WO2023250489A1 - Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal - Google Patents

Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal Download PDF

Info

Publication number
WO2023250489A1
WO2023250489A1 PCT/US2023/068998 US2023068998W WO2023250489A1 WO 2023250489 A1 WO2023250489 A1 WO 2023250489A1 US 2023068998 W US2023068998 W US 2023068998W WO 2023250489 A1 WO2023250489 A1 WO 2023250489A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
tag
cell
targeting module
binding domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2023/068998
Other languages
English (en)
French (fr)
Inventor
Johannes SPEHR
Armin Ehninger
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Avencell Therapeutics Inc
Original Assignee
Avencell Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from EP22180805.8A external-priority patent/EP4296281A1/en
Application filed by Avencell Therapeutics Inc filed Critical Avencell Therapeutics Inc
Priority to JP2024575443A priority Critical patent/JP2025524457A/ja
Priority to CN202380060615.0A priority patent/CN119790072A/zh
Priority to EP23741575.7A priority patent/EP4543922A1/en
Priority to CA3258275A priority patent/CA3258275A1/en
Priority to AU2023289687A priority patent/AU2023289687A1/en
Priority to US18/878,321 priority patent/US20250269025A1/en
Publication of WO2023250489A1 publication Critical patent/WO2023250489A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4217Receptors for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/11Antigen recognition domain
    • A61K2239/15Non-antibody based
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23On/off switch
    • A61K2239/24Dimerizable CARs; CARs with adapter
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/50Cellular immunotherapy characterised by the use of allogeneic cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag

Definitions

  • the present invention relates to a targeting module comprising at least one CD123-binding domain and a tag-binding domain binding the human La epitope E5B9, a nucleic acid, a vector or a cell comprising a nucleotide sequence encoding the targeting module, a pharmaceutical composition and a kit comprising the targeting module and a vector or a cell comprising a nucleotide sequence encoding a reversible chimeric antigen receptor.
  • Chimeric antigen receptors are artificial receptors consisting of a binding moiety, which provides the antigen-specificity and one or several signaling chains derived from immune receptors (Cartellieri et a/. 2010).
  • Immune cells genetically modified to express CARs, can be used to bind cells or tissue structures expressing the appropriate target of the CAR binding moiety. Cross-linking leads to an induction of signal pathways via the CAR signaling chains, which will change the biologic properties of the CAR-engrafted immune cell.
  • CAR activation in gene-modified regulatory T cells leads to an activation of Treg-specific immunomodulatory and suppressive mechanisms like interleukin (IL>10 or tumor growth factorbeta (TGF-P) secretion.
  • IL>10 or tumor growth factorbeta (TGF-P) secretion IL>10 or tumor growth factorbeta (TGF-P) secretion.
  • TGF-P tumor growth factorbeta
  • CAR-T cells are a new class of self-amplifying cell drugs
  • infused T cells can undergo a vigorous expansion in the presence of heavy tumor burden leading to tumor lysis syndrome, cytokine release syndrome and macrophage activation syndrome (Brudno and Kochenderfer 2016).
  • Another drawback of conventional CAR technology is the restriction of engineered T cell retargeting to a single antigen.
  • Such a monotherapeutic approach implies the risk for the development of tumor escape variants, which have lost the target antigen during treatment.
  • the emergence of tumor escape variants under conventional CAR T cell therapy after several months was already observed in clinical trials (Sotillo et al. 2015).
  • these obstacles restrict the application of CAR T cells to very few indications. In fact, examples of clinical effectiveness have been restricted to CD19- and BCMA-targeting CAR T cells until now.
  • Modular switchable “universal” CAR T (UniCAR) approaches can overcome these limitations by separating antigen recognition and activating domain of a CAR into two separate operational units.
  • T cells are engineered to express a CAR with a universal binding domain recognizing a tag (Cartellieri et al. 2016).
  • Antigen-specificity is provided by soluble adapter proteins, which consist of an antigen-binding domain fused to the tag recognized by the universal CAR.
  • Cartellieri et al. describe the treatment of CD33- and/or CD123-positive acute myeloid leukemia cells in vitro and in vivo.
  • a reversed universal CAR (RevCAR) approach that promotes binding of an immune cell engineered to express a RevCAR comprising a tag to a target cell through an adaptor molecule comprising a tag-binding domain and a target cell-binding domain (EP 3 581 200 A1).
  • EP 3 581 200 A1 discloses an extracellular LA/SSB derived tag and an adapter molecule comprising a CD123 scFv and a scFv binding to the tag (5B9 or 7B6), which is added to bridge the CAR and the tumor cells resulting in antigen specific cytotoxicity.
  • CAR-adaptors flexible chimeric antigen receptor adaptor molecules
  • T cells with tags like 5B9, GCN4, FITC, leucine zipper sequences, or biotinylated IgG, and targets like CD33, CD123, CD19, CD20, CD22, HER2, EGFR, CCR4, G2D, MCSP, ErbB2 (Darowski et al. 2019).
  • Kittel-Boselli et al. describe targeting acute myeloid leukemia, in particular patient-derived AML cells expressing CD33 and CD123, using the RevCAR platform, wherein the RevCARs consist of the extracellular peptide epitope E5B9 or E7B6 and CD28 (28) hinge domain (HiD), CD28 transmembrane domain (TMD), the intracellular CD28 costimulatory (CSD) and CDS zeta (3z) activating signaling domain (ASD) (Kittel-Boselli et al. 2021).
  • the RevCARs consist of the extracellular peptide epitope E5B9 or E7B6 and CD28 (28) hinge domain (HiD), CD28 transmembrane domain (TMD), the intracellular CD28 costimulatory (CSD) and CDS zeta (3z) activating signaling domain (ASD) (Kittel-Boselli et al. 2021).
  • the targeting modules are constructed with the variable heavy (VH) and light chain (VL) domains derived from the monoclonal antibodies (mAbs) CD33, CD123, 5B9, or 7B6 connected via glycine (G)-serine (S) linkers.
  • VH variable heavy
  • VL light chain domains derived from the monoclonal antibodies
  • mAbs monoclonal antibodies
  • G glycine-serine
  • the object has been solved by a targeting module comprising at least one CD123-binding domain and a tag-binding domain that binds to a human La epitope E5B9 comprising a VL-linker-Vn structure according to the present invention.
  • the targeting module according to the invention comprises i) at least one CD123-binding domain comprising a sequence with at least 95 % identity, preferably 99 % identity, with the sequence according to SEQ ID No. 22 and SEQ ID No. 23, and ii) a tag-binding domain binding a human La epitope E5B9 comprising a VL-linker-Vn structure, wherein the VL region of the tag-binding domain comprises a sequence with at least 95 % identity, preferably 99 % identity, with the sequence according to SEQ ID No. 19 and/or the VH region of the tag-binding domain comprises a sequence with at least 95 % identity, preferably 99 % identity, with the sequence according to SEQ ID No. 20.
  • the term “targeting module” refers to a molecule, preferably a polypeptide or protein with at least two different domains, wherein each domain is specific for a target or a uniform group of targets, respectively, wherein at least one domain is specific for a target cell, in particular the CD123-binding domain; and one domain is specific for a reversible chimeric antigen receptor, in particular the tag-binding domain.
  • the targeting module is isolated.
  • the targeting module according to the invention is expressed as a recombinant protein.
  • the targeting module is chemically synthesized.
  • autoimmune disorder refers to an abnormal immune response of the body against substances and tissues normally present in the body (autoimmunity).
  • domain refers to a part of a protein sequence, which can exist and function independently from the rest of the protein.
  • VL-linker-Vn structure refers to a structure, wherein the C-terminus of the VL region is connected with a linker, which is connected to the N-terminus of the VH region.
  • linker refers to a molecule or molecule part separating at least two elements under consideration, in particular selected from functional groups, tags, binding domains or binding domain subunits, such as a VLand a VH domain.
  • specific refers to the ability of an antibody or antibody fragment or a protein, peptide or low molecular weight organic ligand to recognize and bind with a binding partner (e.g. a tumor antigen) protein present in a sample, but not substantially recognize or bind other molecules in the sample.
