dose resulted in drug receptor occupancy. p-value ⁇ 0.05 (*), 0.01 (**) or 0.001 (***) based on one-way ANOVA test.
- FIG. 25B shows percentage of TNFR2 receptor occupied by the injected antibody, HFB3-l-hGl at 0.1 mg/kg, lmg/kg and 10 mg/kg dosage or control antibody at 10 mg/kg, on selected peripheral blood cells.
- HFB3-l-hGl at 10 mg/kg and 1 mg/kg doses resulted in comparable drug receptor occupancy.
- p-value ⁇ 0.05 (*), 0.01 (**) or 0.001 (***) based on one-way ANOVA test.
- FIG. 26A shows antibody concentrations in blood on Day 4 of the experiment in FIG. 24A.
- HFB3-l-hGl at 10 mg/kg and 1 mg/kg doses was detectable in blood.
- / -valuc ⁇ 0.001 (***) or 0.0001 (****) based on one-way ANOVA test.
- FIG. 26B shows soluble TNFR2 in blood on Day 4 of the experiment in FIG. 24A. 10 mg/kg and 1 mg/kg administrations of HFB3-l-hGl increased the amount of TNFR2 detectable in blood. p-value ⁇ 0.001 (***) or 0.0001 (****) based on one-way ANOVA test.
- FIG. 27 A and FIG. 27B show that the humanized monoclonal antibodies such as HFB3-lhz6 and HFB3-18hzl have similar therapeutic efficacy as compared to that of the rat anti-mPD-1 monoclonal antibody.
- FIG. 28 shows that the humanized HFB3-lhz6 monoclonal antibody has therapeutic efficacy in the MC38 tumor model, as does the mouse anti-mPD-1 monoclonal antibody.
- FIG. 29 shows that the humanized HFB3-lhz6 monoclonal antibody inhibits tumor growth and increases life span of tumor bearing mice at two different doses, 3 mg/kg and 10 mg/kg, and combination treatment with HFB3-lhz6 and anti-mPD-1 antibody extends survival better than treatment with anti-mPD-1 alone.
- FIG. 30A shows that the humanized HFB3-lhz6 monoclonal antibody was eliminated from the body of cynomolgus monkeys over time (left panel), and anti-drug antibodies (ADA) were observed at about 2 weeks after injection (right panel), which is common in non human primates.
- FIG. 30B shows that no elevation of cytokines was observed after injecting 15, 50 or 150 mg/kg of HFB3-lhz6-hGl in comparison to reported data (dotted lines) from CD3xCD20 bispecific IgG at ⁇ 3 mg/kg.
- FIG. 31 shows cell count analysis after injection of 15, 50 or 150 mg/kg of HFB3- lhz6-hGl compared to historical data range from normal monkeys (left and right lines in each panel).
- FIG. 32 shows that the humanized HFB3-lhz6 monoclonal antibody has anti-tumor efficacy in the Hepal-6 tumor model.
- FIGs. 33A-33C show Kaplan Meier survival curves of skin cutaneous melanoma (SKCM, FIG. 33A), head and neck squamous cell carcinoma (HNSC, FIG. 33B) and thymoma (THYM, FIG. 33C) patients in TCGA database based on TNFR2 level. Higher TNFR2 expression is significantly associated with improved survival in melanoma and HNSC patients, but is not favorable in THYM.
- SKCM skin cutaneous melanoma
- HNSC head and neck squamous cell carcinoma
- THYM thymoma
- FIGs. 34A and 34B show examples of TCGA bulk RNA analysis of a patients of a number of cancers with solid tumor.
- Prostate cancer PRAD
- AML has low CD8A (but not TNFR2) expresion, and can be used as negative control for increased CD8A expresion in selected cancer types.
- FIG. 35 shows TCGA ranking of cancer types with high TNFR2 (e.g., as compared to that in prostate cancer) and high CD8A expression (e.g., as compared to that of AML) based on proportion of patient samples that are TNFR2-high/CD8A-high.
- ACC adrenocortical carcinoma
- BLCA bladder urothelial carcinoma
- BRCA breast invasive carcinoma
- CESC cervical squamous cell carcinoma/endocervical adenocarcinoma
- CHOL cholangiocarcinoma
- COAD colon adenocarcinoma
- EBV Epstein-Barr Virus
- ESCA esophageal carcinoma
- GBM glioblastoma multiforme
- HNSC head and neck squamous cell carcinoma
- KICH kidney chromophobe
- KIRC kidney renal clear cell carcinoma
- KIRP kidney renal papillary cell carcinoma
- LGG brain lower grade glioma
- LIHC liver hepatocellular carcinoma
- LUAD lung adenocarcinoma
- LUSC lung squamous cell carcinoma
- MESO pleural mesothelioma
- OV ovarian serous cystadenocarcinoma;
- PAAD pancreatic adenocarcinoma
- PCPG pheochromocytoma and paraganglioma
- PD- L1 programmed death-ligand 1
- PRAD prostate adenocarcinoma
- READ rectum adenocarcinoma
- SARC sarcoma
- SKCM skin cutaneous melanoma
- STAD stomach adenocarcinoma
- TGCT testicular germ cell tumors
- THCA thyroid carcinoma
- UCEC uterine corpus endometrial carcinoma
- UCS uterine carcinosarcoma
- UVM uveal melanoma.
- FIG. 36 shows molecular subtype analysis for selected renal cell carcinoma (RCC), skin cutaneous melanoma (SKCM), stomach adenocarcinoma/gastric cancer (STAD/GI), lung adenocarcinoma (LUAD) and head and neck squamous cell carcinoma (HNSC).
- RRC renal cell carcinoma
- SKCM skin cutaneous melanoma
- STAD/GI stomach adenocarcinoma/gastric cancer
- LAD lung adenocarcinoma
- HNSC head and neck squamous cell carcinoma
- TNFR2 has recently emerged as a promising therapeutic target for Immuno- Oncology.
- TNFR2 expression on regulatory and effector T cells in the tumor microenvironment (TME) has been associated with T cell exhaustion and resistance to immune-checkpoint blockade.
- TAE tumor microenvironment
- the invention described herein provides antibodies against human TNFR2 that can be used as anti-cancer agents. While not wishing to be bound by any particular theory, it is believed that co-stimulation of effector T cells with the subject anti- TNFR2 antibodies enhances the anti-tumor activity of the effector T cells.
- mice were immunized with the recombinant extracellular domain (ECD) of human TNFR2 (rhTNFR2) to produce a series of diverse antibodies that were characterized for binding, cross-reactivity, selectivity and functional activity.
- the antibodies were selected for their ability to induce CD8 + and CD4 + effector T cell proliferation in the presence of Treg cells, and for increased NFkB signaling.
- the selected antibodies also desirably showed cross -reactivity against the monkey ortholog of rhTNFR2, which would be a beneficial feature for toxicity study of a human therapeutic agent in animal.
- Further desired features include the ability of the subject antibodies to enhance the binding of human recombinant TNFa to TNFR2.
- HFB3-1 and HFB3-14 Two mouse antibodies, HFB3-1 and HFB3-14, with sub- or single-digit-nanomolar binding affinities for human TNFR2, were initially selected for further characterization and humanization. Epitope mapping experiments showed that these two antibodies recognize different domains of TNFR2, with HFB3-1 binding to a region within the CRD2 domain, and HFB3-14 binding within the CRD3 region. Despite their different binding sites, however, both antibodies are selective for TNFR2, cross-react with cynomolgus and rhesus monkey orthologs, and enhance the binding of human recombinant TNFa to TNFR2, as well as stimulate CD8 and conventional CD4 T cells (Tconv).
- humanized variants of these mouse antibodies retained the binding and cross-reactivity profiles of their respective parental antibodies.
- the humanized antibodies preferentially bind to TCR-activated primary CD8 and CD4 T cells as compared to unstimulated T cells, and enhance CD3/CD28-induced activation and proliferation of T cells. This co-stimulatory mechanism of action is cross-linking independent, and is consistent with the antibodies’ ability to enhance NFKB signaling and induce upregulation of NFKB downstream target genes.
- both humanized antibodies demonstrated good developability profile and are stable under high temperature, low pH conditions and following several freeze/thaw cycles.
- Good plasma exposures for lead antibodies were also observed in mice models.
- the in vivo efficacy evaluation of these antibodies in mouse tumor models as well as initial toxicity analysis are being conducted.
- antibody in the broadest sense, encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, and multispecific antibodies (e.g ., bispecific antibodies).
- the term “antibody” may also broadly refers to a molecule comprising complementarity determining region (CDR) 1, CDR2, and CDR3 of a heavy chain and CDR1, CDR2, and CDR3 of a light chain, wherein the molecule is capable of binding to an antigen.
- CDR complementarity determining region
- the term “antibody” also includes, but is not limited to, chimeric antibodies, humanized antibodies, human antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, etc.
- antibody refers to the various monoclonal antibodies, including chimeric monoclonal antibodies, humanized monoclonal antibodies, and human monoclonal antibodies, particularly humanized monoclonal antibodies of the invention.
- an antibody comprises a heavy chain variable region (HCVR) and a light chain variable region (LCVR).
- an antibody comprises at least one heavy chain (HC) comprising a heavy chain variable region and at least a portion of a heavy chain constant region, and at least one light chain (LC) comprising a light chain variable region and at least a portion of a light chain constant region.
- an antibody comprises two heavy chains, wherein each heavy chain comprises a heavy chain variable region and at least a portion of a heavy chain constant region, and two light chains, wherein each light chain comprises a light chain variable region and at least a portion of a light chain constant region.
- a single-chain Fv or any other antibody that comprises, for example, a single polypeptide chain comprising all six CDRs (three heavy chain CDRs and three light chain CDRs) is considered to have a heavy chain and a light chain.
- the heavy chain is the region of the antibody that comprises the three heavy chain CDRs and the light chain in the region of the antibody that comprises the three light chain CDRs.
- HCVR heavy chain variable region
- a heavy chain variable region refers to, at a minimum, a region comprising heavy chain CDR1 (CDR-H1), framework 2 (HFR2), CDR2 (CDR-H2), FR3 (HFR3), and CDR3 (CDR-H3).
- a heavy chain variable region also comprises at least a portion ( e.g ., the whole) of an FR1 (HFR1), which is N-terminal to CDR-H1 , and/or at least a portion (e.g., the whole) of an FR4 (HFR4), which is C-terminal to CDR-H3.
- heavy chain constant region refers to a region comprising at least three heavy chain constant domains, CHI, CH2, and CH3.
- Non-limiting exemplary heavy chain constant regions include g, d, and a.
- Non-limiting exemplary heavy chain constant regions also include e and m.
- Each heavy constant region corresponds to an antibody isotype.
- an antibody comprising a g constant region is an IgG antibody
- an antibody comprising a d constant region is an IgD antibody
- an antibody comprising an a constant region is an IgA antibody
- an antibody comprising an e constant region is an IgE antibody
- an antibody comprising an m constant region is an IgM antibody.
- IgG antibodies include, but are not limited to, IgGl (comprising a g ⁇ constant region), IgG2 (comprising a g2 constant region), IgG3 (comprising a g3 constant region), and IgG4 (comprising a g4 constant region) antibodies;
- IgA antibodies include, but are not limited to, IgAl (comprising an al constant region) and IgA2 (comprising an a2 constant region) antibodies;
- IgM antibodies include, but are not limited to, IgMl (comprising an m ⁇ constant region) and IgM2 (comprising an m2 constant region).
- heavy chain refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence.
- a heavy chain comprises at least a portion of a heavy chain constant region.
- full- length heavy chain refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence, and with or without a C-terminal lysine.
- LCVR light chain variable region
- LCVR refers to a region comprising light chain CDR1 (CDR-L1), framework (FR) 2 (LFR2), CDR2 (CDR-L2), FR3 (LFR3), and CDR3 (CDR-L3).
- a light chain variable region also comprises at least a portion (e.g., the whole) of an FR1 (LFR1) and/or at least a portion (e.g., the whole) of an FR4 (LFR4).
- light chain constant region refers to a region comprising a light chain constant domain, C L .
- Non-limiting exemplary light chain constant regions include l and K.
- the term “light chain” as used herein refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence. In some embodiments, a light chain comprises at least a portion of a light chain constant region.
- full-length light chain refers to a polypeptide comprising a light chain variable region and a light chain constant region, with or without a leader sequence.
- antibody fragment or “antigen binding portion” (of antibody) includes, but is not limited to, fragments that are capable of binding antigen, such as Fv, single-chain Fv (scFv), Fab, Fab’, and (Fab’)2.
- an antibody fragment includes Fab, Fab’, F(ab’)2, F d , single chain Fv or scFv, disulfide linked F v , V-NAR domain, IgNar, intrabody, IgGACFh, minibody, F(ab’)3, tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAt2, (scFv)2, or scFv-Fc.
- Fab refers to an antibody fragment with a molecular mass of approximately 50,000 Daltons, and has an activity of binding to the antigen. It comprises approximately half of the N-terminal side of the heavy chain and the whole of the light chain connected by a disulfide bridge.
- the Fab can be obtained in particular by treatment of immunoglobulin by a protease, papain.
- F(ab’)2 designates a fragment of approximately 100,000 Daltons and an activity of binding to the antigen. This fragment is slightly larger than two Fab fragments connected via a disulfide bridge in the hinge region. These fragments are obtained by treating an immunoglobulin with a protease, pepsin. The Fab fragment can be obtained from the F(ab')2 fragment by cleaving of the disulfide bridge of the hinge region.
- a single Fv chain “scFv” corresponds to a VH: VL polypeptide synthesized using the genes coding for the VL and VH domains and a sequence coding for a peptide intended to bind these domains.
- An scFv according to the invention includes the CDRs maintained in an appropriate conformation, for example using genetic recombination techniques.
- the dimers of “scFv” correspond to two scFv molecules connected together by a peptide bond.
- This Fv chain is frequently the result of the expression of a fusion gene including the genes coding for VH and VL connected by a linker sequence coding a peptide.