  • binding refers to a non-covalent binding, in particular ionic bonds, hydrogen bonds, Van der Waals forces and/or hydrophobic interactions.
  • mutants refers to peptides or proteins having at least 90 % sequence identity to the named antibodies, antibody fragments, proteins or peptides, preferably at bast 95 % sequence identity.
  • the mutants are capable of having one or more activities of the named antibodies, antibody fragments, peptides or proteins.
  • mutants are truncated versions of peptides or proteins.
  • the term “truncated versions” refers to shortened peptides or proteins having at least 90 % sequence identity to the named peptides or proteins, preferably at least 95 % sequence identity, more preferably having a chain length of at least 90 % and a sequence identity of 100 %, most preferably a chain length of at least 95 % and a sequence identity of 100 %.
  • the truncated version has at least 80 %, preferably of at least 90 %, more preferably of at least 95 %; of the activity of the named peptide or protein.
  • nuclear protein refers to a protein found in the cell nucleus.
  • tags which are peptide sequences from nuclear antigens, cannot be accessed and bound by the corresponding tag-binding domain in the context of the native protein under physiological conditions. Further advantageously, the tag is not immunogenic. This leads to minimization of the risk of uncontrolled on-target off-site toxicities by CAR-expressing immune cells like the release of toxic levels of cytokines, referred to variously as cytokine storms or cytokine release syndrome (CRS).
  • CRS cytokine release syndrome
  • the term “administered in combination” refers to a treatment, wherein the targeting module is administered prior to, simultaneously with and/or after the administration of the vector or cell comprising a nucleotide sequence encoding a reversible chimeric antigen receptor (RevCAR).
  • the term “antibody” refers to a protein, which binds antigens via the antigenbinding fragment variable region (Fab). This is composed of one constant and one variable domain of each of the heavy (VH) and the light chain (VL).
  • Fab antigenbinding fragment variable region
  • VH heavy
  • VL light chain
  • the term “antibody fragment or antigen-binding fragment” refers to a protein comprising at least the VL or H of an antibody.
  • antibody fragments are selected from single-chain variable fragments (scFv), single-chain antibodies, F(ab')2 fragments, Fab fragments, and fragments produced by a Fab expression library or single-domain antibodies (nanobodies).
  • scFv single-chain variable fragments
  • F(ab')2 fragments F(ab')2 fragments
  • Fab fragments fragments produced by a Fab expression library or single-domain antibodies (nanobodies).
  • single-chain variable fragment refers to an artificial antibody fragment comprising a variable domain of a light chain and a variable domain of a heavy chain of an antibody covalently linked.
  • the VL and Vn of an antibody are covalently linked by a short peptide of 10 to 25 amino acids.
  • the short peptide links the N- terminus of the VH with the C-terminus of the VL, or vice versa.
  • the at least one CD123-binding domain comprises CDR sequences according to SEQ ID No. 33, SEQ ID No. 34, SEQ ID No. 35, SEQ ID No. 36, amino acid sequence WAS (Trp-Ala-Ser) and SEQ ID No. 37.
  • the tag-binding domain binding a human La epitope E5B9 comprises CDR sequences according to SEQ ID No. 38, SEQ ID No. 39, SEQ ID No. 40, SEQ ID No. 41 , amino acid sequence WAS (Trp-Ala-Ser) and SEQ ID No. 42.
  • CDR complementarity-determining regions
  • An antibody comprises three CDRs (CDR1 , CDR2 and CDR3), arranged non-consecutively, on the amino acid sequence of each variable domain and thus, six CDRs on the two variable domains (VH and VL), which can come into contact with the antigen.
  • VL and VH are connected via a glycine-serine linker with the structure (GxS y ) with x and y selected from 1 to 10, preferably 3 to 5. Usually preferred are 1 to 10 repeats of the sequence G4S1 (SEQ ID No. 24). Moreover, linkers are preferred that are constituted of a peptide sequence that can increase the protease resistance of the antibody derivatives.
  • the linker of the tag-binding domain comprises 20 to 30 amino acids, preferably 25 amino acids. In further embodiments, the linker of the tag-binding domain comprises a linker according SEQ ID No. 25 or SEQ ID No. 26.
  • the antibody is obtained from an animal species, preferably from a mammal such as human, simian, mouse, rat, rabbit, guinea pig, horse, cow, sheep, goat, pig, dog or cat.
  • the antibody or antibody fragment is a human, humanized or deimmunized antibody.
  • Humanized antibodies can be prepared in various ways, for example, by resurfacing and CDR grafting. In case of resurfacing, a combination of molecular modeling, statistical analyses, and mutagenesis is used to modify all non-CDR regions on the surface of the antibody to become similar to the surface of antibodies of the target organism.
  • the CDR regions according to the invention are introduced into known human framework regions, which are similar in sequence to the original ones.
  • Deimmunized antibodies can be obtained by specifically mutating residues that confer immunogenicity hotspots as predicted based on in silico peptide- MHC affinity prediction.
  • the antibody or antibody fragment is a polyclonal, a monoclonal or a chimeric antibody, wherein an antigen-binding region of a non-human antibody is transferred into the framework of a human antibody by recombinant DNA techniques including in silico design.
  • antibodies to a selected tag or antigen may be produced by immunization of various hosts including, but not limited to, goats, rabbits, rats, mice, humans, through injection with cells expressing a particular protein, DNA or RNA encoding for the protein, the protein itself or any portion, fragment or oligopeptide that retain immunogenic properties of the protein.
  • the CD123-binding domain is an antibody or antigen binding fragment.
  • the CD123-binding domain comprises the sequences SEQ ID No. 22 and SEQ ID No. 23.
  • the CD123-binding domain comprises a sequence according to SEQ ID No. 27.
  • the tag-binding domain binds to a tag from the human La epitope E5B9.
  • the tag-binding domain is an antibody or an antigen-binding fragment, preferably comprising a VL according to the following sequence:
  • the tag-binding domain constitutes an anti-La epitope scFv.
  • X24 to X101 are selected as follows:
  • X24 is selected from polar and/or positive charged residues, such as Serine, Threonine, Asparagine, Glutamine, Histidine, Lysine and Arginine; preferably Lysine or Arginine;
  • X35 is preferably selected from Lysine and Proline
  • Xei is selected from polar and charged residues, such as Asparagine, Aspartic Acid, Glutamine, Glutamic acid, Histidine, Lysine and Arginine, preferably Glutamic acid and Lysine;
  • X101 is selected from hydrophobic residues, such as Isoleucine, Leucine, Valine, Alanine, Methionine, Phenylalanine, Proline and Tryptophan; preferably Leucine or Proline.
  • the tag-binding domain comprises a sequence having each at least 90 % sequence identity, preferably at least 95 % sequence identity; to the sequences according to SEQ ID NO. 20 (V H ) and SEQ ID NO. 21 (V L ).
  • the tag-binding domain constitutes the anti-La 5B9 scFv according to SEQ ID NO. 20 (V H ) and SEQ ID NO. 21 (V L ).
  • the length of the target module is in the range of 100 to 1600 amino acids, preferably 500 to 800 amino acids.
  • the targeting module comprises one of the sequences according to SEQ ID No.3 to SEQ ID No. 10.
  • the invention provides a nucleic acid, a vector or a cell comprising a nucleotide sequence encoding a targeting module according to the invention.
  • the nucleic acid, vector or cell comprises one of the sequences according to SEQ ID No. 11 to 18.
  • the sequences according to SEQ ID No. 11 to 18 encode the targeting modules according to SEQ ID No. 3 to 10.
  • the invention provides a pharmaceutical composition comprising the targeting module according to the invention and a pharmaceutically acceptable thinner or carrier.
  • the pharmaceutical composition is preferably administered parenterally, particularly preferred intravenously.
  • the pharmaceutical composition is present in a form suitable for intravenous administration.
  • the pharmaceutical composition is a solution, emulsion or suspension.