- the human scFv fragment may include CDR regions that are maintained in an appropriate conformation, preferably by means of the use of genetic recombination techniques.
- the “dsFv” fragment is a VH-VL heterodimer stabilized by a disulfide bridge; it may be divalent (dsFV2). Fragments of divalent Sc(Fv)2 or multivalent antibodies may form spontaneously by the association of monovalent scFvs or be produced by connecting scFvs fragments by peptide binding sequences.
- the Fc fragment is the support for the biological properties of the antibody, in particular its ability to be recognized by immunity effectors or to activate the complement. It consists of constant fragments of the heavy chains beyond the hinge region.
- diabodies signifies small antibody fragments having two antigen fixing sites. These fragments comprise, in the same VH-VL polypeptide chain, a variable heavy chain domain VH connected to a variable light chain domain VL. Using a binding sequence that is too short to allow the matching of two domains of the same chain, the matching with two complementary domains of another chain necessarily occurs and thus two antigen fixing sites are created.
- an “antibody that binds to the same epitope” as a reference antibody can be determined by an antibody competition assay. It refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
- the term “compete” when used in the context of an antibody that compete for the same epitope means competition between antibodies is determined by an assay in which an antibody being tested prevents or inhibits specific binding of a reference antibody to a common antigen.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see, e.g., Stahli et al., 1983, Methods in Enzymology 9:242-253
- solid phase direct biotin-avidin EIA see, e.g., Kirkland et al., 1986, J. Immunol.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see, e.g., Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using I 125 label (see, e.g., Morel et al., 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g., Cheung, et al., 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et al., 1990, Scand.
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test antigen binding protein and a labeled reference antibody.
- Competitive inhibition is measured by determining the amount of label bound to the solid surface or cells in the presence of the test antibody.
- the test antibody is present in excess.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibodies and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- a competing antibody when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 40%, 45%, 50%, 55%, 60%, 65%, 70% or 75%. In some instance, binding is inhibited by at least 80%, 85%, 90%, 95%, or 97% or more.
- antigen refers to a molecule or a portion of a molecule capable of being bound by a selective binding agent, such as an antibody or immunologically functional fragment thereof, and additionally capable of being used in a mammal to produce antibodies capable of binding to that antigen.
- a selective binding agent such as an antibody or immunologically functional fragment thereof
- An antigen may possess one or more epitopes that are capable of interacting with antibodies.
- epitope is the portion of an antigen molecule that is bound by a selective binding agent, such as an antibody or a fragment thereof.
- the term includes any determinant capable of specifically binding to an antibody.
- An epitope can be contiguous or non contiguous (e.g., in a polypeptide, amino acid residues that are not contiguous to one another in the polypeptide sequence but that within in context of the molecule are bound by the antigen binding protein).
- epitopes may be mimetic in that they comprise a three dimensional structure that is similar to an epitope used to generate the antibody, yet comprise none or only some of the amino acid residues found in that epitope used to generate the antibody.
- Epitope determinants may include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl or sulfonyl groups, and may have specific three dimensional structural characteristics, and/or specific charge characteristics.
- an “epitope” is defined by the method used to determine it.
- an antibody binds to the same epitope as a reference antibody, if they bind to the same region of the antigen, as determined by hydrogen- deuterium exchange (HDX).
- HDX hydrogen- deuterium exchange
- an antibody binds to the same epitope as a reference antibody if they bind to the same region of the antigen, as determined by X-ray crystallography.
- a “chimeric antibody” as used herein refers to an antibody comprising at least one variable region from a first species (such as mouse, rat, cynomolgus monkey, etc.) and at least one constant region from a second species (such as human, cynomolgus monkey, chicken, etc.).
- a chimeric antibody comprises at least one mouse variable region and at least one human constant region.
- all of the variable regions of a chimeric antibody are from a first species and all of the constant regions of the chimeric antibody are from a second species.
- a “humanized antibody” as used herein refers to an antibody in which at least one amino acid in a framework region of a non-human variable region (such as mouse, rat, cynomolgus monkey, chicken, etc.) has been replaced with the corresponding amino acid from a human variable region.
- a humanized antibody comprises at least one human constant region or fragment thereof.
- a humanized antibody fragment is an Fab, an scFv, a (Fab’)2, etc.
- CDR-grafted antibody refers to a humanized antibody in which one or more complementarity determining regions (CDRs) of a first (non-human) species have been grafted onto the framework regions (FRs) of a second (human) species.
- a “human antibody” as used herein refers to antibodies produced in humans, antibodies produced in non-human animals that comprise human immunoglobulin genes, such as XENOMOUSE ® , and antibodies selected using in vitro methods, such as phage display, wherein the antibody repertoire is based on a human immunoglobulin sequences.
- a “host cell” refers to a cell that may be or has been a recipient of a vector or isolated polynucleotide.
- Host cells may be prokaryotic cells or eukaryotic cells.
- Exemplary eukaryotic cells include mammalian cells, such as primate or non-primate animal cells; fungal cells, such as yeast; plant cells; and insect cells.
- Non-limiting exemplary mammalian cells include, but are not limited to, NSO cells, PER.C6 ® cells (Crucell), and 293 and CHO cells, and their derivatives, such as 293-6E and DG44 cells, respectively.
- isolated refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or has been separated from at least some of the components with which it is typically produced.
- a polypeptide is referred to as “isolated” when it is separated from at least some of the components of the cell in which it was produced.
- a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be “isolating” the polypeptide.
- a polynucleotide is referred to as “isolated” when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, e.g., in the case of an RNA polynucleotide.
- a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as “isolated” so long as that polynucleotide is not found in that vector in nature.
- subject and “patient” are used interchangeably herein to refer to a mammal such as human.
- methods of treating other non-human mammals including, but not limited to, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are also provided.
- a “subject” or “patient” refers to a (human) subject or patient in need of treatment for a disease or disorder.
- sample refers to material that is obtained or derived from a subject of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- disease sample and variations thereof refers to any sample obtained from a subject of interest that would be expected or is known to contain the cellular and/or molecular entity that is to be characterized.
- tissue or cell sample is meant a collection of similar cells obtained from a tissue of a subject or patient.
- the source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood constituents; bodily fluids such as sputum, cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject.
- the tissue sample may also be primary or cultured cells or cell lines.
- the tissue or cell sample is obtained from a disease tissue/organ.
- the tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- a “reference sample,” “reference cell,” or “reference tissue,” as used herein, refers to a sample, cell or tissue obtained from a source known, or believed, not to be afflicted with the disease or condition for which a method or composition of the invention is being used to identify.
- a reference sample, reference cell or reference tissue is obtained from a healthy part of the body of the same subject or patient in whom a disease or condition is being identified using a composition or method of the invention.
- a reference sample, reference cell or reference tissue is obtained from a healthy part of the body of at least one individual who is not the subject or patient in whom a disease or condition is being identified using a composition or method of the invention.
- a reference sample, reference cell or reference tissue was previously obtained from a patient prior to developing a disease or condition or at an earlier stage of the disease or condition.
- a “disorder” or “disease” is any condition that would benefit from treatment with one or more Gal-9 antagonists of the invention. This includes chronic and acute disorders or diseases including those pathological conditions that predispose the mammal to the disorder in question.
- disorders to be treated herein include cancers.
- an “illness associated with the suppressor activity of regulatory T lymphocytes” means any illness (not autoimmune) in which the suppressor activity of regulatory T lymphocytes plays a role, in particular by promoting the development or persistence of the illness. In particular, it has been demonstrated that the suppressor activity of regulatory T lymphocytes promotes the development of tumors. The invention therefore aims more particularly at cancers in which the suppressor activity of T lymphocytes plays a role.
- cancer is used herein to refer to a group of cells that exhibit abnormally high levels of proliferation and growth.
- a cancer may be benign (also referred to as a benign tumor), pre-malignant, or malignant.
- Cancer cells may be solid cancer cells (i.e., forming solid tumors) or leukemic cancer cells.
- cancer growth is used herein to refer to proliferation or growth by a cell or cells that comprise a cancer that leads to a corresponding increase in the size or extent of the cancer.
- cancer examples include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular nonlimiting examples of such cancers include squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non-small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, endometrial cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, gastric cancer, mela
- cancer as used herein includes a hematological cancer (such as AML and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).
- a hematological cancer such as AML and DLBCL
- a solid tumor such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer.
- chemotherapeutic agent is a chemical compound that can be useful in the treatment of cancer.
- examples of chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and CYTOXAN ® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizele
- dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN ® doxorubicin (including morpholino-doxorubicin, cyanomorpholino- doxorubicin, 2-pyrrolino- doxorubicin and deoxydoxombicin), epimbic
- chemotherapeutic agents include anti- hormonal agents that act to regulate or inhibit hormone action on cancers such as anti- estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX ® tamoxifen), raloxifene, droloxifene, 4- hydroxy tamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTON ® toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE ® megestrol acetate, AROMAS IN ® exemestane, formestanie, fadrozole, RIVISOR ® vorozole, FEMARA ® letrozole, and ARIMIDEX ® anastrozole; and anti- hormonal agents that act to
- an “anti-angiogenesis agent” or “angiogenesis inhibitor” refers to a small molecular weight substance, a polynucleotide (including, e.g., an inhibitory RNA (RNAi or siRNA)), a polypeptide, an isolated protein, a recombinant protein, an antibody, or conjugates or fusion proteins thereof, that inhibits angiogenesis, vasculogenesis, or undesirable vascular permeability, either directly or indirectly.
- RNAi or siRNA inhibitory RNA
- the anti-angiogenesis agent includes those agents that bind and block the angiogenic activity of the angiogenic factor or its receptor.
- an anti-angiogenesis agent is an antibody or other antagonist to an angiogenic agent, e.g., antibodies to VEGF-A (e.g. , bevacizumab (AVASTIN ® )) or to the VEGF-A receptor (e.g., KDR receptor or Fit- 1 receptor), anti- PDGFR inhibitors such as GLEEVEC ® (Imatinib Mesylate), small molecules that block VEGF receptor signaling (e.g., PTK787/ZK2284, SU6668, SUTENT ® /SU1 1248 (sunitinib malate), AMG706, or those described in, e.g. , international patent application WO 2004/113304).
- an angiogenic agent e.g., antibodies to VEGF-A (e.g. , bevacizumab (AVASTIN ® )) or to the VEGF-A receptor (e.g., KDR receptor or Fit- 1 receptor), anti- PDGFR
- Anti-angiogensis agents also include native angiogenesis inhibitors, e.g., angiostatin, endostatin, etc. See, e.g., Klagsbmn and D'Amore (1991) Annu. Rev. Physiol. 53:217-39; Streit and Detmar (2003) Oncogene 22:3172-3179 (e.g., Table 3 listing anti- angiogenic therapy in malignant melanoma); Ferrara & Alitalo (1999) Nature Medicine 5(12): 1359-1364; Tonini et al. (2003) Oncogene 22:6549-6556 (e.g., Table 2 listing known anti-angiogenic factors); and, Sato (2003) Int. J. Clin. Oncol. 8:200-206 (e.g., Table 1 listing anti-angiogenic agents used in clinical trials).
- native angiogenesis inhibitors e.g., angiostatin, endostatin, etc. See, e.g., Klag
- a “growth inhibitory agent” as used herein refers to a compound or composition that inhibits growth of a cell (such as a cell expressing VEGF) either in vitro or in vivo.
- the growth inhibitory agent may be one that significantly reduces the percentage of cells (such as a cell expressing VEGF) in S phase.
- growth inhibitory agents include, but are not limited to, agents that block cell cycle progression (at a place other than S phase), such as agents that induce G1 arrest and M-phase arrest.
- Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epimbicin, daunorubicin, etoposide, and bleomycin.
- Those agents that arrest G1 also spill over into S-phase arrest, for example, DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
- Taxanes are anticancer drugs both derived from the yew tree.
- Docetaxel (TAXOTERE ® , Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL ® , Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
- anti-neoplastic composition refers to a composition useful in treating cancer comprising at least one active therapeutic agent.
- therapeutic agents include, but are not limited to, e.g., chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, cancer immunotherapeutic agents (also referred to as immuno-oncology agents), apoptotic agents, anti-tubulin agents, and other-agents to treat cancer, such as anti-HER-2 antibodies, anti- CD20 antibodies, an epidermal growth factor receptor (EGFR) antagonist (e.g., a tyrosine kinase inhibitor), HER1/EGFR inhibitor (e.g., erlotinib (TARCEVA®), platelet derived growth factor inhibitors (e.g., GLEEVEC® (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, CTLA4 inhibitors (e.g., anti-
- Treatment refers to therapeutic treatment, for example, wherein the object is to slow down (lessen) the targeted pathologic condition or disorder as well as, for example, wherein the object is to inhibit recurrence of the condition or disorder.
- Treatment covers any administration or application of a therapeutic for a disease (also referred to herein as a “disorder” or a “condition”) in a mammal, including a human, and includes inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, partially or fully relieving the disease, partially or fully relieving one or more symptoms of a disease, or restoring or repairing a lost, missing, or defective function; or stimulating an inefficient process.
- treatment also includes reducing the severity of any phenotypic characteristic and/or reducing the incidence, degree, or likelihood of that characteristic.
- Those in need of treatment include those already with the disorder as well as those at risk of recurrence of the disorder or those in whom a recurrence of the disorder is to be prevented or slowed down.
- an effective amount refers to an amount of a drug effective to treat a disease or disorder in a subject.
- an effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- a therapeutically effective amount of the antibodies of the invention may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antagonist to elicit a desired response in the individual.
- a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the subject antibodies are outweighed by the therapeutically beneficial effects.
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount would be less than the therapeutically effective amount.
- a “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject.
- a pharmaceutically acceptable carrier is non toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
- the pharmaceutically acceptable carrier is appropriate for the formulation employed.
- the carrier may be a gel capsule. If the therapeutic agent is to be administered subcutaneously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.
- An “article of manufacture” is any manufacture (e.g ., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or disorder, or a probe for specifically detecting a biomarker described herein.
- the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
- the invention described herein provides anti-TNFR2 antibodies for use in methods of treating humans and other non-human mammals.
- Tregs may cause an inappropriate immune suppression, which could, for example, promotes tumor growth.
- Tregs have been associated with reducing the anti-tumoral immune responses, in particular by inappropriately inhibiting the activity of the effector T lymphocytes, thus promoting the development of numerous cancer types.
- methods for treating or preventing a cancer comprising administering an effective amount of any of the subject anti-TNFR2 antibodies or antigen-binding fragments thereof to a subject in need of such treatment.
- methods of treating cancer comprise administering any of the subject anti-TNFR2 antibodies or antigen-binding fragments thereof to a subject with cancer.
- the cancers treatable by the method / use of the invention include those in which the regulatory T lymphocytes exert their suppressor activity, such as those cancers in which relatively large amount of the regulatory T lymphocytes are present in the tumoral tissue or in the circulation. Expansion of the regulatory T lymphocytes (which can be measured by frequency of Tregs) is generally correlated with an increase of Tregs activation.
- the frequency of the regulatory T lymphocytes can be assessed by any method known in the art, for example by a flow cytometry (FACS) analysis of the intra- tumoral lymphocytes or circulating lymphocytes, or by an immuno-histological staining of the tumoral tissue.
- FACS flow cytometry
- Non-limiting exemplary cancers that may be treated with any of the subject anti- TNFR2 antibodies or antigen-binding fragments thereof are provided herein, including carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular non- limiting examples of such cancers include melanoma, cervical cancer, squamous cell cancer, small cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, non small cell lung cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney cancer, renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma,
- the cancer is melanoma, breast cancer, colon cancer, cervical cancer, renal cancer, liver cancer (e.g., heptocellular carcinoma), lung cancer (NSCLC), ovarian cancer, skin cancer (e.g., squamous cell carcinoma or basal cell carcinoma), lymphoma, or leukemia.
- liver cancer e.g., heptocellular carcinoma
- lung cancer NSCLC
- ovarian cancer skin cancer (e.g., squamous cell carcinoma or basal cell carcinoma), lymphoma, or leukemia.
- the cancer has a high TNFR2 index, defined as the ratio between (a) the total CD8 T cell number in a tumor sample x TNFR2 expression on CD8 T cells; and (b) the total Treg cell number in a tumor sample x TNFR2 expression on Tregs.
- the cancer has a TNFR2 index of over 1, such as over 1.5, over 2, over 3, over 4, or over 5.
- representative TNFR2 indices for certain cancers include: 4.57 for melanima, 1.67 for breast cancer, 1.05 for NSCLC, 1.03 for SCC, 0.78 for BCC, and 0.46 for HCC.
- the cancer has a TNFR2 index of about 0.5 - about 1.
- the cancer has a high proportion of CD8 TILs (tumor infiltrating lymphocytes), such as more than 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60% or more of the T cells in a tumor are CD8 T cells.
- CD8 TILs tumor infiltrating lymphocytes
- the cancer has a low level of TNFR2 expression on tumor cells.
- the cancer is known to be susceptible to immune therapy (e.g., inflammed), such as melanoma, NSCLC, renal cell carcinoma, gastric cancer, colorectal cancer, urothelial cancer, HCC, head and neck cancer, and Hodgkin’s Lymphoma.
- immune therapy e.g., inflammed
- melanoma NSCLC
- renal cell carcinoma gastric cancer
- colorectal cancer urothelial cancer
- HCC head and neck cancer
- Hodgkin’s Lymphoma Hodgkin’s Lymphoma.
- the cancer has high level of TNFR2 expression on intra- tumoral exhausted T cells, such as exhausted CD8 T cells.
- Such cancer may be treated with a combination therapy with, for example, an antagonist of the PD-1/PD-L1 pathway, such as any of the anti-PD-1 or anti-PD-Ll antibodies (e.g., either described herein specifically or known in the art).
- the method / use of the invention can be used to treat cancers in which there are known high levels of regulatory T lymphocytes, and/or which cancers / tumors are clearly associated with poor prognosis, including: chronic myeloid leukemia (CML), colon cancer, melanoma, cancer of the uterus, breast cancer, pancreatic cancer, gastric cancers, ovarian cancer, primary lymphoma of the central nervous system, multiple myelomas, prostate cancer, Hodgkin's lymphoma, or hepatocellular carcinoma.
- CML chronic myeloid leukemia
- colon cancer melanoma
- cancer of the uterus cancer
- breast cancer pancreatic cancer
- gastric cancers gastric cancers
- ovarian cancer primary lymphoma of the central nervous system
- multiple myelomas multiple myelomas
- prostate cancer Hodgkin's lymphoma
- Hodgkin's lymphoma Hodgkin's lymphoma
- the cancer is a hematological cancer (such as AML and DLBCL), or a solid tumor (such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer).
- a hematological cancer such as AML and DLBCL
- a solid tumor such as breast cancer, head and neck cancer, lung cancer, melanoma (including uveal melanoma), colon cancer, renal carcinoma, ovarian cancer, liver cancer, and prostate cancer.
- the cancer is BCC, SCC, melanoma, colorectal cancer, or NSCLC.
- the cancer has high level of TNFR2 expression and CD8A expression.
- the high or higher level of TNFR2 expression is in relation to / compared with the average TNFR2 expression level in prostate cancer patients; optionally, the TNFR2 expression is assessed in effector T cells (e.g., CD4+ and/or CD8+ T cells), tumor-infiltrating CD8+ T cells, and/or NK cells; and/or the high or higher level of CD8A expression is in relation to / compared with the average CD8A expression level in AML patients.
- the patient e.g., the cancer of the patient
- the patient has EBV + gastric cancer.
- the patient has stomach adenocarcinoma, such as stomach adenocarcinoma with increased / high PD-L1/CD274 expression.
- the patient has clear cell renal cell carcinoma (RCC).
- RRC renal cell carcinoma
- the patient has kidney renal clear cell carcinoma (KIRC). In certain embodiments, the patient has KIRC.2, KIRC.3 or KIRC.4 subtype. In certain embodiments, the patient has a clear cell type B (ccB) subtype, or a ccA (clear cell type A)/ccB unclassified subtype. In certain embodiments, the patient has cutaneous melanoma.
- KIRC kidney renal clear cell carcinoma
- the patient has KIRC.2, KIRC.3 or KIRC.4 subtype.
- the patient has a clear cell type B (ccB) subtype, or a ccA (clear cell type A)/ccB unclassified subtype. In certain embodiments, the patient has cutaneous melanoma.
- the patient has skin cutaneous melanoma (SKCM).
- SKCM skin cutaneous melanoma
- the patent has a subtype with a BRAF hotspot mutation, such as the V600E, the V600K, or the V600R mutation, or a hotspot mutation at K601.
- a BRAF hotspot mutation such as the V600E, the V600K, or the V600R mutation, or a hotspot mutation at K601.
- the patient has a RAS hot-spot mutation.
- the RAS hotspot mutation is an NRAS hotspot mutation, such as Q61R, Q61K, Q61L, Q61H, 61_62QE > HK, G12R/D/A, and G13R/D.
- the RAS hotspot mutation is an HRAS hotspot mutation, such as G13D, G13S, or Q61K.
- the RAS hotspot mutation is a KRAS hotspot mutation such as G12D, G12R, or Q61R.
- the patient has a subtype with any NF1 mutation.
- the patient has a triple- wt subtype of SKCM that lacks hot spot BRAF, N/H/K-RAS, or NF1 mutations.
- the patient has testicular germ cell tumor.
- the patient has soft tissue sarcoma.
- the cancer expresses higher than average level of PD-L1.
- the cancer is cervical cancer (e.g., cervical squamous cell carcinoma or endocervical adenocarcinoma), pleural mesothelioma, lung adenocarcinoma, or head and neck squamous cell carcinoma (HNSC).
- cervical cancer e.g., cervical squamous cell carcinoma or endocervical adenocarcinoma
- pleural mesothelioma pleural mesothelioma
- lung adenocarcinoma adenocarcinoma
- HNSC head and neck squamous cell carcinoma
- the patient has an HNSC subtype, such as the atypical subtype.
- the atypical subtype HNSC is further HPV positive.
- the patient has an HNSC mesenchymal subtype.
- the mesenchymal subtype has high PD-L1/CD274 expression.
- the method / use of the invention can be used to treat recurrence of fibrosis resulting from hepatitis C, since it has also been demonstrated that increasing the frequency of the regulatory T lymphocytes is a factor predicting recurrence of such fibrosis.
- the anti-TNFR2 antibodies of the invention can be used alone, or alternatively used in combination with any other suitable compound known to be able to treat the disease or indication.
- an antibody directed against TNFR2 and inhibiting the suppressor activity of regulatory T lymphocytes as previously defined is used in combination with a second therapeutic agent for treating a disease associated with the suppressor activity of regulatory T lymphocytes, for example an anticancer agent.
- the antibody when the use is the treatment of a cancer, can be used in combination with known therapies against cancer such as for example surgery, radiotherapy, chemotherapy or combinations thereof.
- the antibody can be used in combination with an adoptive immunotherapy, consisting one or more injections of effector lymphocytes against tumoral antigens, in particular EBV antigens.
- other anticancer agents used in combination with the antibody directed against TNFR2 according to the invention for cancer therapy comprise anti- angiogenic s.
- the antibody can be co-administered with a cytokine, for example a cytokine that stimulates an anti-tumoral immune response.
- the antibody of the invention can be used before, after, or concurrently with the second therapeutic agent. See further section below concerning combination therapy.
- the subject anti-TNFR2 monoclonal antibodies may be administered subcutaneously or intravenously.
- the subject anti-TNFR2 monoclonal antibodies refer to mouse-human chimeric anti-TNFR2 antibody of the invention, as well as the humanized variants thereof.
- the subject anti-TNFR2 monoclonal antibodies may be administered in vivo by various routes, including, but not limited to, oral, intra-arterial, parenteral, intranasal, intramuscular, intracardiac, intraventricular, intratracheal, buccal, rectal, intraperitoneal, by inhalation, intradermal, topical, transdermal, and intrathecal, or otherwise, e.g., by implantation.
- the subject anti-TNFR2 monoclonal antibodies may be administered via i.v. or s.c..
- the subject antibody compositions may be formulated into preparations in solid, semi-solid, liquid, or gaseous forms; including, but not limited to, tablets, capsules, powders, granules, ointments, solutions, suppositories, enemas, injections, inhalants, and aerosols.
- compositions comprising the subject anti-TNFR2 monoclonal antibodies are provided in formulations with a wide variety of pharmaceutically acceptable carriers (see, e.g., Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel el al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th ed., Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3rd ed., Pharmaceutical Press (2000)).
- Various pharmaceutically acceptable carriers which include vehicles, adjuvants, and diluents, are available.
- Nonlimiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- compositions comprising the subject anti-TNFR2 monoclonal antibodies may be formulated for injection, including subcutaneous administration, by dissolving, suspending, or emulsifying them in an aqueous or nonaqueous solvent, such as vegetable or other oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids, or propylene glycol; and if desired, with conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
- an aqueous or nonaqueous solvent such as vegetable or other oils, synthetic aliphatic acid glycerides, esters of higher aliphatic acids, or propylene glycol
- solubilizers isotonic agents
- suspending agents emulsifying agents
- stabilizers and preservatives such as solubilizers, isotonic agents, suspending agents, emulsifying agents, stabilizers and preservatives.
- compositions may be formulated for inhalation, for example, using pressurized acceptable propellants such as dichlorodifiuoromethane, propane, nitrogen, and the like.
- compositions may also be formulated, in various embodiments, into sustained release microcapsules, such as with biodegradable or non-biodegradable polymers.
- a non limiting exemplary biodegradable formulation includes poly lactic acid-glycolic acid (PLGA) polymer.
- PLGA poly lactic acid-glycolic acid
- a non-limiting exemplary non-biodegradable formulation includes a polyglycerin fatty acid ester. Certain methods of making such formulations are described, for example, in EP 1125584 Al.
- compositions comprising one or more containers, each containing one or more doses of the subject anti-TNFR2 monoclonal antibodies, are also provided.
- a unit dosage is provided wherein the unit dosage contains a predetermined amount of a composition comprising the subject anti-TNFR2 monoclonal antibodies, with or without one or more additional agents.
- such a unit dosage is supplied in single-use prefilled syringe for injection.
- the composition contained in the unit dosage may comprise saline, sucrose, or the like; a buffer, such as phosphate, or the like; and/or be formulated within a stable and effective pH range.
- the composition may be provided as a lyophilized powder that may be reconstituted upon addition of an appropriate liquid, for example, sterile water.
- the composition comprises one or more substances that inhibit protein aggregation, including, but not limited to, sucrose and arginine.
- a composition of the invention comprises heparin and/or a proteoglycan.
- compositions are administered in an amount effective for treatment or prophylaxis of the specific indication.
- the therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, or the age of the subject being treated.
- the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 50 pg/kg body weight to about 50 mg/kg body weight per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 100 pg/kg body weight to about 50 mg/kg body weight per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 100 pg/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 0.5 mg/kg body weight to about 20 mg/kg body weight per dose.
- the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 10 mg to about 1,000 mg per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 20 mg to about 500 mg per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 20 mg to about 300 mg per dose. In some embodiments, the subject anti-TNFR2 monoclonal antibodies may be administered in an amount in the range of about 20 mg to about 200 mg per dose.
- the subject anti-TNFR2 monoclonal antibody compositions may be administered as needed to subjects.
- an effective dose of the subject anti-TNFR2 monoclonal antibodies is administered to a subject one or more times.
- an effective dose of the subject anti-TNFR2 monoclonal antibodies is administered to the subject once a month, less than once a month, such as, for example, every two months, every three months, or every six months.
- an effective dose of the subject anti-TNFR2 monoclonal antibodies is administered more than once a month, such as, for example, every two weeks, every week, twice per week, three times per week, daily, or multiple times per day.
- an effective dose of the subject anti-TNFR2 monoclonal antibodies is administered to the subject at least once.
- the effective dose of the subject anti-TNFR2 monoclonal antibodies may be administered multiple times, including for periods of at least a month, at least six months, or at least a year.