  • the pharmaceutical composition is an injectable buffered solution comprising a concentration in the range of 1 ng/ml to 500 mg/ml of the targeting module, the nucleic acid, vector and/or cell according to the invention, preferably in the range of 50 pg/ml to 5 mg/ml.
  • the pharmaceutical composition comprises a pharmaceutically acceptable thinner (dilution agent) or carrier.
  • the carrier is selected from water, an aqueous buffer solution, 0.9 % saline solution, 5 % glucose, 5 % xylitol, 0.3 % glycine solution, ringer solutions or amino acid solutions.
  • the aqueous buffer solution is selected from an aqueous histidine, sodium succinate, sodium citrate, sodium phosphate or potassium phosphate-buffered solution with a pH value in the range of pH 5.0 to pH 7.0.
  • the aqueous buffer solution has a buffer concentration in the range of 1 mmol/l (mM) to 500 mM, preferably in the range of 5 mM to 20 mM, especially preferred in the range of 5 mM to 10 mM.
  • the carrier comprises sodium chloride, preferably in a concentration in the range of 1 mM to 300 mM, especially preferred 150 mM.
  • the pharmaceutical composition further comprises a stabilizer, preferably with a concentration in the range of 1 mM to 900 mM, especially preferred in the range of 50 mM and 600 mM.
  • the stabilizer is sucrose, trehalose or L-methionine.
  • the pharmaceutical composition further comprises pharmaceutically acceptable excipients.
  • pharmaceutically acceptable excipients refers to compounds, which provide approximately physiological conditions and/or increase the stability, such as agents for adjusting the pH value and buffering agents, agents for adjusting the toxicity and the like.
  • pharmaceutically acceptable excipients are selected from sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and polysorbate-80, preferably polysorbate-80 in the range of 0.0001 % (w/v) to 1 % (w/v), especially preferred in the range of 0.001 % (w/v) to 0.1 % (w/v).
  • the pharmaceutical composition comprises the targeting module in a dosage quantity in the range of 25 pg/day to 100 mg/day, preferably dosage quantities in the range of 0.1 mg/day to 20 mg/day.
  • the pharmaceutical composition is sterile.
  • the pharmaceutical composition is sterilized by conventional well-known techniques including, but not limited to, sterile filtration.
  • the pharmaceutical composition is used for administration to a subject.
  • the pharmaceutical composition is lyophilized prior to storage or stored as solution at ambient temperature or below, including, but not limited to, frozen storage.
  • the pharmaceutical composition is reconstituted and/or diluted in an infusion and stabilizer solution prior to administration to a subject.
  • the solutions used for reconstitution or infusion/stabilization may contain any of the components mentioned for the pharmaceutical composition or similar components.
  • the invention provides the targeting module according to the invention, a nucleic acid, a vector or a cell comprising a nucleotide sequence encoding the targeting module according to invention or a pharmaceutical composition comprising the targeting module according to the invention and a pharmaceutically acceptable thinner or carrier for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal, preferably for use in the treatment of cancer, infectious disease or autoimmune disease.
  • the targeting module is administered in combination with a vector or a cell comprising a nucleotide sequence encoding a RevCAR, wherein the RevCAR comprises
  • the pharmaceutical composition for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal according to the invention further comprises a vector or a cell comprising a nucleotide sequence encoding a RevCAR, wherein the RevCAR comprises
  • the invention provides a kit comprising a) a targeting module or the nucleic acid, vector or cell according to the invention, and b) a vector or a cell comprising a nucleotide sequence encoding a RevCAR, wherein the RevCAR comprises
  • the extracellular hinge and transmembrane domain of the RevCAR is selected from the group comprising a hinge and transmembrane domain of a human CD28 molecule, a CD8a chain NK cell receptor, parts of the constant region of an antibody and combinations thereof.
  • the signal transduction domain of the RevCAR is selected from the group comprising cytoplasmic regions of CD28, CD137 (4-1 BB), CD134 (0X40), CD278 (ICOS), DAP10 and CD27, programmed cell death-1 (PD-1), cytotoxic T-lymphocyte antigen 4 (CTLA-4), cytoplasmic regions of CD3 chains, DAP12, CD122 (interleukin-2 receptor P), CD132 (interleukin- 2 receptor y), CD127 (interleukin-7 receptor a), CD360 (interleukin-21 receptor), activating Fc receptors and mutants thereof.
  • the kit according to the invention comprises at least one further targeting module or at least one further nucleic acid, vector or cell encoding a further targeting module, wherein the at least one further targeting module comprises at least one target cell-binding domain and a tag-binding domain, wherein the at least one target cell-binding domain is an antibody, antibody fragment, a protein, a peptide or a low molecular weight organic ligand that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD5, CD7, CD8, CD10, CD15, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD66a, CD66b, CD66c, CD66d, CD66e, CD66f, CD90, CD99, CD123, CD133, CD135, CD150 CD181 , CD182, CD184, CD223, CD229, CD269, CD273, CD274, CD276, CD279, CD319
  • the kit according to the invention comprises the targeting module and/or the vector or cell comprising a nucleotide sequence encoding a RevCAR in the form of a pharmaceutical composition.
  • the kit according to the invention is used in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal, preferably for use in the treatment of cancer, infectious disease or autoimmune disease.
  • the targeting module is administered on its own, preferably one hour to 2 days, more preferably 4 to 24 hours, prior to the administration of the vector or cell comprising a nucleotide sequence encoding a RevCAR.
  • the administration of the targeting module prior to the administration of the vector or cell comprising a nucleotide sequence encoding a RevCAR stimulates the RevCAR and increases the expansion of the RevCAR carrying effector cells and their accumulation at the target site.
  • the targeting module is administered simultaneously with the vector or cell comprising a nucleotide sequence encoding a RevCAR.
  • the targeting module is administered until, preferably in the range of 3 days to 30 days, after the administration of the vector or cell comprising a nucleotide sequence encoding a RevCAR. Furthermore, additional such doses of the targeting module may be administered following resting periods to reactivate the RevCAR-carrying effector cells.
  • the term “reversible chimeric antigen receptor” refers to an artificial chimeric fusion protein, in particular a receptor comprising a tag, an extracellular hinge and a transmembrane domain and a signal transduction domain.
  • the domains can be derived from different sources and therefore, the receptor is called chimeric.
  • the receptor can bind with the tag to different targeting modules.
  • the cell comprising a nucleotide sequence encoding a RevCAR expresses the RevCAR, which has binding specificity for the tag-binding domain of the targeting module, which in turn binds to CD123 on a target cell.
  • the targeting module is in monomeric, dimeric or polymeric form, preferably in monomeric form.
  • the targeting module is monovalent, bivalent or multivalent.
  • the targeting module according to the invention is bivalent or multivalent and comprises at least one CD123-binding domain and a tag-binding domain that binds to a human La epitope E5B9 comprising a VL-linker-Vn structure.
  • the different domains of the targeting module according to the invention are linked with each other by a linker.
  • the linker comprises a short sequence of preferably 10 to 20 amino acid residues.
  • the targeting module comprises a flexible peptide sequence that is selected such that the domains have a three-dimensional folding that allows them to exhibit the specificity for effector cell and target cell binding.
  • Preferred linkers are glycineserine linkers with the structure (GxS y ) with x and y selected from 1 to 10, preferably 1 to 5. Usually preferred are 1 to 10 repeats of the sequence G4S1 (SEQ ID No. 24).
  • linkers are preferred that are constituted of a peptide sequence that can increase the protease resistance of the antibody derivatives.
  • the linker is SEQ ID No. 25 or SEQ ID No. 26.
  • the targeting module according to the invention comprises a further domain selected from the group comprising co-stimulatory ligands, radionuclides, cell death-inducing chemical compounds and half-life increasing domains, preferably lgG1 Fc, lgG2 Fc, lgG3 Fc, lgG4 F c , HSA, FcRn-binding peptides or mutants thereof.
  • the term “mutants” refers to proteins having at least 90 % sequence identity to the half-life increasing domain, preferably at least 95 % sequence identity.
  • the mutant is capable of havhg one or more activities of the named peptides or proteins; in particular, the mutant increases the halflife like the half-life increasing domain.
  • the targeting module according to the invention is used in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal, wherein the targeting module is administered in combination with a vector or a cell comprising a nucleotide sequence encoding a reversible chimeric antigen receptor and at least one further targeting module, wherein the at least one further targeting module comprises at least one target cellbinding domain and a tag-binding domain or a tag, wherein the at least one target cell-binding domain is an antibody, antibody fragment, a protein, a peptide or a low molecular weight organic ligand that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD8, CD10, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD90, CD99, CD133, CD150 CD181 , CD182, CD184, CD223, CD229, CD269 (BCMA),
  • target cell-binding domain refers to a peptide, protein, or low molecular weight organic ligand, which specifically binds a protein or protein complex (antigen) on the surface of a target cell, preferably a cancer cell, T cell, infected cell, pathogens or parasites.
  • peptide As used herein, the terms “peptide”, “polypeptide” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence.
  • low molecular weight organic ligand refers to an organic molecule with a molecular weight of maximal 10 kilodaltons, preferably of maximal 3 kilodaltons, which specifically binds a protein or protein complex (antigen) on the surface of a target cell, preferably a cancer cell, T cell, infected cell or pathogens or parasites.
  • target cell-binding domain also comprises soluble T cell receptors, which are composed of the alpha and beta or the gamma and delta chains of a T cell receptor (TOR), fragments or mutants thereof.
  • TCR-derived binding moieties recognize and bind to peptides presented by human leukocyte antigen class (HLA) I and II protein complexes. Examples are, but are not limited to, TCRs specific for peptides derived from proteins like EGFR family, survivin, sry- like high motility group box (SOX) protein family, melanoma-associated antigens (e.g.
  • autoimmunogenic cancer/testis antigen NY-ESO-1 members of the melanoma antigen family A MAGEA, the preferentially expressed antigen in melanoma PRAME), and leukemia-associated antigens (e.g. Wilms tumor gene 1 WT1).
  • analogues refers to molecules having a high degree of structural identity to the named antibodies, antibody fragments, proteins, peptides or low molecular weight organic ligands, preferably at least one atom, group of atoms, functional group or substructure is replaced with another group of atoms, e.g. a hydroxy group.
  • an analogue of somatostatin (SRIF14) is octreotide or pasireotide.
  • the analogues bind the identical antigens as the named antibodies, antibody fragments, proteins, pepides or low molecular weight organic ligands.
  • the analogues of the named antibodies, antibody fragments, proteins or peptides comprise modifications selected from the group comprising D amino acids, pseudo peptide bonds, aminoalcohols, non-proteinogenic amino acids, unnatural amino acids, amino acids with modified side chains and/or circular proteins.
  • these analogues reveal increased stability.
  • the target cell-binding domain is a soluble T cell receptor consisting of the alpha and beta or the gamma and delta chain of a T cell receptor (TCR).
  • TCR T cell receptor
  • the at least one further targeting module comprises at least one target cell-binding domain and a tag-binding domain or a tag, wherein the at least one target cell-binding domain is an antibody or an antibody fragment that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD8, CD10, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD90, CD99, CD133, CD150 CD181 , CD182, CD184, CD223, CD229, CD269, CD273, CD274, CD276, CD279, CD319, CD366 and CD371 , interleukin receptors, especially preferred IL-8Ra, IL-8R
  • the nucleic acid, vector and/or cell are isolated.
  • isolated means altered or removed from the natural state.
  • the nucleic acid is a cDNA.
  • cDNA complementary DNA
  • cDNA refers to double-stranded DNA synthesized from a single-stranded RNA, e.g. mRNA, in a reaction catalyzed by the enzyme reverse transcriptase.
  • cDNA is of synthetic origin.
  • cDNA is derived from mRNA, therefore containing only exons but no introns, as opposed to genomic DNA.
  • the vector is preferably a plasmid, an artificial chromosome, linearized DNA or RNA, a virus particle or another vector that contains an expression cassette that is incorporated stably into the genome of a host cell or host organism.
  • the cell is selected from immune cells, preferably with cytolytic, phagocytic or immunosuppressive activity, such as T cells, Natural Killer (NK) cells and macrophages.
  • T cells including alpha/beta and gamma/delta T cells or subpopulations of T cells like stem-cell memory T cells or central memory T cells, cytotoxic T cells or NK cells.
  • the nucleic acid, vector or cell further comprises an inducible expression system.
  • the inducible expression system is based on a prokaryotic operon, including, but not limited to, the lac operon, transposon TnTM or tetracycline operon.
  • the inducible expression system is based on components of a eukaryotic signaling pathway, including, but not limited to, expression systems based on a steroid receptor, an estrogen receptor, progesterone or metallothionein.
  • the inducible expression system induces the transcription of the nucleotide sequence encoding a RevCAR and/or a nucleotide sequence encoding a targeting module according to the invention, preferably the inducible expression system induces the transcription of the nucleotide sequence encoding a targeting module according to the invention.
  • the nucleic acid, vector or cell is administered in combination with a vector or a cell comprising a nucleotide sequence encoding a RevCAR and a nucleic acid, a vector or a cell comprising a nucleotide sequence encoding a further targeting module, wherein the at least one further targeting module comprises at least one target cell-binding domain and a tag-binding domain or a tag, wherein the at least one target cell-binding domain is an antibody, antibody fragment, a protein, a peptide or a low molecular weight organic ligand that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD5, CD7, CD8, CD10, CD15, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD66a, CD66b, CD66c, CD66d, CD66e, CD66f, CD90, CD99, CD123, CD133, CD13
  • the pharmaceutical composition comprises at least one further targeting module or at least one further nucleic acid, vector or cell encoding a further targeting module, wherein the at least one further targeting module comprises at least one target cell-binding domain and a tagbinding domain or a tag, wherein the at least one target cell-binding domain is an antibody, antibody fragment, a protein, a peptide or a low molecular weight organic ligand that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD8, CD10, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD90, CD99, CD133, CD150 CD181 , CD182, CD184, CD223, CD229, CD269, CD273, CD274, CD276, CD279, CD319, CD366 and CD371 , interleukin receptors, especially preferred IL-8Ra, IL-8R
  • the tag-binding domain binds to a tag from the human nuclear La protein.
  • the tag-binding domain is an antibody or an antigen-binding fragment, comprising a VL according to the following sequence: DIVMTQSPDSLAVSLGERATINCX24SSQSLLNSRTX35KNYLAWYQQKPGQPPKLLIYWASTR X61SGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLX101TFGGGTKVEIK (SEQ ID No.
  • X24, X35, Xei and X101 are independently from each other selected from a proteinogenic alpha-amino acid residue; or a sequence having at least 90 % sequence identity, preferably at least 95 % sequence identity; to SEQ ID No. 21 .
  • the tag-binding domain constitutes an anti-La epitope scFv.
  • X24 to X101 are selected as follows:
  • X24 is selected from polar and/or positive charged residues, such as Serine, Threonine, Asparagine, Glutamine, Histidine, Lysine and Arginine; preferably Lysine or Arginine;
  • X35 is preferably selected from Lysine and Proline
  • Xei is selected from polar and charged residues, such as Asparagine, Aspartic Acid, Glutamine, Glutamic acid, Histidine, Lysine and Arginine, preferably Glutamic acid and Lysine;
  • X101 is selected from hydrophobic residues, such as Isoleucine, Leucine, Valine, Alanine, Methionine, Phenylalanine, Proline and Tryptophan; preferably Leucine or Proline.
  • the tag-binding domain comprises a sequence having each at least 90 % sequence identity, preferably at least 95 % sequence identity; to the sequences according to SEQ ID No. 20 (V H ) and SEQ ID No. 21 (V L ).
  • the tag-binding domain constitutes the anti-La 5B9 scFv according to SEQ ID No. 20 (V H ) and SEQ ID No. 21 (V L )
  • the term “extracellular hinge and a transmembrane domain” refers to a flexible peptide sequence connected to the tag, which anchors the RevCAR into the cell membrane of the cell and protrudes from the surface of the cell for optimal binding to its particular targeting module.