- the subject anti-TNFR2 monoclonal antibodies is administered to a subject as-needed to alleviate one or more symptoms of a condition.
- the subject anti-TNFR2 monoclonal antibodies of the invention may be administered to a subject in need thereof in combination with other biologically active substances or other treatment procedures for the treatment of diseases.
- the subject anti-TNFR2 monoclonal antibodies may be administered alone or with other modes of treatment. They may be provided before, substantially contemporaneous with, or after other modes of treatment, such as radiation therapy.
- the subject anti-TNFR2 monoclonal antibodies may be administered in conjunction with one or more of anti-cancer agents, such as the immune checkpoint inhibitor, chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent or anti-neoplastic composition.
- anti-cancer agents such as the immune checkpoint inhibitor, chemotherapeutic agent, growth inhibitory agent, anti-angiogenesis agent or anti-neoplastic composition.
- the subject anti-TNFR2 monoclonal antibodies specifically binds to TNFR2 (a “TNFR2 -binding antagonist”), e.g., TNFR2 antagonist antibody or antigen-binding fragment thereof, is administered with a second antagonist such as an immune checkpoint inhibitor (e.g., an inhibitor of the PD-1 or PD-L1 pathway), to a subject having a disease in which the stimulation of the immune system would be beneficial, e.g., cancer or infectious diseases.
- the two antagonists may be administered simultaneously or consecutively, e.g., as described below for the combination of the subject anti-TNFR2 monoclonal antibodies with an immuno-oncology agent.
- One or more additional therapeutics, e.g., checkpoint modulators may be added to a treatment with the subject anti- TNFR2 monoclonal antibodies for treating cancer or autoimmune diseases.
- the subject anti-TNFR2 monoclonal antibodies is administered with another treatment, either simultaneously, or consecutively, to a subject, e.g., a subject having cancer.
- the subject anti-TNFR2 monoclonal antibodies may be administered with one of more of: radiotherapy, surgery, or chemotherapy, e.g., targeted chemotherapy or immunotherapy.
- a method of treatment of a subject having cancer comprises administering to the subject an anti-TNFR2 monoclonal antibody of the invention, and one or more immuno-oncology agents, such as immune checkpoint inhibitor.
- Immunotherapy e.g., therapy with an immuno-oncology agent
- an immuno-oncology agent such as a PD-1 inhibitor
- the administration of the subject anti-TNFR2 monoclonal antibodies with an immuno-oncology agent has a synergic effect in the treatment of cancer, e.g., in inhibiting tumor growth.
- a subject anti-TNFR2 monoclonal antibody is sequentially administered prior to administration of the immuno-oncology agent. In one aspect, a subject anti-TNFR2 monoclonal antibody is administered concurrently with the immunology-oncology agent (such as PD-1 inhibitor). In yet one aspect, a subject anti-TNFR2 monoclonal antibody is sequentially administered after administration of the immuno-oncology agent (such as PD- 1 inhibitor).
- the administration of the two agents may start at times that are, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks apart, or administration of the second agent may start, e.g., 30 minutes, 60 minutes, 90 minutes, 120 minutes, 3 hours, 6 hours, 12 hours, 24 hours, 36 hours, 48 hours, 3 days, 5 days, 7 days, or one or more weeks after the first agent has been administered.
- the subject anti-TNFR2 monoclonal antibodies and an immuno- oncology agent are administered simultaneously, e.g., are infused simultaneously, e.g., over a period of 30 or 60 minutes, to a patient.
- the subject anti-TNFR2 monoclonal antibodies may be co-formulated with an immuno- oncology agent (such as PD-1 inhibitor).
- Immuno-oncology agents include, for example, a small molecule drug, antibody or fragment thereof, or other biologic or small molecule.
- biologic immuno- oncology agents include, but are not limited to, antibodies, antibody fragments, vaccines and cytokines.
- the antibody is a monoclonal antibody. In certain aspects, the monoclonal antibody is humanized or human antibody.
- the immuno-oncology agent is (i) an agonist of a stimulatory (including a co- stimulatory) molecule (e.g., receptor or ligand) or (ii) an antagonist of an inhibitory (including a co-inhibitory) molecule (e.g., receptor or ligand) on immune cells, e.g., T cells, both of which result in amplifying antigen- specific T cell responses.
- a stimulatory including a co- stimulatory
- an antagonist of an inhibitory (including a co-inhibitory) molecule e.g., receptor or ligand
- an immuno-oncology agent is (i) an agonist of a stimulatory (including a co-stimulatory) molecule (e.g., receptor or ligand) or (ii) an antagonist of an inhibitory (including a co- inhibitory) molecule (e.g., receptor or ligand) on cells involved in innate immunity, e.g., NK cells, and wherein the immuno-oncology agent enhances innate immunity.
- a stimulatory including a co-stimulatory
- an antagonist of an inhibitory (including a co- inhibitory) molecule e.g., receptor or ligand
- Such immuno- oncology agents are often referred to as immune checkpoint regulators, e.g., immune checkpoint inhibitor or immune checkpoint stimulator.
- the immuno-oncology agent may be an agent that targets (or binds specifically to) a member of the B7 family of membrane-bound ligands, which includes B7-1, B7-2, B7-H1 (PD-L1), B7-DC (PD-L2), B7-H2 (ICOS-L), B7-H3, B7-H4, B7-H5, and B7-H6, or a co-stimulatory or co-inhibitory receptor binding specifically to a B7 family member.
- An immuno-oncology agent may be an agent that targets a member of the TNF family of membrane bound ligands or a co- stimulatory or co-inhibitory receptor binding specifically thereto, e.g., a TNF receptor family member.
- TNF and TNFR family members that may be targeted by immuno-oncology agents include CD40 and CD40L, OX- 40, OX-40L, GITR, GITRL, CD70, CD27L, CD30, CD30L, 4-1BBL, CD137 (4-1BB), TRAIL/ Apo2-L, TRAILR1/DR4, TRAILR2/DR5, TRAILR3, TRAILR4, OPG, RANK, RANKL, TWEAKR/Fnl4, TWEAK, BAFFR, EDAR, XEDAR, TACI, APRIL, BCMA, LTfiR, LIGHT, DcR3, HVEM, VEGI/TL1 A, TRAMP/DR3, EDAR, EDA1, XEDAR, EDA2, TNFR1, Lymphotoxin a/TNRb, TNFR2, TNFa, LTfiR, Lymphotoxin a 1b2, FAS, FASL, RELT, DR6, TROY and
- a subject anti-TNFR2 monoclonal antibody is administered with one or more of (i) an antagonist of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitor) such as CTLA-4, PD-1, PD-L1, PD-L2, LAG-3, TIM3, CEACAM- 1, BTLA, CD69, Galectin-1, TIGIT, CD113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PDIH, LAIR1, TIM-1, TIM-4, and PSGL-1 and (ii) an agonist of a protein that stimulates T cell activation such as B7-1, B7-2, CD28, 4-1BB (CD137), 4-1BBL, ICOS, ICOS-L, 0X40, OX40L, GITR, GITRL, CD70, CD27, CD40, CD40L, DR3 and CD28H.
- an antagonist of a protein that inhibits T cell activation
- an immuno-oncology agent is an agent that inhibits (i.e., an antagonist of) a cytokine that inhibits T cell activation (e.g ., IL-6, IL-10, TGF-b, VEGF, and other immunosuppressive cytokines) or is an agonist of a cytokine, such as IL-2, IL- 7, IL-12, IL- 15, IL-21 and IFNa (e.g., the cytokine itself) that stimulates T cell activation, and stimulates an immune response.
- a cytokine that inhibits T cell activation
- TGF-b e.g IL-6, IL-10, TGF-b, VEGF, and other immunosuppressive cytokines
- an cytokine such as IL-2, IL- 7, IL-12, IL- 15, IL-21 and IFNa (e.g., the cytokine itself) that stimulates T cell activation, and stimulates an immune response.
- agents that can be combined with the subject anti-TNFR2 monoclonal antibodies for stimulating the immune system include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells.
- the subject anti-TNFR2 monoclonal antibodies can be combined with an antagonist of KIR.
- agents for combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-IR antagonists such as CSF-IR antagonist antibodies including RG7155 (WOl 1/70024, WOl 1/107553, WO11/131407, W013/87699, W013/119716, WO13/132044) or FPA008 (WOl 1/140249; W013169264; WO14/036357).
- CSF-IR antagonists such as CSF-IR antagonist antibodies including RG7155 (WOl 1/70024, WOl 1/107553, WO11/131407, W013/87699, W013/119716, WO13/132044) or FPA008 (WOl 1/140249; W013169264; WO14/036357).
- Immuno-oncology agents also include agents that inhibit TGF-b signaling.
- agents that may be combined with the subject anti-TNFR2 monoclonal antibodies include agents that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
- agents that enhance tumor antigen presentation e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod
- therapies that enhance the immunogenicity of tumor cells e.g., anthracyclines.
- therapies that may be combined with the subject anti-TNFR2 monoclonal antibodies include therapies that deplete or block Treg cells, e.g., an agent that specifically binds to CD25.
- Another therapy that may be combined with the subject anti-TNFR2 monoclonal antibodies is a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
- IDO indoleamine dioxigenase
- dioxigenase dioxigenase
- arginase arginase
- nitric oxide synthetase nitric oxide synthetase
- agents that may be used includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
- therapies that may be combined with the subject anti-TNFR2 monoclonal antibodies for treating cancer include therapies that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.
- the subject anti-TNFR2 monoclonal antibodies may be combined with more than one immuno-oncology agent (such as immune checkpoint inhibitor), and may be, e.g., combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Treg or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD- 137, OX-40 and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such
- the subject anti-TNFR2 monoclonal antibodies can be used with one or more agonistic agents that ligate positive costimulatory receptors; one or more antagonists (blocking agents) that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block PD-L1/PD-1/PD-L2 interactions); one or more agents that increase systemically the frequency of anti-tumor immune cells, such as T cells, deplete or inhibit Tregs (e.g., by inhibiting CD25); one or more agents that inhibit metabolic enzymes such as IDO; one or more agents that reverse/prevent T cell anergy or exhaustion; and one or more agents that trigger innate immune activation and/or inflammation at tumor sites.
- agonistic agents that ligate positive costimulatory receptors e.g., block PD-L1/PD-1/PD-L2 interactions
- antagonists that attenuate signaling through inhibitory receptors, such as antagonists that overcome distinct
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject of the subject anti-TNFR2 monoclonal antibodies and an immuno-oncology agent, wherein the immuno-oncology agent is a CTLA-4 antagonist, such as an antagonistic CTLA- 4 antibody.
- CTLA-4 antibodies include, for example, YERVOY (ipilimumab) or tremelimumab.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject of the subject anti-TNFR2 monoclonal antibodies and an immuno-oncology agent, wherein the immuno-oncology agent is a PD-1 antagonist, such as an antagonistic PD-1 antibody.
- Suitable PD-1 antibodies include, for example, OPDIVO (nivolumab), KEYTRUDA (pembrolizumab), or MEDI-0680 (AMP-514; WO2012/145493).
- the immuno-oncology agent may also include pidilizumab (CT-011).
- Another approach to target the PD-1 receptor is the recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgGl, called AMP -224.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject of an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a PD-L1 antagonist, such as an antagonistic PD- LI antibody.
- Suitable PD-L1 antibodies include, for example, MPDL3280A (RG7446; W 02010/077634), durvalumab (MEDI4736), BMS-936559 (W02007/005874), MSB0010718C (WO2013/79174) orrHigM12B7.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a LAG-3 antagonist, such as an antagonistic LAG-3 antibody.
- Suitable LAG3 antibodies include, for example, BMS-986016 (W010/19570, WO14/08218), or IMP-731 or IMP-321 (W008/132601, WO09/44273).
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a CD137 (4-1BB) agonist, such as an agonistic CD 137 antibody.
- Suitable CD 137 antibodies include, for example, urelumab or PF- 05082566 (W012/32433).
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a GITR agonist, such as an agonistic GITR antibody.
- GITR antibodies include, for example, TRX-518 (W006/105021, W 009/009116), MK-4166 (WO 11/028683) or a GITR antibody disclosed in WO20 15/031667.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is an 0X40 agonist, such as an agonistic 0X40 antibody.
- Suitable 0X40 antibodies include, for example, MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a CD40 agonist, such as an agonistic CD40 antibody.
- the immuno-oncology agent is a CD40 antagonist, such as an antagonistic CD40 antibody.
- Suitable CD40 antibodies include, for example, lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a CD27 agonist, such as an agonistic CD27 antibody.
- Suitable CD27 antibodies include, for example, varlilumab (CDX-1127).
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is MGA271 (to B7H3) (WOl 1/109400).
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a KIR antagonist, such as lirilumab.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is an IDO antagonist.
- IDO antagonists include, for example, INCB-024360 (W02006/122150, WO07/75598, WO08/36653, W 008/36642), indoximod, NLG-919 (W009/73620, WO09/1156652, WOl 1/56652, WO 12/142237) or F001287.
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein the immuno-oncology agent is a Toll-like receptor agonist, e.g., a TLR2/4 agonist (e.g., Bacillus Calmette-Guerin); a TLR7 agonist (e.g., Hiltonol or Imiquimod); a TLR7/8 agonist (e.g., Resiquimod); or a TLR9 agonist (e.g., CpG7909).
- a TLR2/4 agonist e.g., Bacillus Calmette-Guerin
- TLR7 agonist e.g., Hiltonol or Imiquimod
- TLR7/8 agonist e.g., Resiquimod
- TLR9 agonist e.g., CpG7909
- a subject having a disease that may benefit from stimulation of the immune system is treated by administration to the subject an anti-TNFR2 monoclonal antibody of the invention and an immuno-oncology agent, wherein, the immuno-oncology agent is a TGF-b inhibitor, e.g., GC1008, LY2157299, TEW7197 or IMC-TR1.
- the immuno-oncology agent is a TGF-b inhibitor, e.g., GC1008, LY2157299, TEW7197 or IMC-TR1.