  • the extracellular hinge and transmembrane domain are selected from hinge and transmembrane domains of human CD28 molecule, CD8a chain, NK cell receptors, preferably natural killer group NKG2D; or parts of the constant region of an antibody and combinations thereof.
  • the term “combinations thereof’ refers to combinations of the different hinge and transmembrane domains.
  • Pinthus et al. and Cartel lieri et al. describe the use of hinge and transmembrane domains of the human CD28 molecule in CARs (Pinthus et al. 2003, Cartellieri et al. 2016).
  • Zhang et al. describe the use of hinge and transmembrane domains of NKG2D in CARs (Zhang et al. 2005).
  • Frigault et al. and Wang et al. describe the use of hinge and transmembrane domains of parts of the constant region of immunoglobulin G1 (IgG) (Frigault et al. 2015, Wang et al. 2007). Frigault et al. describes the use of hinge domains of the constant region of lgG4.
  • IgG immunoglobulin G1
  • extracellular hinge and transmembrane domain examples include CD28 extracellular hinge and transmembrane domain, CD8alpha extracellular hinge and transmembrane domain, lgG1 or lgG4 constant regions combined with CD28 or CD137 transmembrane domain.
  • signal transduction domain refers to a peptide sequence which transmits a signal into the cell by cross-linkage of the cell expressing the RevCAR (effector cell) to a human cell surface protein or protein complex (target cell). Cross-linkage between effector and target cell is mediated by the targeting module according to the invention.
  • the signal transduction domain is selected from cytoplasmic regions of CD28, CD137 (4-1 BB), CD134 (0X40), CD278 (ICOS), DAP10 and CD27, programmed cell death-1 (PD-1), cytotoxic T-lymphocyte antigen 4 (CTLA-4), cytoplasmic regions of CD3 chains, DAP12, CD122 (interleukin-2 receptor P), CD132 (interleukin-2 receptor y), CD127 (interleukin-7 receptor a), CD360 (interleukin-21 receptor) activating Fc receptors and mutants thereof.
  • mutants refers to proteins having at least 90 % sequence identity to the signal transduction domains, preferably at least 95 % sequence identity.
  • the mutant transmits a signal into the cell by cross-linkage of the cell expressing the RevCAR (effector cell) to a human cell surface protein or protein complex (target cell) in the same way as the named signal transduction domains.
  • mutants are truncated versions.
  • the term “truncated versions” refers to shortened proteins having at least 90 % sequence identity to the signal transduction domains, preferably at least 95 % sequence identity, more preferably having a chain length of at least 90 % and a sequence identity of 100 %, most preferably a chain length of at least 95 % and a sequence identity of 100 %.
  • the truncated version has an activity of at least 80 %, preferably of at least 90 %, more preferably of at least 95 %; of the named signal transduction domains.
  • Hornbach et al. and Cartellieri et al. describe the use of cytoplasmic regions of CD28 as signal transduction domain in CARs (Hornbach et al. 2001 , Cartellieri et al. 2016). Guedan et al. describes the use of a mutant of cytoplasmic regions of CD28 as signal transduction domain (Guedan et al. 2020).
  • Zhang et al. describes the use of DAP10 as signal transduction domain (Zhang et al. 2005).
  • Fedorov et al. describes the use of programmed cell death 1 (PD-1) and of cytotoxic T-lymphocyte antigen 4 (CTLA-4) as signal transduction domain in CARs (Fedorov et al. 2013).
  • PD-1 programmed cell death 1
  • CTL-4 cytotoxic T-lymphocyte antigen 4
  • Gong et al. and Gade et al. describe the use of cytoplasmic regions of CD3 chains, in particular the CD3 chain, as signal transduction domain in CARs (Gong et al. 1999, Gade et al. 2005).
  • Tdpfer et al. describes the use of DAP12 as signal transduction domain in CARs (Tdpfer et al. 2015).
  • Kagoya et al. describes the use of signaling chains or motifs derived from interleukin receptors as signal transduction domain in CARs (Kagoya et al. 2018).
  • Larners et al. and Kershaw et al. describe the use of activating Fc receptors, in particular the Fc epsilon receptor y chain, as signal transduction domain (Larners et al. 2004, Kershaw et al. 2006).
  • the signal transduction domain is selected from cytoplasmic regions of CD28, CD137 (4-1 BB), CD134 (0X40), CD278 (ICOS), DAP10 and CD27, programmed cell death-1 (PD-1), cytotoxic T-lymphocyte antigen 4 (CTLA-4), cytoplasmic regions of CD3 chains, DAP12, CD122 (interleukin-2 receptor P), CD132 (interleukin-2 receptor y), CD127 (interleukin-7 receptor a) and CD360 (interleukin-21 receptor) activating Fc receptors.
  • the RevCAR comprises a fourth domain, wherein the fourth domain is a short peptide linker in the extracellular portion of the receptor that may serve to detect the chimeric antigen receptor on the cell surface or stimulate the chimeric antigen receptor T cell.
  • the fourth domain is located in between the tag-binding domain or the tag and the extracellular hinge domain or an integral part of the extracellular hinge domain.
  • the RevCAR engrafted cells with the fourth domain can be specifically stimulated to proliferate preferentially and persist longer compared to non-engrafted cells either in vitro or in vivo.
  • the fourth domain may be also used to purify RevCAR engrafted cells from mixed cell populations or to dampen RevCAR engrafted cell-mediated immune response and to eliminate RevCAR engrafted cells in vivo.
  • the RevCAR comprises a signal peptide.
  • the signal peptide allows for expression on the cell surface of an effector cell.
  • the signal peptide is located at the N-terminus of the RevCAR nucleotide sequence in front of the tag-binding domain or the tag.
  • the signal peptide targets proteins to the secretory pathway either co-translationally or post-translationally and is selected from leader peptides from proteins like CD28, CD8alpha, IL-2, lysozyme C or the heavy or light chains of antibodies of human origin to avoid immunogenic reactions.
  • the nucleic acid is a cDNA.
  • the tag is present at the amino-terminal end of the polypeptide that comprises the RevCAR.
  • locating the tag at the amino terminus permits the tag unhampered access to the targeting module that is bound to the target cell.
  • the nucleic acid encodes a RevCAR according to SEQ ID No. 29 or SEQ ID No. 30.
  • the nucleic acid is SEQ ID No. 31 or SEQ ID No. 32.
  • the cell comprising a nucleotide sequence encoding a RevCAR is selected from immune cells, preferably with cytolytic, phagocytic or immunosuppressive activity, such as T cells, Natural Killer (NK) cells and macrophages.
  • the cell is selected from T cells, including alpha/beta and gamma/delta T cells or subpopulations of T cells like stemcell memory T cells or central memory T cells, cytotoxic T cells; or NK cells.
  • the kit further comprises at least one further targeting module or at least one further nucleic acid, vector or cell encoding a further targeting module, wherein the at least one further targeting module comprises at least one target cell-binding domain and a tag-binding domain or a tag, wherein the at least one target cell-binding domain is an antibody, antibody fragment, a protein, a peptide or a low molecular weight organic ligand that binds to surface antigens selected from the group comprising CD2, CD3, CD4, CD8, CD10, CD19, CD20, CD22, CD23, CD25, CD30, CD33, CD38, CD44, CD44v6 CD52, CD90, CD99, CD133, CD150 CD181 , CD182, CD184, CD223, CD229, CD269, CD273, CD274, CD276, CD279, CD319, CD366 and CD371 , interleukin receptors, especially preferred IL-8Ra, IL-8Rp, IL-11 Ra, IL
  • Fig. 1 shows a schematic illustration of the mode of action of engineered T cell according to the invention in combination with an antigen-specific targeting module (TM) together forming the active drug.
  • a RevCAR expressing allogeneic T cell (Allo-RevCAR-T) carries the RevCAR epitope (RCE or tag), preferably a short, non-immunogenic peptide motif derived from the human nuclear La/SSB autoantigen, on their cell surface. Since ligands binding to RCE or tag are not present within the human body Allo-RevCAR-T remain in an off-mode (left).
  • Antigen-specificity of Allo- RevCAR-T is provided via a soluble targeting module (TM) with exclusive specificity for a target antigen.
  • TM soluble targeting module
  • the TM for Allo-RevCAR consists of a target-binding domain and a tag-binding domain specific for the RCE or tag.
  • Cross-linking of RevCAR-T and the target antigen-expressing tumor cell by TMs activates RevCAR-T effector functions and subsequently killing of the tumor cells (right).
  • Fig. 2 shows surface plasmon resonance (SPR) sensograms of targeting modules according to the invention binding to CD123 with a tag-binding domain comprising the structure Vi-linker-Vn compared to a reference targeting module with the same CD123-binding domain and a tagbinding domain comprising the structure VH-linker-Vi.: A) SEQ ID No. 2 (reference), B) SEQ ID No. 5, C) SEQ ID No. 6 and D) SEQ ID No. 8. For data fitting and KD calculation a 1 :1 binding model was applied.
  • SPR surface plasmon resonance
  • Fig. 3 shows SPR sensograms of targeting modules according to the invention binding to the La epitope 5B9 according to SEQ ID No. 28 with a tag-binding domain comprising the structure VL- linker-Vn compared to a reference targeting module with the same CD123-binding domain and a tag-binding domain comprising the structure Vn-linker-Vi:
  • Fig. 4 shows the cellular binding of targeting modules according to the invention to CD123 positive AML cell lines: A) SEQ ID No. 5 to Oci-AML3, B) SEQ ID No. 9 to Oci-AML3, C) SEQ ID No. 4 to Molm-13 and D) SEQ ID No. 6 to Molm-13.
  • the mean fluorescence intensity (MFI) was plotted to obtain the dose-response curve and the half maximal binding (KD) was calculated after fitting with a four logistic regression.
  • Fig. 5 shows the thermodynamic stability of two targeting modules according to the invention (SEQ ID No. 5 and SEQ ID No. 9) assessed by melting point analysis in a pH range from pH 4.0 to 9.0.
  • Fig. 6 shows the results of a cytotoxicity assay of RevCAR T cells and different targeting modules according to the invention against AML cell line Molm-13 using a suspension cell based cocultivation assay in the presence of variable concentrations of the targeting module: A) SEQ ID No. 2 (reference), B) SEQ ID No. 4, C) SEQ ID No. 5, and D) SEQ ID No. 6.
  • the target cell lysis was plotted to obtain a dose-response curve and the EC50 was calculated after fitting with a four logistic regression.
  • Fig. 7 shows the results of a cytotoxicity assay of RevCAR T cells and different targeting modules according to the invention against AML cell line line Oci-AML3 using a suspension cell based cocultivation assay in the presence of variable concentrations of the targeting module: A) SEQ ID No. 2 (reference), B) SEQ ID No. 3, C) SEQ ID No. 4, D) SEQ ID No. 5 and E) SEQ ID No. 6.
  • the target cell lysis was plotted to obtain a dose-response curve and the EC50 was calculated after fitting with a four logistic regression.
  • Fig. 8 shows the surface expression of CD25 on Allo-RevCAR-T upon R-TM123 mediated activation.
  • Fig. 9 shows the specific lysis of AML cell line MOLM-13 by R-TM123 re-directed Allo-RevCAR- T.
  • Fig. 10 shows the cytokine and effector molecule release by Allo-RevCAR-T redirected by R- TM123 against the AML cell line MOLM-13.
  • Fig. 11 shows the cytotoxic response of Allo-RevCAR-T redirected by R-TM123 against primary leukemic cells from AML patients.
  • Fig. 12 shows the in vivo pharmacokinetics of R-TM123 in NSG mice.
  • Fig. 13 shows leukemia elimination by R-TM123-redirected Allo-RevCAR-T against extramedullary disease of AML
  • the targeting module R-TM123 is a soluble, recombinant fusion protein comprising two antibody- derived binding domains. One selectively binds to the target antigen CD123, the other recognizes the RCE ortag presented on RevCAR expressing cells (epitope E5B9 from the human La protein). Thus, R-TM123 functions as a bridging module between RevCAR-T and a CD123-expressing target cancer cell (Fig. 1).
  • the targeting module further comprises an 8x-histidine tag for detection and purification purposes at the C-terminus.
  • Tab. 1 Design and characteristics of different targeting modules according to the invention (SEQ ID No. 3 to SEQ ID No. 6, SEQ ID No. 8 and SEQ ID No.
  • CD123-binding TMs The functionality of the CD123-binding TMs can be confirmed in binding assays to soluble recombinant CD123 (Fig. 2 and 3 and Tab. 1) using surface plasmon resonance measurements.
  • Binding of different variants of the targeting module according to the invention was analyzed by SPR measurements using human CD123-Fc coupled to a CM5 sensor chip on a Biacore X100 device (Fig. 2).
  • Targeting modules were purified monomer except for the targeting module according to SEQ ID No. 8.
  • the targeting modules were concentrated between 1.23 to 100 nM and measured in technical duplicates.
  • a 1 :1 binding model was applied for data fitting and KD calculation a 1 :1 binding model was applied.
  • CD123-binding TMs interaction with human CD123 yielded a dissociation constant at equilibrium (KD) in a range between 23 pM und 5.2 nM, while the reference TM according to SEQ ID No. 2 had a K D of 227 pM.
  • binding of different variants of the targeting module according to the invention was analyzed using the La epitope 5B9 (SEQ ID No. 28) fused to human Fc domain which was coupled to a CM5 sensor chip on a Biacore X100 device (Fig. 3).
  • the targeting modules were purified monomers.
  • the targeting modules were concentrated between 2.47 to 200 nM and measured in technical duplicates. For data fitting and KD calculation a two-state-reaction binding model was applied.
  • TMs interaction with 5B9 yielded a dissociation constant at equilibrium (KD) in a range between 2.0 nM und 3.4 nM, while the reference TM according to SEQ ID No. 2 had a KD of 17 nM.
  • TM CD123-binding targeting modules
  • Figure 4 shows the cellular binding potential assessed using the CD123 positive target cell lines Oci-AML3 and Molm-13. Different concentrations of R-TM123 were incubated with cells, washed and quantified. A dose-response curve was obtained when the geometric mean fluorescence (MFI) was plotted against the TM concentration.
  • MFI geometric mean fluorescence
  • thermodynamic stability of two targeting modules according to the invention was assessed by melting point analysis (Fig. 5).
  • a thermal shift assay in different buffers in a pH range from pH 4.0 to 9.0 was used to determine the protein melting point of the targeting module according to SEQ ID No. 5 and SEQ ID No. 9.
  • colloidal stability of proteins correlates with the thermodynamic stability and allows comparative predictability of long term stability.
  • the RevCAR comprises IL-2LP (modified human IL-2 leader peptide), RCE (RevCAR epitope, also tag), G4S1 (glycine-serine linker), ECD (extracellular domain), TMD (transmembrane domain), ICD (intracellular domain).
  • IL-2LP modified human IL-2 leader peptide
  • RCE RevCAR epitope, also tag
  • G4S1 Glycine-serine linker
  • ECD extracellular domain
  • TMD transmembrane domain
  • ICD intracellular domain
  • the transfer of the vector can be performed by electroporation or transfection of nucleic acids or the help of viral vector systems like adeno-, adeno-associated, retro-, foamy- or lentiviral viral gene transfer.
  • the lentiviral gene transfer is applied for stable expression of RevCARs in immune cells by first constructing a lentiviral vector encoding for a selected RevCAR.
  • the lentiviral vector is pLVX- EFIalpha UniCAR 28/ (Clontech, Takara Bio Group), in which the lentiviral parts of the vector are derived from the human immunodeficiency virus (HIV) and the MSC/IRES/ZxGreenl portion was replaced by the RevCAR construct.
  • the lentiviral particles are produced by transient transfection of human embryonal kidney (HEK) 293T (ACC 635) cells with the RevCAR encoding lentiviral vector plasmid and cotransfection with a group specific antigen (gag) and Polymerase (pol) encoding plasmid (psPAX2) plus a plasmid encoding for an envelope (pMD2.G).