- the invention described herein provides monoclonal antibodies specific for TNFR2, or antigen-binding fragments thereof.
- one aspect of the invention provides an isolated monoclonal antibody, or an antigen-binding fragment thereof, which competes with any of the isolated monoclonal antibody or antigen-binding fragment thereof described herein for binding to the epitope of SEQ ID NO: 13/101 or 38, or for binding to the epitope bound by HFB3-18.
- FIGs. 1 lA-11C SEQ ID NO: 13 in FIGs. 11A and 11B, and SEQ ID NO: 101 in FIG. 11C).
- a related aspect of the invention provides an isolated monoclonal antibody, or an antigen-binding fragment thereof, which specifically binds to the epitope of SEQ ID NO: 13/101 or 38, or the epitope bound by HFB3-18.
- Another related aspect of the invention provides an isolated monoclonal antibody, or an antigen-binding fragment thereof, wherein said monoclonal antibody or antigen-binding fragment thereof is specific for human TNFR2, and wherein said monoclonal antibody comprises: (la) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 1, a HCVR CDR2 sequence of SEQ ID NO: 2, and a HCVR CDR3 sequence of SEQ ID NO: 3; and, (lb) a light chain variable region (LCVR), comprising a LCVR CDR1 sequence of SEQ ID NO: 4, a LCVR CDR2 sequence of SEQ ID NO: 5, and a LCVR CDR3 sequence of SEQ ID NO: 6; or (2a) a heavy chain variable region (HCVR), comprising a HCVR CDR1 sequence of SEQ ID NO: 14, a HCVR CDR2 sequence of SEQ ID NO: 15, and a HCVR CDR3 sequence of SEQ
- the HCVR sequence in the isolated monoclonal antibody or antigen-binding fragment thereof: (1A) the HCVR sequence is SEQ ID NO: 7; and/or, (IB) the LCVR sequence is SEQ ID NO: 8, or, (2A) the HCVR sequence is SEQ ID NO: 20; and/or, (2B) the LCVR sequence is SEQ ID NO: 21, or, (3 A) the HCVR sequence is SEQ ID NO: 32; and/or, (3B) the LCVR sequence is SEQ ID NO: 33, or, (4 A) the HCVR sequence is SEQ ID NO: 45; and/or, (4B) the LCVR sequence is SEQ ID NO: 46, or, (5 A) the HCVR sequence is SEQ ID NO: 57; and/or, (5B) the LCVR sequence is
- the isolated monoclonal antibody or antigen-binding fragment thereof has: (la) a heavy chain sequence of SEQ ID NO: 9; and/or, (lb) a light chain sequence of SEQ ID NO: 10, or, (2a) a heavy chain sequence of SEQ ID NO: 22; and/or, (2b) a light chain sequence of SEQ ID NO: 23, or, (3a) a heavy chain sequence of SEQ ID NO:
- HFB3-l-hGl mouse monoclonal antibody
- CDR-L1 SSVTY ( SEQ ID NO : 4 )
- CDR-L2 LTSNLASGVPA ( SEQ ID NO : 5 )
- HCVR IS SEQ ID NO : 7
- LCVR IS SEQ ID NO : 8 .
- SCEDSTYTQLWNWVPECLS SEQ ID NO: 13
- SCEDSTYTQLWNWVPECLSC SEQ ID NO : 101
- HFB3-lhz6-hGl humanized monoclonal antibody
- CDR-L1 SSVTY ( SEQ ID NO : 17 )
- CDR-L2 LTSNLASGVPS ( SEQ ID NO : 18 )
- HCVR IS SEQ ID NO : 20
- LCVR IS SEQ ID NO : 21 .
- HFB3-14-hGl mouse monoclonal antibody
- CDR-L2 STSSLNSGVPS (SEQ ID NO: 30)
- HCVR IS SEQ ID NO: 32, AND LCVR IS SEQ ID NO: 33.
- HC EVQLQQSGPELVKPGASVRISCKASGYTFTDYYMNWVKQSHGKSLEWIGDINPNDGGTTYSQ KFKGKATLTVDKSSSTAYMELRSLTSEDSAVYFCAREGNYYAYDVRVWYFDVWGTGTTVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
- HFB3-14hzlc-hGl humanized monoclonal antibody
- HCVR IS SEQ ID NO: 45, AND LCVR IS SEQ ID NO: 46.
- HFB3-18-hGl mouse monoclonal antibody
- CDR-H3 TRSVGGYGTTYWYFDV (SEQ ID NO: 53)
- CDR-L2 GASTRESGVPD (SEQ ID NO: 55)
- HCVR IS SEQ ID NO: 57
- LCVR IS SEQ ID NO: 58.
- HFB3-18hzl-hGl humanized monoclonal antibody
- CDR-H3 TRSVGGYGTTYWYFDV (SEQ ID NO: 65)
- CDR-L1 QNLLNSGNQKNY (SEQ ID NO: 66)
- CDR-L2 GASTRESGVPD ( SEQ ID NO : 67 )
- HCVR IS SEQ ID NO : 69
- LCVR IS SEQ ID NO : 70 .
- the monoclonal antibodies of the invention or antigen-binding fragments thereof are human-mouse chimeric antibodies, humanized antibodies, human antibodies, CDR- grafted antibodies, or resurfaced antibodies.
- the antigen-binding fragment thereof is an Fab, Fab’, F(ab’)2, F d , single chain Fv or scFv, disulfide linked F v , V-NAR domain, IgNar, intrabody, IgGACFh, minibody, F(ab’)3, tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAt2, (SCFV)2, or scFv-Fc.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof has an engineered Fc region that abolishes immue effector function.
- the engineered Fc region of the subject antibody may have a “LALA” double mutation (Leu234Ala together with Leu235Ala) and thus have diminished effector function.
- Such antibodies may have the designation of G1AA for having the LALA double mutation on
- IgGl Other recombinant human IgG antibodies (hlgGs) partially or completely devoid of binding to Fey receptors (FcyRs) and complement protein Clq, and thus with abolished immune effector functions, are known in the art, and are of use for various therapeutic applications in order to reduce FcyR activation and Fc-mediated toxicity. Certain such Fc- engineered antibodies / fragments partially achieve this goal, while others completely abolishes FcyR activation and Fc-mediated toxicity.
- hlgGs recombinant human IgG antibodies
- FcyRs Fey receptors
- complement protein Clq complement protein Clq
- the antibody / fragment of the invention has an engineered hlgG Fc domain comprising hIgGl-P329G LALA or hIgG4-P329G SPLE (the human IgG4 S228P/L235E variant of IgG4) mutations, with completely abolish FcyR and Clq interactions, and with unaffected FcRn interactions and Fc stability.
- the P329G Fc mutation disrupts the formation of a proline sandwich motif with the FcyRs. As this motif is present in the interface of all IgG Fc/FcyR complexes, its disruption can be applied to all human and most of the other mammalian IgG subclasses to create effector silent IgG molecules.
- the subject antibody / fragment has any one IgG subclass with such effector silent Fc mutation.
- the monoclonal antibodies of the invention or antigen binding fragments thereof are specific for human TNFR2, e.g., substantially do not cross- react with TNFR1, and/or substantially do not cross-react with mouse TNFR2.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof cross-react with a monkey TNFR2, such as a cynomolgus monkey or rhesus monkey TNFR2.
- the monoclonal antibody of the invention or antigen-binding fragment thereof has a dissociation constant (K d ) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 50 nM, ⁇ 25 nM, ⁇ 20 nM, ⁇ 15 nM, ⁇ 10 nM, ⁇ 5 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 8 M or less, e.g. from 10 8 M to 10 13 M, e.g., from 10 9 M to 10 13 M) for rhTNFR2.
- K d dissociation constant
- the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to a region within the CRD2 domain of the TNFR2. In certain embodiment, the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to the epitope bound by HFB3-1.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to a region within the CRD3 domain of the TNFR2. In certain embodiment, the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to the epitope bound by HFB3-14. In certain embodiment, the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to the epitope bound by HFB3-18.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof bind to the epitope of SEQ ID NO: 13/101 or 38.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof enhance the binding of human recombinant TNFa to TNFR2.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof block the binding of human recombinant TNFa to TNFR2.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof substantially do not affect binding of human recombinant TNFa to TNFR2.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof inhibit TNFa-mediated signaling, such as NFKB signaling, and/or induce down-regulation of NFKB downstream target genes. In other embodiments, however, the monoclonal antibodies of the invention or antigen-binding fragments thereof promote TNFa- mediated signaling, such as NFKB signaling, and/or induce up-regulation of NFKB downstream target genes.
- NFKB signaling is stimulated in effector T cells, such as CD8 and/or CD4 Tconv T cells. In some other embodiments, NFKB signaling is inhibited in effector T cells, such as CD8 and/or CD4 Tconv T cells.
- NFKB signaling is stimulated in Tregs. In some other embodiments, NFKB signaling is inhibited in Tregs.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof stimulate CD8 and/or conventional CD4 T cell proliferation, optionally with or without co-stimulation by CD3/CD28, and/or optionally with or without TNFa co stimulation.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof preferentially bind to (CD3/CD28) TCR-activated primary CD8 and/or CD4 T cells as compared to unstimulated primary CD8 and/or CD4 T cells.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof particularly humanized monoclonal antibodies or antigen-binding fragments thereof, enhance CD3/CD28-induced activation and/or proliferation, such as CD3/CD28-induced activation and/or proliferation of primary CD8 and/or CD4 T cells, including activation and/or proliferation of primary CD8 and/or CD4 T cells in the presence of Tregs.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof co-stimulate activation and/or proliferation of primary CD8 and/or CD4 T cells in a cross-linking independent manner.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof co-stimulate activation and/or proliferation of primary CD8 and/or CD4 T cells in a cross-linking dependent manner.
- the monoclonal antibody or antigen-binding fragment thereof of the invention enhances binding between TNFa and TNFR2; enhances TNFa-mediated or - co-stimulated NFKB signaling (e.g., in TCR-activated CD8 and/or CD4 Tconv T cells); and/or promotes TCR-activated effector T cell (e.g., CD8 and/or CD4 Tconv T cell) proliferation in the presence of Treg.
- the monoclonal antibody or antigen-binding fragment thereof of the invention enhances TNFa-mediated CD25 expression on Tregs.
- the monoclonal antibodies of the invention or antigen-binding fragments thereof include humanized monoclonal antibodies or antigen-binding fragments thereof, have good developability profile, including being stable under high temperature (e.g., 25°C or 40°C), low pH conditions (e.g., pH3.5 around room temperature), and/or following several rounds of freeze/thaw cycles.
- the monoclonal antibodies of the invention or antigen binding fragments thereof, including humanized monoclonal antibodies or antigen-binding fragments thereof include one or more point mutations of in amino acid sequences that are designed to improve developability of the antibody.
- TAP Therapeutic Antibody Profiler
- the authors further provide TAP as freely available at opig.stats.ox.ac.uk/webapps/sabdab- s abpred/T AP . php .
- the antibody of the invention is a humanized antibody.
- Humanized antibodies are useful as therapeutic molecules because humanized antibodies reduce or eliminate the human immune response to non-human antibodies (such as the human anti-mouse antibody (HAMA) response), which can result in an immune response to an antibody therapeutic, and decreased effectiveness of the therapeutic.
- HAMA human anti-mouse antibody
- An antibody may be humanized by any standard method.
- Non-limiting exemplary methods of humanization include methods described, e.g., in U.S. Patent Nos. 5,530,101; 5,585,089; 5,693,761; 5,693,762; 6,180,370; Jones etal, Nature 321:522-525 (1986); Riechmann et al, Nature 332: 323-27 (1988); Verhoeyen et al, Science 239: 1534-36 (1988); and U.S. Publication No. US 2009/0136500. All incorporated by reference.
- a humanized antibody is an antibody in which at least one amino acid in a framework region of a non-human variable region has been replaced with the amino acid from the corresponding location in a human framework region. In some embodiments, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least 10, at least 11, at least 12, at least 15, or at least 20 amino acids in the framework regions of a non-human variable region are replaced with an amino acid from one or more corresponding locations in one or more human framework regions.
- some of the corresponding human amino acids used for substitution are from the framework regions of different human immunoglobulin genes. That is, in some such embodiments, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a first human antibody or encoded by a first human immunoglobulin gene, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a second human antibody or encoded by a second human immunoglobulin gene, one or more of the non-human amino acids may be replaced with corresponding amino acids from a human framework region of a third human antibody or encoded by a third human immunoglobulin gene, etc.
- all of the corresponding human amino acids being used for substitution in a single framework region need not be from the same human framework. In some embodiments, however, all of the corresponding human amino acids being used for substitution are from the same human antibody or encoded by the same human immunoglobulin gene.
- an antibody is humanized by replacing one or more entire framework regions with corresponding human framework regions.
- a human framework region is selected that has the highest level of homology to the non-human framework region being replaced.
- such a humanized antibody is a CDR-grafted antibody.
- one or more framework amino acids are changed back to the corresponding amino acid in a mouse framework region.
- Such “back mutations” are made, in some embodiments, to retain one or more mouse framework amino acids that appear to contribute to the structure of one or more of the CDRs and/or that may be involved in antigen contacts and/or appear to be involved in the overall structural integrity of the antibody.
- ten or fewer, nine or fewer, eight or fewer, seven or fewer, six or fewer, five or fewer, four or fewer, three or fewer, two or fewer, one, or zero back mutations are made to the framework regions of an antibody following CDR grafting.
- a humanized antibody also comprises a human heavy chain constant region and/or a human light chain constant region.
- the antibody of the invention is a human antibody.
- Human antibodies can be made by any suitable method. Non-limiting exemplary methods include making human antibodies in transgenic mice that comprise human immunoglobulin loci. See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA 90: 2551-55 (1993); Jakobovits et al, Nature 362: 255-8 (1993); onberg et al, Nature 368: 856-9 (1994); and U.S. Patent Nos. 5,545,807; 6,713,610; 6,673,986; 6,162,963; 5,545,807; 6,300,129; 6,255,458; 5,877,397; 5,874,299; and 5,545,806.