  • the packaging plasmid expresses Gag and Pol protein of HIV-1.
  • the plasmid MD2.G encodes the glycoprotein of the vesicular stomatitis virus (VSV-G).
  • VSV-G protein is used to lentiviral vectors to transduce a broad range of mammalian cells.
  • Lentiviral vectors can successfully pseudotype with the envelope glycoproteins (Env) of amphotropic murine leukemia virus (MLV) or the G protein of vesicular stomatitis virus (VSV-G), a modified envelope of the prototypic foamy virus (PFV) or chimeric envelope glycoprotein variants derived from gibbon ape leukemia virus (GaLV) and MLV.
  • Env envelope glycoproteins
  • MLV amphotropic murine leukemia virus
  • VSV-G G protein of vesicular stomatitis virus
  • PFV prototypic foamy virus
  • GaLV gibbon ape leukemia virus
  • MLV gibbon ape leukemia virus
  • PBMC peripheral blood mononuclear cells
  • isolated T cells are activated with mab specific for the CD3 complex, e.g. clone OKT3 or UCHT1 , either given in solution or coated to plastic cell culture dishes or magnetic beads or a biodegradable polymer matrix.
  • Activation of PBMC or isolated T cells is further enhanced by stimulating costimulatory pathways with mabs or ligands specific for CD27, CD28, CD134 or CD137 either alone or in combinations coated to plastic cell culture dishes or magnetic beads or a biodegradable polymer matrix and the supply with exogenous recombinant cytokines like interleukin (IL)-2, IL-7, IL-12, IL-15 and IL-21.
  • IL interleukin
  • Concentrated or non-concentrated virus particles are added to PBMC or T cell cultures 24 h to 96 h after initial administration of activating CD3 specific antibodies and/or antibodies specific for costimulatory receptors CD27, CD28, CD134 or CD137 and/or recombinant cytokines as single or multiple doses.
  • T cell electroporation, transduction and expansion may be performed in open cell culture systems by manual handling or in closed partially or fully automated systems.
  • Stable transduction of T cells may be determined by flow cytometry after staining with tagcontaining molecules for surface expression of RevCARs or mabs directed against a fourth domain of RevCARs from day 3 onwards after the final administration of virus supernatant.
  • RevCAR transduced T cells can be propagated in vitro by culturing them under the supply of recombinant cytokines and activating anti-CD3 mabs.
  • RevCAR harbors the optional fourth domain, a peptide sequence forming a linear epitope for a mab
  • immune cells genetically modified to express RevCARs can be specifically propagated in vitro by coating a mab or antibody fragments thereof binding to the fourth RevCAR domain to the surface of culture dishes or to beads of any kind or a biodegradable polymer matrix, which are added to the cell culture at a defined ratio.
  • the binding of surface-coated mabs to the RevCAR peptide domain induces cross-linkage of cell-surface expressed RevCARs and formation of an immune synapse, which leads to the activation of signal pathways specifically triggered by the signal domain of the RevCAR.
  • this may lead to enhance proliferation and sustained resistance against activation-induced cell death of the RevCAR-carrying immune cells and therefore enrichment of RevCAR genetically modified immune cells in a mixed population.
  • the optional fourth domain a peptide sequence forming a linear epitope for a mab
  • the optional fourth domain can be further utilized to enrich and purify RevCAR-expressing immune cells from mixed populations. Enrichment and purification are performed with the help of a mab or antibody fragment thereof binding to the fourth RevCAR domain to either mark RevCAR-expressing cells for cell sorting or to transiently link the RevCAR expressing immune cell to small particles, which can be utilized for cell isolation.
  • RevCAR-engrafted immune cells are incubated with the mab recognizing the fourth domain.
  • magnetic beads are added, which are conjugated with antibodies or fragments thereof directed against the species- and isotype-specific heavy and light chains of the mab binding to the optional fourth domain.
  • RevCAR-expressing immune cells and magnetic beads are linked and are trapped and separated from other immune cells in a magnetic field.
  • the potency of CD123-binding TMs to induce a tumor cell elimination by RevCAR-T cells was tested using a suspension cell based co-cultivation assay with the AML cell line Molm-13 (Fig. 6) and the AML cell line 0ci-AML3 (Fig. 7) in the presence of variable concentrations of the targeting module.
  • Switchable CAR-T cells were incubated with the target cells at a E:T ratio of 2:1 in the presence of various TM concentrations for 48 h.
  • CD123-positive target cells the human AML cell line Molm-13 (Fig. 6) or 0ci-AML3 (Fig. 7), respectively, was used which was stained with efluor prior setup.
  • Target cells were quantified by flow cytometry and lysis was calculated normalizing the cell count of each sample to a control sample where only timor cells were plated. Data were fitted with a four-parameter model with a variable slope for sigmoidal curves. The calculated EC50 value can be interpreted as a representative value for the TM potency against these tumor cells.
  • IL-2 receptor a IL-2 receptor a
  • IL-2Ra The high-affinity receptor for IL-2, CD25 (IL-2 receptor a, IL-2Ra), is expressed in human T cells and becomes detectable on the cell surface upon stimulation of the endogenous TCR complex (Kmieciak et al. 2009).
  • IL-2Ra regulates the T cell proliferative response and is an indicator for the magnitude of TCR stimulation (Shatrova et al. 2016).
  • Stimulation of RevCAR via R-TM123 according to SEQ ID No. 5 resembles activation by endogenous TCR except that in the artificial receptor activating signals from the immunoreceptor tyrosine-based activation motif (ITAM) of the CD3 part are accompanied by simultaneous costimulatory signals from the CD28 signaling chain (Cartellieri et al. 2016) and this activation can be followed by monitoring CD25 upregulation.
  • ITAM immunoreceptor tyrosine-based activation motif
  • Figure 8 shows the surface expression of CD25 on RevCAR-T upon R-TM123 mediated activation.
  • RevCAR-T batches were co-cultured with CD123 expressing AML cell line MOLM-13, MV4- 11 and OCI-AML3 in the presence of varying concentrations of R-TM123 for 48 h.
  • Cell samples were prepared and surface expression of CD2, RevCAR, CD4, CD8 and CD25 were analyzed by flow cytometry. All samples were pre-gated for CD2+/RevCAR+ cells. Frequencies of CD25+ RevCAR-T cells are shown separately for CD4+ and CD8+ cells.
  • Technical triplicates from the co-culture were pooled and stained data of four clinical scale batches generated from healthy donor material is shown.
  • CD25 surface expression on RevCAR-T in the presence of CD123-expressing target cells was determined in response to R-TM123-mediated stimulation.
  • the frequency of CD25 expressing RevCAR-T is dependent on the R-TM123 dose ( Figure 8).
  • Both CD4+ and CD8+ RevCAR-expressing T cells are activated upon cross-linkage of RevCAR-T to target cells via R-TM123 ( Figure 8).
  • the R-TM123-dose-dependent magnitude of response after 48 h is similar for both sub-populations ( Figure 8 and Table 2).
  • RevCAR-T of four clinical-scale batches were used in cytotoxicity assays. Using increasing R-TM123 concentrations the cytotoxic response against three AML cell lines was analyzed for all four RevCAR-T batches. R-TM123-dose- response curves against MOLM-13, OCI-AML3 and MV4-11 are shown in Figure 9.
  • Figure 9 shows specific lysis of AML cell line MOLM-13 by R-TM123 re-directed RevCAR-T.
  • CD123 expressing AML cell lines MOLM-13, MV4-11 and OCI-AML3 were labeled with the cell dye eFluor670 and subsequently co-cultured at an E:T ratio of 1 :1 with 2 x 10 5 RevCAR-T cells from four clinical-scale batches in the absence or presence of R-TM123. After 48 h of co-culture the number of viable target cells was determined cytometrically and specific lysis determined. Mean ⁇ SD values of technical triplicates and dose-response curves derived for four clinical-scale RevCAR-T batches from independent donors are shown. Data points were fitted with four parameter non-linear regression in GraphPad9 and half-maximal dose of R-TM123 is reported in Table 3.