- Non-limiting exemplary methods also include making human antibodies using phage display libraries. See, e.g., Hoogenboom et al., J. Mol. Biol. 227: 381-8 (1992); Marks et al, J. Mol. Biol. 222: 581-97 (1991); and PCT Publication No. WO 99/10494.
- a humanized, chimeric, or human antibody described herein comprises one or more human constant regions.
- the human heavy chain constant region is of an isotype selected from IgA, IgG, and IgD.
- the human light chain constant region is of an isotype selected from K and l.
- an antibody described herein comprises a human IgG constant region, for example, human IgGl, IgG2, IgG3, or IgG4.
- an antibody or Fc fusion partner comprises a C237S mutation, for example, in an IgGl constant region.
- an antibody described herein comprises a human IgG2 heavy chain constant region.
- the IgG2 constant region comprises a P331S mutation, as described in U.S. Patent No. 6,900,292.
- an antibody described herein comprises a human IgG4 heavy chain constant region.
- an antibody described herein comprises an S241P mutation in the human IgG4 constant region. See, e.g., Angal et al. Mol. Immunol. 30(1): 105-108 (1993).
- an antibody described herein comprises a human IgG4 constant region and a human k light chain.
- the choice of heavy chain constant region can determine whether or not an antibody will have effector function in vivo.
- effector function includes antibody-dependent cell-mediated cytotoxicity (ADCC) and/or complement-dependent cytotoxicity (CDC), and can result in killing of the cell to which the antibody is bound.
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement-dependent cytotoxicity
- antibodies comprising human IgGl or IgG3 heavy chains have effector function.
- effector function is not desirable.
- effector function may not be desirable in treatments of inflammatory conditions and/or autoimmune disorders.
- a human IgG4 or IgG2 heavy chain constant region is selected or engineered.
- an IgG4 constant region comprises an S241P mutation.
- any of the antibodies described herein may be purified by any suitable method. Such methods include, but are not limited to, the use of affinity matrices or hydrophobic interaction chromatography.
- Suitable affinity ligands include the antigen and/or epitope to which the antibody binds, and ligands that bind antibody constant regions.
- a Protein A, Protein G, Protein A/G, or an antibody affinity column may be used to bind the constant region and to purify an antibody.
- hydrophobic interactive chromatography for example, a butyl or phenyl column
- HIC hydrophobic interactive chromatography
- Many methods of purifying polypeptides are known in the art.
- an antibody described herein is produced in a cell-free system.
- Nonlimiting exemplary cell-free systems are described, e.g., in Sitaraman etal. , Methods Mol. Biol. 498: 229-44 (2009); Spirin, Trends Biotechnol. 22: 538-45 (2004); Endo etal, Biotechnol. Adv. 21 : 695-713 (2003).
- nucleic acid molecules comprising polynucleotides that encode one or more chains of an antibody described herein.
- a nucleic acid molecule comprises a polynucleotide that encodes a heavy chain or a light chain of an antibody described herein.
- a nucleic acid molecule comprises both a polynucleotide that encodes a heavy chain and a polynucleotide that encodes a light chain, of an antibody described herein.
- a first nucleic acid molecule comprises a first polynucleotide that encodes a heavy chain and a second nucleic acid molecule comprises a second polynucleotide that encodes a light chain.
- the heavy chain and the light chain are expressed from one nucleic acid molecule, or from two separate nucleic acid molecules, as two separate polypeptides.
- a single polynucleotide encodes a single polypeptide comprising both a heavy chain and a light chain linked together.
- a polynucleotide encoding a heavy chain or light chain of an antibody described herein comprises a nucleotide sequence that encodes a leader sequence, which, when translated, is located at the N-terminus of the heavy chain or light chain.
- the leader sequence may be the native heavy or light chain leader sequence, or may be another heterologous leader sequence.
- Nucleic acid molecules may be constructed using recombinant DNA techniques conventional in the art.
- a nucleic acid molecule is an expression vector that is suitable for expression in a selected host cell, such as a mammalian cell.
- Vectors comprising polynucleotides that encode heavy chains and/or light chains of the antibodies described herein are provided.
- Such vectors include, but are not limited to, DNA vectors, phage vectors, viral vectors, retroviral vectors, etc.
- a vector comprises a first polynucleotide sequence encoding a heavy chain and a second polynucleotide sequence encoding a light chain.
- the heavy chain and light chain are expressed from the vector as two separate polypeptides.
- the heavy chain and light chain are expressed as part of a single polypeptide, such as, for example, when the antibody is an scFv.
- a first vector comprises a polynucleotide that encodes a heavy chain and a second vector comprises a polynucleotide that encodes a light chain.
- the first vector and second vector are transfected into host cells in similar amounts (such as similar molar amounts or similar mass amounts).
- a mole- or mass-ratio of between 5:1 and 1:5 of the first vector and the second vector is transfected into host cells.
- a mass ratio of between 1:1 and 1:5 for the vector encoding the heavy chain and the vector encoding the light chain is used.
- a mass ratio of 1:2 for the vector encoding the heavy chain and the vector encoding the light chain is used.
- a vector is selected that is optimized for expression of polypeptides in CHO or CHO-derived cells, or in NSO cells. Exemplary such vectors are described, e.g., in Running Deer el al., Biotechnol. Prog. 20:880-889 (2004).
- a vector is chosen for in vivo expression of the subject antibodies in animals, including humans.
- expression of the polypeptide or polypeptides is under the control of a promoter or promoters that function in a tissue- specific manner. For example, liver- specific promoters are described, e.g., in PCT Publication No. WO 2006/076288.
- heavy chains and/or light chains of the antibodies described herein may be expressed in prokaryotic cells, such as bacterial cells; or in eukaryotic cells, such as fungal cells (such as yeast), plant cells, insect cells, and mammalian cells. Such expression may be carried out, for example, according to procedures known in the art.
- exemplary eukaryotic cells that may be used to express polypeptides include, but are not limited to, COS cells, including COS 7 cells; 293 cells, including 293-6E cells; CHO cells, including CHO-S and DG44 cells; PER.C6® cells (Crucell); and NSO cells.
- heavy chains and/or light chains of the antibodies described herein may be expressed in yeast.
- a particular eukaryotic host cell is selected based on its ability to make desired post-translational modifications to the heavy chains and/or light chains of TNFR2 antibody.
- CHO cells produce polypeptides that have a higher level of sialylation than the same polypeptide produced in 293 cells.
- nucleic acids may be transiently or stably transfected in the desired host cells, according to any suitable method.
- one or more polypeptides may be produced in vivo in an animal that has been engineered or transfected with one or more nucleic acid molecules encoding the polypeptides, according to any suitable method.
- mice was immunized with the recombinant extracellular domain
- ECD human TNFR2
- rhTNFR2 human TNFR2
- VH and VL sequences of selected antibodies were aligned, and the consensus sequences were obtained, as shown in FIG. 1.
- the H-CDR3 and L-CDR3 regions are marked by boxed sequences.
- CHO.hHFB3 and CHO.mkHFB3 cells were then tested for their abilities to bind human and monkey TNFR2 expressed by CHO cells (CHO.hHFB3 and CHO.mkHFB3 cells respectively). Briefly, about 40,000 CHO.hHFB3 or CHO.mkHFB3 cells were seeded in tissue culture wells, and serial 1:3 dilutions of each test antibodies, with starting (highest) concentration of about 66 nM antibody, were added to each cell type and incubated for about an hour. Antibodies bound to the cells were detected by using 17 nM of anti-human Fc antibody labeled by AF647 (ALEXSA FLUOR ® 647 fluorescent dye). An isotype matched negative control antibody was also used in this assay. The data, including EC50 values and E max for each antibody, were compiled in FIG. 2A.
- test antibodies showed sub- or single digit- nM level of affinity (EC50) against hTNFR2 expressed on CHO cells. These antibodies also showed cross reactivity against rhesus monkey ortholog of TNFR2 expressed on CHO cells, with substantially the same trend for binding affinity as compared to hTNFR2 binding. See FIG. 2A.
- FIG. 2B Specifically, binding of 25 ng/mL TNFa to CHO.hHFB3 cells were measured after pre incubating the CHO cells with the respective antibodies for about an hour. The percentage of cells bound to TNFa (labeled as HFB2003L) was then plotted against increasing concentrations of the antibodies.
- Binding specificity towards human TNFR2 (vs. the related TNFR1 receptor) was also verified using recombinant human TNFR2 and TNFR1 proteins.
- tissue culture plates were coated with either 0.1 pg/mL of His-tagged recombinant human TNFR2 or TNFR1 overnight at 4°C. The coated plates were then incubated for about 1 hour on ice with 1:3 serial dilutions of each test antibodies, with starting (highest) concentration of about 66 nM antibody. Antibodies bound to the cells were detected by using 1:5000 dilution of HRP-labeled anti-human Fc antibody and TMB substrate. Isotype matched negative control antibody F3, as well as the MR2-1 positive control antibody specific for rhTNFR2 and a positive control antibody specific for rhTNFRl were also used in this assay. The data, including EC50 values for each antibody, were compiled in FIG. 4 A.
- HFB3-1 sub-nM affinity
- -14 -21, -23, -24, and -25
- 4 additional ones HFB-3, -6, -19, and -22
- HFB3- 18 showed relatively the weakest binding to the monomeric rhTNFR2 with double digit nM affinity.
- none of the 11 antibodies showed any detectable level of binding towards the His-tagged TNFR1 receptor, demonstrating binding specificity for TNFR2.
- AHC biosensors enable kinetic characterization of macromolecular interactions between human Fc-containing proteins (e.g., the subject antibodies) and target analytes (e.g., recombinant human TNFR2). Immobilization of human Fc-containing proteins is achieved through a factory immobilized anti-human Fc-specific antibody whose high-affinity for the human Fc domain provides the stable baseline required for demanding kinetics applications.
- test antibodies humanized ⁇ were loaded at a concentration of 20 pg/mL in assay buffer (PBS, pH 7.4, 0.1% BSA, 0,1% Tween20).
- the analyte was His- tagged recombinant human TNFR2 at 500, 167, or 55.7 nM.
- the capture assay was run at 25°C. K d of tested antibodies are in the nM range (see FIG. 4B).
- HFB3-l-hGl Epitope mapping experiments of HFB3-l-hGl, HFB3-14-hGl, HFB3-6-hGl, and HFB3-18-hGl antibodies showed that these antibodies recognize different domains of TNFR2.
- One structural characteristic shared by most members of the TNFR superfamily is that they contain from about two to four cysteine-rich domains (CRDs).
- HFB3-l-hGl binds to a region within the CRD2 domain (FIG. 11C)
- HFB3-18-hGl binds to a conformational epitope within CDR1.
- HFB3-6-hGl binds to a region within CRD3, and HFB3-14-hGl also binds to an epitope within CRD3 region that is smaller than HFB3-6- hGl’s epitope (see FIG. 11B). Locations of their epitopes on 3D-model of the TNFR2-TNFa complex can be visualized in FIG. 1 ID.
- TNFR2 is predominantly expressed on Tregs as well as on CD4 + and CD8 + T cells in various cancer types.
- T cell subtypes including Tregs and CD4 + and CD8 + T cells, were isolated from the various tumor samples, and the relative percentage of the T cell subtypes in the tumor samples, as well as the average relative expression levels of TNRF2 (scale of 2-8) in the T cell subtypes, were determined using RNA sequence analysis. The results were compiled in FIG. 5.
- TNFR2 was predominantly and most frequently found in Tregs, as well as CD4 + and CD8 + T cells. In addition, the highest relative expression levels were also found in the Tregs. See FIG. 5, left panel. The data suggests that TNFR2 is an attractive target for cancer therapy.
- this experiment demonstrates that the subject anti-TNFR2 monoclonal antibodies can bind to primary T cell subtypes, preferentially to activated T cells.
- T cell subtypes including Tregs, CD8 or CD4 conventional T cells were isolated from human PBMC. Isolated T cell subtypes were deeded at a density of about 50,000 cells/well, in the presence of 6.6 nM of anti-CD28 antibody to co- stimulate primary T cells for about 3 days. The stimulated primary T cells were then treated with various concentrations of 1:3 serial dilution of anti-TNFR2 human-mouse chimeric monoclonal antibodies of the invention for 1 hour on ice, with the highest concentration being 66 nM. Bound chimeric antibodies were detected by adding 17 nM of anti-hFc antibody labeled by AF647 dye for 1 hour incubation on ice, followed by FACS analysis to detect AF647 signals.
- FIG. 6 top panel shows that the CD4 Tconv was the most abundant T cell subtype at about 30% of total hPBMC, followed by 10% CD8 T cell and about 1% Treg.
- non-TCR-activated primary T cells did not detectably bind the subject anti-TNFR2 antibodies, except that relatively low levels of binding occurred in primary Tregs.
- receptor occupancy Emax was the highest in Tregs, followed by CD8 then CD4 Tconv.
- Tregs Given the relatively low abundancy of the Tregs compared to the CD8 and CD4 Tconv, the expression of TNFR2 on Tregs was much higher than that on CD8 and CD4 T cells on per cell basis.
- HFB3-1, -6, -24, -25 and SBT1 positive control
- HFB3-14 and -19 exhibited single digit nM affinity
- HFB3-18, -21, and -22 had double digit nM affinity.
- CD4 Tconv CD4 + CD25
- CD8 + T cells were isolated from hPBMC using standard techniques and commercially available kits. Isolated T cells were incubated with 10 pg/mL (66 nM) of the various test monoclonal antibodies of the invention or proper positive or negative controls, together with 25 ng/mL (1.5 nM) of TNFa, for about 24 hours. The stimulated T cells were then harvested, and their mRNA was isolated, reverse transcribed, and subjected to QPCR analysis on selected NFKB signaling pathway genes such as CD25, Foxp3, NFKB2, RelB, and LTA. The expression levels of these genes in the presence and absence of co- stimulation by the subject antibodies were compared in the bar graph in FIG. 7. The results were presented as fold change compared to no stimulation control (lx).
- HFB3-1 HFB3-1, -14, -23, -24, and -25 induced NFKB signaling.
- HFB3-1 and -14 HFB3-18, induced NFKB signaling from time to time, particularly in NFKB2, RelB and LTA.
- CD8 and CD4 Tconv cells were isolated from hPBMC as described, and were labeled with 2 mM of CTV (CELLTRACETM Violet Cell Proliferation Kit from Invitrogen) to track T cell proliferation.
- CTV CELLTRACETM Violet Cell Proliferation Kit from Invitrogen
- the CELLTRACETM Violet dye easily diffuses into cells where it is cleaved by intracellular esterases to yield a highly fluorescent compound, which then covalently binds to intracellular amines, resulting in stable, well-retained fluorescent staining that can be fixed with aldehyde fixatives. Excess unconjugated reagent passively diffuses to the extracellular medium, where it can be quenched with complete media and washed away.
- Labeled T cells were then seeded at a density of about 50,000 cells / well in the coated 96-well plates, in the presence of 6.6 nM of anti-CD28 antibody for co-stimulation for about 3 days. The cells were then fixed for FACS analysis of the fluorescent signals.
- FIG. 8 shows that certain of the subject anti-TNFR2 antibodies co stimulated CD8 and CD4 Tconv proliferation, even at the lower 20 nM concentration.
- the benchmark positive control antibodies SBT-1 and -4 also co-stimulated T cell proliferation under the same conditions, but did so to a lesser extent that the HFB3-1, -14, -18, and -25.
- CD8 and CD4 Tconv were isolated from donor KP59095, and the isolated primary T cells were stimulated by CD3/CD28 TCR activation, as well as the subject anti-TNFR2 monoclonal antibodies HFB3-1, -14, or -18, in the presence of absence of 25 ng/mL recombinant human TNFa (rhTNFa).
- the anti-TNFR2 antibodies were either plate bound, or were supplied as soluble antibody present in the binding mixture.
- all three plate-bound anti-TNFR2 antibodies (HFB3-1, -14 and -18) stimulated CD8 T cell proliferation (see FIG. 19, lower left comer panel).
- CD3 + T cells including CD8 and CD4 Tconv effector T cells, as well as Tregs, were isolated from human PBMC, and were co-stimulated by CD3/CD28-mediated TCR activation and the subject anti-TNFR2 monoclonal antibody, substantially as described above, for about 4 days.
- CTV CELLTRACETM Violet Cell Proliferation Kit from Invitrogen
- Activation of CD4 + T cells CD8 + T cells was also determined by measuring the percentage of CD25 + T cells in the respective T cell populations.
- the anti-TNFR2 monoclonal antibody of the invention e.g ., HFB3-lhz6-hGlAA, a humanized version of HFB3-1, see below
- ADCC antibody-dependent cellular cytotoxicity
- HH lymphoma cells were target cells.
- the effector to target cell ratio was about 6:1.
- Co cultured effector and target cells were incubated overnight in the presence of a subject anti- TNFR2 monoclonal antibody (e.g., HFB3-1, -14, or -18), or an isotype matched control (hlgGl), at a concentration of 0, 0.0066, 0.66, or 66 nM.
- the moganulizumab antibody was used as a positive control for ADCC.
- the results in FIG. 10 showed that the positive control antibody moganulizumab had at least 120-fold stronger ADCC effect on the target cells than any of the tested anti-TNFR2 monoclonal antibodies.
- HFB3-1, -14 and -18 Multiple humanized monoclonal antibodies for HFB3-1, -14 and -18 were generated, including at least 20 for HFB3-1, 16 for HFB3-14, and one for HFB3-18 (due to the selected human germline being highly similar to the parental HFB3-18 monoclonal antibody coding sequence).
- the abilities of these humanized monoclonal antibodies to bind human TNFR2 expressed on CHO cells were determined substantially as described in Example 1.
- FIG. 12A shows that the humanized HFB3-lhz6, HFB3-14hzlc and HFB3-18hzl bound to CHO cells expression human TNFR2 (CHO.hTNFR) but did not bind to the parental CHO cells.
- FIG. 12A shows that the humanized HFB3-lhz6, HFB3-14hzlc and HFB3-18hzl bound to CHO cells expression human TNFR2 (CHO.hTNFR) but did not bind to the parental CHO cells.
- HFB3-1 antibodies namely HFB3-lhz6, -lhz8, -lhz9, -lhzlO, -lhzll, -lhzl2, and -lhzl4, and at least 8 humanized HFB3-14 antibodies, namely HFB3-14hzlc, -14hz2c, -14hz3c, -14hz4c, -14hz6c, -14hz7c, - 14hzl2c, and -14hzl4c, retained roughly the same (if not better) level of binding affinity by the respective parental chimeric antibodies towards CHO cell-expressed TNFR2 (CHO.hHFB3).
- FIG. 13 shows that the general trend of binding towards CHO cells expressing monkey TNFR2 matched that for CHO.hTNFR2.
- HFB3-14hz2c HFB3-14hz2c
- Binding of the humanized anti-TNFR2 antibodies is specific for TNFR2 and not to TNFR1.
- the ELISA assay in FIG. 14A demonstrated that humanized monoclonal antibodies HFB3-lhz6, HFB3-14hzlc and HFB3-18hzl bound to recombinant human and cynomolgus TNFR2 (hTNFR2-His and cynoTNFR2-His, respectively) without recognizing recombinant human TNFR1 (hTNFRl-His).
- binding EC50 of these humanized anti-TNFR2 antibodies to recombinant human and cynomolgus TNFR2 ranged from a sub- to single digit- nM.
- Binding affinity for the humanized variants towards human TNFR2 was also verified using recombinant human TNFR2 protein and AHC biosensor.
- Anti-Human IgG Fc Capture (AHC) biosensors enable kinetic characterization of macromolecular interactions between human Fc-containing proteins (e.g., the subject antibodies) and target analytes (e.g., recombinant human TNFR2). Immobilization of human Fc-containing proteins is achieved through a factory immobilized anti-human Fc-specific antibody whose high-affinity for the human Fc domain provides the stable baseline required for demanding kinetics applications. In this specific experiment, the test antibodies (humanized vs.
- the parental chimeric antibody were loaded at a concentration of 20 pg/mL in assay buffer (PBS, pH 7.4, 0.1% BSA, 0,1% Tween20).
- the analyte was His-tagged recombinant human TNFR2 at 500, 167, or 55.7 nM.
- the capture assay was run at 25 °C.
- Example 3 shows that the chimeric anti-TNFR2 antibodies bind to TCR-activated T cells. Substantially the same experiment was run for the humanized variants, and the results were shown in FIG. 15.
- Example 5 showed that co- stimulatory effect of chimeric anti-TNFR2 monoclonal antibodies proliferates isolated human primary CD8 and CD4 Tconv cells. This experiment demonstrates the same in TCR-activated CD4 T cells using the humanized variants of HFB3- 1 and HFB3-14.
- FIG. 16 shows that humanized variants HFB3-lhz5, -lhz6, -lhz8, - lhzlO, -lhzll, and -lhzl2 strongly stimulated TCR-activated CD4 T cells based on the CTV proliferation assay (see above), each to a larger extent compared to the parental HFB3-1 chimeric antibody. The same was repeated for the HFB3-14hzlc and -14hz3c variants.
- T cell activation based on the percentage of CD25 + T cell populations was also confirmed for the above variants.
- Example 4 showed that binding of certain chimeric anti-TNFR2 monoclonal antibodies to primary CD8 and CD4 Tconv cells co-stimulated NFKB signaling. Similar experiment here demonstrates that certain humanized variant anti-TNFR2 antibodies induced NFKB signaling in Tregs.
- FIG. 17A shows that co-stimulation of Tregs using certain humanized variant anti-TNFR2 antibodies and TNFa led to NFKB downstream signaling in FT A, TNF, and TNF AIP3.
- Variants HFB3-lhz6, -lhz9, -lhzlO, and -lhzll promoted NFKB signaling to a larger extent than the parental chimeric antibody HFB3-1.
- variants HFB3- 14hzlc, -14hz2c, -14hz3c, and -14hz4c also promoted NFKB signaling to a larger extent than the parental chimeric antibody HFB3-14.
- FIG. 17B shows activation of NFKB signaling in CD8 T cells using certain humanized variant of HFB3-1 antibody with and without human recombinant TNFa.
- Example 11 Anti-TNFR2 Antibodies are Stable
- a humanized TNFR2 knock-in (KI) mouse was generated in the C57BL/6 mouse background through commercial service (Biocytogen, Wakefield, MA).
- HFB3-l-hGl and its humanized variant HFB3-lhz6- hGl did induce more response (see FIG. 21), compared to the other antibodies.
- the lack of signal induction from the HFB3-18 series is expected.
- PK Pharmacokinetic (PK) profiles of the subject humanized anti-TNFR2 monoclonal antibodies (HFB3-lhz6-hGl, HFB3-141c-hGl, and HFB3-18hzl-hGl) in C57BF/6 mice were examined. All three humanized monoclonal antibodies exhibited T1/2 consistent with expectation for well-behaved antibodies. See below.
- NK cells were isolated from peripheral blood mononuclear cells (PBMC) donated by two human patients using NK Cell Isolation Kit (Miltenyi Biotec). NK cells were first stimulated by soluble IL-2 (10 ng/mL) and IL-15 (10 ng/mL) for 24 hours, and then treated with isotype control antibody, mouse HFB3-l-hGl, humanized HFB3-l-hz6- hGl, or anti-OX40 control antibody (BMS) at 22 nM, 66 nM or 200 nM, respectively, for 16 hours.
- CD107a expression on NK cell surface which represents degranulation and activation of NK cells, as well as TNFR2 expression were measured by FACS.
- HFB3-l-hGl and HFB3-l-hz6-hGl significantly increased CD107a expression in a dose dependent manner, indicating that these antibodies can promote NK cell activation in whole PBMC. Under long-term activation (64 hours since anti-CD3/CD28 stimulation), anti-OX40 antibody was able to activate NK cells.
- HFB3-l-hGl After only 2 doses of treatment on Day 0 and Day 3, there was no significant difference in tumor weight among treatments yet (FIG. 24B, top left panel).
- Administration of HFB3-l-hGl at 10 mg/kg increased absolute number of CD45+ cells present in the tumor (FIG. 24B, bottom left panel) but percentage of CD45+ among live cells of tumors was not significantly elevated (FIG. 24B, bottom right panel).
- Treatment of HFB3-l-hGl at 10 mg/kg also increased absolute cell numbers of CD8+, conventional CD4+ T and NK cells in tumor microenvironment, but did not change the number of T-regulatory cells (FIG. 24C).
- Adminstration of HFB3-l-hGl at other lower doses did not result in any observable effects.
- TNFR2 receptor occupancy was determined for CD8 T cells, conventional CD4 T cells, T-regulatory cells and NK cells in tumor and in peripheral blood.
- tumor only HFB3-l-hGl at 10 mg/kg dose resulted in drug receptor occupancy on T cells in tumor; no occupancy was observed for the 1 and 0.1 mg/kg doses (see FIG. 25A).
- receptor occupancy was observed in tumor NK cells.
- HFB3-l-hGl at 10 mg/kg and 1 mg/kg doses resulted in comparable drug receptor occupancy and no significant occypancy was observed at the 0.1 mg/kg dose.
- HFB3-l-hGl Pharmacokinetics of HFB3-l-hGl was determined at the termination of the experiment. HFB3-l-hGl adminstration at 1 and 10 mg/kg doses were detectable on Day 4 in blood. Remarkably, HFB3-l-hGl at 10 mg/kg dose was retained at a much higher level than the isotype control at the same dose (see FIG. 26A). Interestingly, 10 mg/kg and 1 mg/kg administrations of HFB3-l-hGl also increased the amount of TNFR2 detectable in blood (see FIG. 26B). TNFR2 in blood was presumably due to to receptor shedding.
- HFB3-l-hGl has the potential to stimulate activation and proliferation of immune cells, effectively bind to TNFR2 receptors on immune cells and have good retention in blood in vivo.
- Anti-tumor efficacy for the subject humanized anti-TNFR2 monoclonal antibodies were demonstrated in a widely-used mouse colorectal cancer model in the humanized TNFR2 KI mice background.
- TT- hGlAA isotype-matched control
- RMP-1-14 anti-mPD-1
- HFB3-lhz6-hGl HFB3-14hzlc-hGl
- HFB3-18hzl-hGl HFB
- the antibodies were injected intraperitoneally (i.p. ) at a dose of about 10 mg/kg, on Days 0, 3, 6, 9, 12, 15, and 18, for a total of 7 doses (Q3D, x7).
- Tumor volume was measured for the experimental groups over the course of the study. On or about Day 21, the average tumor volume reached >2000 mm 3 for the isotype control group, and the experiment was terminated and all mice were sacrificed. Tumor volume over time was plotted for the various groups in FIG. 27A and FIG. 27B.
- TGI tumor growth inhibition
- HFB3-lhz6-hGl Treatment with 3 and 10 mg/kg HFB3-lhz6-hGl every 3 days for a total of 7 doses (Q3d x 7) and treatment with 10 mg/kg anti-PD-1 (RMP-14) every 3 days for a total of 4 doses (Q3d x 4) significantly inhibited tumor growth and extended life span of mice in comparison to treatment with isotype control. Furthermore, combination treatment of both HFB3-lhz6-hGl (10 mg/kg, Q3d x 7) and anti- PD-1 antibody (10 mg/kg, Q3d x 4) resulted in better survival than treatment with anti-PD-1 antibody alone. See FIG. 29. Data are analyzed using ANOVA comparing treatment groups to isotype control.
- mice were treated with isotype control antibody, anti-mPD-1 at 10 mg/kg or HFB3-lhz6-hGl at 0.3-10 mg/kg doses.
- HFB3-lhz6-hGl was effective at suppressing tumor growth.
- HFB3-lhz6-hGl was even more effective than anti-mPD-1 at controlling tumor growth (see FIG. 32).
- Toxicology of the humanized anti-TNFR2 antibodies were examined using a non human primate model. Two cynomolgus monkeys per group were injected with a single dose of 15 mg/kg (low), 50 mg/kg (medium) and 150 mg/kg (high) of the humanized HFB3-lhz6- hGl monoclonal antibody, after which plasma was collected at different time points until 336 hrs (day 14).
- HFB3-lhz6-hGl Toxicokinetic analysis of HFB3-lhz6-hGl showed that the antibody was eliminated over time. No elevation of cytokines IL-6, IL-2, IFN-g and TNF-a was observed after the injection of 15, 50 or 150 mg/kg of HFB3-lhz6-hGl in comparison to reported data (dotted lines) from CD3xCD20 bispecific IgG at ⁇ 3 mg/kg (FIG. 30).
- a dose range finding study where cynomolgus monkeys were administered with multiple doses of HFB3-lhz6-hGl, no changes for IL-2, IL-4, IL-5, TNFa, and IFN-g in monkeys with repeated dosing up to 150 mg/kg. Changes in IL-6 levels were observed in 10 and 150 mg/kg male animals at the end of 4 weekly doses in monkeys. Dose dependent decreases of neutrophil and platelet counts were observed 2 weeks after the dosing of HFB3- lhz6-hGl in monkeys. Diarrhea (liquid feces or loose stool) was frequently observed following weekly dosing of HFB3-lhz6-hGl in monkeys.
- DPF dose range finding study
- Example 18 Indication selection based on TNFR2 expression
- the anti tumor efficacy of the anti-TNFR2 antibodies of the invention resulted from stimulation of TNFR2 on tumor-infiltrating T and NK cells, thereby activating NK cells and enhancing CD8+ T cell mediated anti-tumor response.
- tumor types that will likely benefit from treatment with the anti-TNFR2 antibodies of the invention include tumors that express high TNFR2 and high CD8A.
- CD8A cutoff was based on CD8A level of acute myeloid leukemia (AML), which is presumed to consist of primarily myloid cells and low or no CD8+ T cells.
- TNFR2 cutoff value is based on TNFR2 level in prostate cancer, which is assumed to be an immune desert. See FIGs. 34A-34B.
- TNFR2 and CD8 scoring were further determined for molecular subtypes of renal cell carcinoma (RCC), skin cutaneous melanoma (SKCM), stomach adenocarcinoma/gastric cancer (STAD/GI), lung adenocarcinoma (LUAD) and head and neck squamous cell carcinoma (HNSC) (FIG. 36).
- RCC renal cell carcinoma
- SKCM skin cutaneous melanoma
- STAD/GI stomach adenocarcinoma/gastric cancer
- LAD lung adenocarcinoma
- HNSC head and neck squamous cell carcinoma
- the tested cancer subtypes with the signature high CD8A and high TNFR2 expression pattern are the primary candidates for beneficial treatment by the subject antibody of the invention, including KIRC.2, KIRC.3, KIRC.4, SKCM.Triple_WT, SKCM.BRAF_hotspot_mutants (possibly also SKCM.RAS_hotspot_mutants and SKCM.NFl_any_mutants), LUAD.6 and LUAD.5, HNSC. Atypical (40% HPV positive) and HNSC. mesenchymal (tends to be higher in PD-L1 / CD274).
- tumors with deficient mismatch repair (dMMR) / micro satellite instability-high (MSI-H) are significantly more sensitive to immune checkpoint inhibitors (ICIs), compared to those microsatellite-stable (MSS) / microsatellite instability- low (MSI-L) tumors, and the former group of patients have derived more clinical benefits from immunotherapy than the latter group of patients.
- dMMR deficient mismatch repair
- MSI-H micro satellite instability-high
- ICIs immune checkpoint inhibitors
- MSI score data is not directly accessible for all cancer indications.
- Applicant used a parameter Mutation Count as surrogate for MSI score, and investigated wheher the TNFR2 hl & CD8A hl tumors treatable by the subject antibodies are enriched in MSI vs. MSS. For this purpose, a Mutation Count of >250 was deemed MSI, while a Mutation Count of ⁇ 250 was deemed MSS. The data (not shown here) shows that TNFR2 hl & CD8A hl expression pattern was not strongly enriched in Mutation. Count>250 vs.
- Dose escalation is carried out up to 150 mg to determine maximum tolerated dose.
- Dose expansion is carried out to EBV+ gastric cancer, clear cell renal cell carcinoma, cutaneous melanoma, soft tissue sarcoma, testicular germ cell tumors and PD-L1+ cancers including cervical cancer, pleural mesothelioma, lung adenocarcinoma, head and neck squamous cell carcinoma. Based on phase I anti-tumor activity/efficacy, additional patient cohorts are enrolled.
- Gly lie lie Phe Pro Lys Tyr Gly Thr Thr Ser Tyr Asn Gin Lys Phe 50 55 60
- Gly lie lie Asn Pro Asn Tyr Gly Ser Thr Ser Tyr Asn Gin Lys Phe 50 55 60
- Ser Val Arg lie Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30
- Gly Glu lie Asp Pro Glu Ala Gly Gly Thr Ala Tyr Asn Gin Lys Phe 50 55 60
- Lys Gly Lys Ala lie Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80
- Thr Val Lys lie Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Thr Ala 20 25 30
- Gly Trp lie Asn Thr His Ser Gly Glu Pro Lys Tyr Ala Glu Asp Phe 50 55 60
- Lys Gly Arg Phe Thr lie Ser Arg Asp Asn Ala Lys Asn Asn Leu Tyr
- Lys Gly Arg Phe Thr lie Ser Arg Asp Asn Ala Lys Asn Thr Leu Phe
- Lys Asn Arg lie Ser lie Thr Arg Asp Thr Ser Lys Asn Gin Phe Phe 65 70 75 80
- Glu Lys Val Thr Met lie Cys Ser Ala Ser Ser Ser Val Arg Tyr Met 20 25 30
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202280060055.4A CN117980336A (zh) | 2021-07-07 | 2022-07-06 | 抗tnfr2抗体及其用途 |
| EP22837100.1A EP4367140A4 (en) | 2021-07-07 | 2022-07-06 | ANTI-TNFR2 ANTIBODIES AND USES THEREOF |
| JP2024500409A JP2024527576A (ja) | 2021-07-07 | 2022-07-06 | 抗tnfr2抗体及びその使用 |
| AU2022308421A AU2022308421A1 (en) | 2021-07-07 | 2022-07-06 | Anti-tnfr2 antibody and uses thereof |
| KR1020247004535A KR20240032985A (ko) | 2021-07-07 | 2022-07-06 | 항-tnfr2 항체 및 이의 용도 |
| CA3224693A CA3224693A1 (en) | 2021-07-07 | 2022-07-06 | Anti-tnfr2 antibody and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163219175P | 2021-07-07 | 2021-07-07 | |
| US63/219,175 | 2021-07-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023281313A1 true WO2023281313A1 (en) | 2023-01-12 |
Family
ID=84800439
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2022/000409 Ceased WO2023281313A1 (en) | 2021-07-07 | 2022-07-06 | Anti-tnfr2 antibody and uses thereof |
Country Status (9)
| Country | Link |
|---|---|
| EP (1) | EP4367140A4 (https=) |
| JP (1) | JP2024527576A (https=) |
| KR (1) | KR20240032985A (https=) |
| CN (1) | CN117980336A (https=) |
| AR (1) | AR126387A1 (https=) |
| AU (1) | AU2022308421A1 (https=) |
| CA (1) | CA3224693A1 (https=) |
| TW (1) | TW202309096A (https=) |
| WO (1) | WO2023281313A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023228082A1 (en) * | 2022-05-26 | 2023-11-30 | Pfizer Inc. | Anti-tnfr2 antibodies and methods of use thereof |
| WO2024233258A1 (en) * | 2023-05-05 | 2024-11-14 | Cureimmune Therapeutics Inc. | Anti-tnfr2 antibodies and uses thereof |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190135929A1 (en) * | 2015-08-28 | 2019-05-09 | The General Hospital Corporation | Agonistic anti-tumor necrosis factor receptor 2 antibodies |
| WO2020061210A1 (en) * | 2018-09-18 | 2020-03-26 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
| US20200270355A1 (en) * | 2017-11-09 | 2020-08-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily polypeptides |
| WO2020180712A1 (en) * | 2019-03-01 | 2020-09-10 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
| WO2021023098A1 (zh) * | 2019-08-02 | 2021-02-11 | 江苏先声药业有限公司 | 抗tnfr2抗体及其用途 |
| CN112480259A (zh) * | 2021-02-05 | 2021-03-12 | 百奥赛图(北京)医药科技股份有限公司 | 抗tnfr2抗体及其用途 |
| WO2021055253A2 (en) * | 2019-09-17 | 2021-03-25 | Apexigen, Inc. | Anti-tnfr2 antibodies and methods of use |
-
2022
- 2022-07-06 CN CN202280060055.4A patent/CN117980336A/zh active Pending
- 2022-07-06 JP JP2024500409A patent/JP2024527576A/ja active Pending
- 2022-07-06 AR ARP220101767A patent/AR126387A1/es unknown
- 2022-07-06 CA CA3224693A patent/CA3224693A1/en active Pending
- 2022-07-06 AU AU2022308421A patent/AU2022308421A1/en active Pending
- 2022-07-06 TW TW111125395A patent/TW202309096A/zh unknown
- 2022-07-06 EP EP22837100.1A patent/EP4367140A4/en active Pending
- 2022-07-06 KR KR1020247004535A patent/KR20240032985A/ko active Pending
- 2022-07-06 WO PCT/IB2022/000409 patent/WO2023281313A1/en not_active Ceased
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190135929A1 (en) * | 2015-08-28 | 2019-05-09 | The General Hospital Corporation | Agonistic anti-tumor necrosis factor receptor 2 antibodies |
| US20200270355A1 (en) * | 2017-11-09 | 2020-08-27 | The General Hospital Corporation | Antagonistic anti-tumor necrosis factor receptor superfamily polypeptides |
| WO2020061210A1 (en) * | 2018-09-18 | 2020-03-26 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
| WO2020180712A1 (en) * | 2019-03-01 | 2020-09-10 | Merrimack Pharmaceuticals, Inc. | Anti-tnfr2 antibodies and uses thereof |
| WO2021023098A1 (zh) * | 2019-08-02 | 2021-02-11 | 江苏先声药业有限公司 | 抗tnfr2抗体及其用途 |
| WO2021055253A2 (en) * | 2019-09-17 | 2021-03-25 | Apexigen, Inc. | Anti-tnfr2 antibodies and methods of use |
| CN112480259A (zh) * | 2021-02-05 | 2021-03-12 | 百奥赛图(北京)医药科技股份有限公司 | 抗tnfr2抗体及其用途 |
Non-Patent Citations (3)
| Title |
|---|
| CASE KATHERINE, TRAN LISA, YANG MICHAEL, ZHENG HUI, KUHTREIBER WILLEM M., FAUSTMAN DENISE L.: "TNFR2 blockade alone or in combination with PD-1 blockade shows therapeutic efficacy in murine cancer models", JOURNAL OF LEUKOCYTE BIOLOGY, JOHN WILEY & SONS LTD., GB, vol. 107, no. 6, 12 June 2020 (2020-06-12), GB , pages 981 - 991, XP093022332, ISSN: 0741-5400, DOI: 10.1002/JLB.5MA0420-375RRRRR * |
| See also references of EP4367140A4 * |
| YANG YANG, ISLAM MD SAHIDUL, HU YUANJIA, CHEN XIN: "TNFR2: Role in Cancer Immunology and Immunotherapy", IMMUNOTARGETS AND THERAPY, vol. Volume 10, pages 103 - 122, XP093022330, DOI: 10.2147/ITT.S255224 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023228082A1 (en) * | 2022-05-26 | 2023-11-30 | Pfizer Inc. | Anti-tnfr2 antibodies and methods of use thereof |
| WO2024233258A1 (en) * | 2023-05-05 | 2024-11-14 | Cureimmune Therapeutics Inc. | Anti-tnfr2 antibodies and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022308421A1 (en) | 2024-01-25 |
| CA3224693A1 (en) | 2023-01-12 |
| EP4367140A4 (en) | 2025-06-18 |
| AR126387A1 (es) | 2023-10-11 |
| TW202309096A (zh) | 2023-03-01 |
| EP4367140A1 (en) | 2024-05-15 |
| JP2024527576A (ja) | 2024-07-25 |
| CN117980336A (zh) | 2024-05-03 |
| KR20240032985A (ko) | 2024-03-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3283527B1 (en) | Combination therapy for cancer | |
| US20230416382A1 (en) | Anti-c-c chemokine receptor 8 (ccr8) antibodies and methods of use thereof | |
| JP7719799B2 (ja) | 抗ガレクチン-9抗体およびその使用 | |
| JP7801225B2 (ja) | 抗tnfr2抗体及びその使用 | |
| WO2023281313A1 (en) | Anti-tnfr2 antibody and uses thereof | |
| US20240158517A1 (en) | Anti-human cxcr5 antibody and uses thereof | |
| WO2021129744A1 (en) | Compositions and methods for treating autoimmune diseases and cancers by targeting igsf8 | |
| US12617860B2 (en) | Anti-TNFR2 antibody and uses thereof | |
| RU2840501C1 (ru) | Анти-галектин-9 антитело и его применение | |
| HK40092079A (zh) | 抗tnfr2抗体和其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22837100 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3224693 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2024500409 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022308421 Country of ref document: AU Ref document number: AU2022308421 Country of ref document: AU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024000217 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022308421 Country of ref document: AU Date of ref document: 20220706 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20247004535 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247004535 Country of ref document: KR Ref document number: 2022837100 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022837100 Country of ref document: EP Effective date: 20240207 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280060055.4 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024000217 Country of ref document: BR Free format text: APRESENTE RELATORIO DESCRITIVO, DESENHOS TRADUZIDOS E LISTAGEM DE SEQUENCIAS EM LINGUA VERNACULA. |
|
| ENP | Entry into the national phase |
Ref document number: 112024000217 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240105 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2022837100 Country of ref document: EP |