  • MOLM-13 cells are derived from the peripheral blood of a patient at relapse of acute monocytic leukemia (FAB M5a), which had evolved from myelodysplastic syndrome (Matsuo et al. 1997).
  • OCI-AML3 was established from a patient with AML (FAB M4) and is carrying an NPM 1 mutation (type A) and an aberrant cytoplasmic dislocation of nucleophosmin which is the immune-cytological hallmark of NPM1-mutated AML (Quentmeier et al. 2005).
  • FAB M4 acute monocytic leukemia
  • NPM 1 mutation type A
  • nucleophosmin which is the immune-cytological hallmark of NPM1-mutated AML
  • it also harbors a DNMT3A mutation of the R882C type (Tiacci et al. 2012).
  • both cell lines represent major AML subtypes which will be included in the up-coming clinical study.
  • the MV4-11 cell line was originally derived from a pediatric acute monocytic leukemia and is also described to express CD123 (Mani et al. 2018).
  • RevCAR-T cells induced target cell lysis for all these cell lines and the lysis occurred in a strictly R-TM123-dependent manner.
  • a half-maximal lysis (EC50) in the single digit picomolar range was observed for all three target cell lines (Table 2).
  • All four clinical-scale batches of RevCAR-T showed similar half-maximal lysis and reached the upper plateau (i.e. 100 % target cell lysis) at approximately 1 nM for all AML cell lines.
  • T cells Due to TCR engagement, T cells become activated and release a plethora of cytokines. These can have effector, stimulatory, regulatory, chemo-attractive and inflammatory functions. In a similar way, CAR-engineered T cells release cytokines upon stimulation via their artificial receptor (Rossi et al. 2018).
  • RevCAR-T To characterize the cytokine release potential of RevCAR-T, a co-culture assay was used. For this, RevCAR-T from the same four clinical-scale batches as used for the specific target cell lysis and T cell activation studies presented in previous sections were analyzed. Cells were thawed and co-cultured with MOLM-13 AML cells in the presence of R-TM123 for 48 h and the effector cytokines released in the cell culture supernatant were guantified using the MACSPlex Cytotoxic T/NK Cell Kit (Miltenyi, Germany).
  • the EC50 value can be used as a direct measure for the cytokine release dynamics and might be compared to other effector functions, like target cell lysis or T cell activation. In general, half-maximal cytokine release differed more strikingly between cytokines than between RevCAR-T cell products. It is particularly worth mentioning that the effector cytokines Granzyme B and Perforh were secreted already at low R-TM123 concentrations and correlated with target cells lysis (EC50 for Granzyme B/Perforin 4-12 pM as compared to 2-6 pM for lysis). The proinflammatory cytokines showed half- maximal cytokine secretion at much higher R-TM123 doses, e.g. GM-CSF at about 35-40 pM, IFN-y at about 20-25 pM or TNF-a at about 50-80 pM.
  • R-TM123 doses e.g. GM-CSF at about 35-40 pM, IFN-y at about 20
  • RevCAR-T clinical-scale products show T cell typical cytokine release.
  • the release differs guantitatively between cytokines and T cell donors or products. Cytokine release correlates with other effector functions (i.e. activation and target cell lysis) of the tested RevCAR-T but is shifted to higher R-TM123 doses.
  • Figure 10 shows cytokine and effector molecule release by RevCAR-T redirected by R-TM123 against the AML cell line MOLM-13.
  • RevCAR-T from four healthy donors and manufactured with the clinical-scale process were incubated with the CD123-expressing AML cell line MOLM-13 in the presence of R-TM123 at the indicated concentrations and at an effector to target cell ratio of 1 :1.
  • T cell co-culture supernatants were harvested, technical replicates were pooled and analyzed using a flow cytometry based multiplex assay (MACSPlex Cytotoxic T/NK Cell Kit; Miltenyi, Germany). Respective dose-response curves are depicted.
  • Sigmoidal data points were fitted using a four-parameter logistic regression in GraphPad Prism 9 and the half-maximal cytokine release (EC50) determined (summarized in Table 4).
  • RevCAR-T batches were cocultured with primary AML cells at an effector to target ratio of 1 :2 in the presence of R-TM123. After 48 h of coculture, the number of viable AML cells was determined via flow cytometry staining ( Figure 11).
  • Figure 11 shows cytotoxic response of RevCAR-T redirected by R-TM123 against primary leukemic cells from AML patients.
  • RevCAR-T derived from healthy donors and manufactured with the clinical-scale process were thawed and cocultured with 1.25-1.5 x 10 4 primary AML cells at an effector-to-target ratio of 1 :2 at the indicated R TM123 concentration range.
  • IMDM supplemented with 5 % FBS, 5 pM p-mercaptoethanol, 1 % penicillin/streptomycin, 100 ng/mL stem cell factor (SCF), 10 ng/mL IL-3, 10 ng/mL thrombopoetin (TPO), and 10 ng/mL Fms-related tyrosine kinase 3 ligand (FLT-3L) was used as culture media.
  • SCF stem cell factor
  • TPO 10 ng/mL thrombopoetin
  • FLT-3L Fms-related tyrosine kinase 3 ligand
  • NSG mice were injected with single doses of 1000 or 3000 ng/g R-TM123 drug product from the confirmation run intravenously (IV). Blood was collected at 15, 30, 60, 120, 180, 210, 255, 270, 300 and 360 min after injection by retro-orbital puncture.
  • the concentration of R-TM123 was measured using a specific sandwich ELISA assay using CD123- Fc as capturing agent and an anti-polyHis tag monoclonal antibody conjugated to horse radish peroxidase (HRP) for the detection of bound R-TM123.
  • Capture with CD123-Fc indicates integrity of the anti-CD123 domain while detection of the poly-HIS tag indicates presence of the second, RCE-specific scFv, as it is located N-terminally of the poly-HIS tag. Quantification of the test samples is achieved by comparing them to titrated amounts of R-TM123 standard.
  • the detection limit of the sandwich ELISA assay was determined to be 0.6 ng/mL assay concentration.
  • Graphical output for the experiments performed is provided in Figure 12 and summary of the key pharmacokinetic data is provided in Table 6.
  • Figure 12 shows in vivo pharmacokinetics of R-TM123 in NSG mice.
  • mice were injected IV with either 1000 or 3000 ng R-TM123 per g body weight.
  • Peripheral blood samples were taken by retro-orbital puncture at 15, 30, 60, 120, 180, 210, 255, 270, 300, and 360 min after IV bolus injection.
  • R-TM123 concentrations determined by ELISA were analyzed using PkSolver 2.0 (Zhang et al. 2010) NCA and 2CA. Mean ⁇ SD values of samples obtained from 5 individual mice are shown per data point.
  • the area under curve values (AUC) were determined to be 255603.5 (NCA) and 220241.7 ng/mL*min (2CA) for the 1000 ng per g body weight and 644179.4 (NCA) and 555559.9 ng/mL*min (2CA) for the 3000 ng per g body weight doses, respectively.
  • the calculated elimination half-life (T1/2) of R-TM123 is 36.5 min (NCA) and 38.0 min (2CA) for the 1000 ng per g body weight and 47.8 min (NCA) and 45.3 min (2CA) for the 3000 ng per g body weight doses, respectively.
  • the obtained T1/2 are in line with values reported in the literature for similar scFv constructs (Hutt et al.
  • R- TM123 was highest 15 min after intravenous injection (T ma x), i.e., at the earliest time point measured.
  • the maximal plasma concentration (Cmax) was detected 15 min after injection and determined to be 4682.6 and 11522.7 ng/mL for the 1000 ng per g body weight or 3000 ng per g body weight doses, respectively.
  • Cmax maximal plasma concentration
  • LLoQ lower limit of quantification
  • NCA and 2CA models of plasma data after intravenous bolus injection were applied using PkSolver 2.0 (Zhang et al. 2010). The observed differences between the two doses are most likely due to technical variation in sampling and/or ELISA performance, especially at lower R-TM123 concentrations.
  • Figure 13 shows leukemia elimination by R-TM123-redirected RevCAR-T against extramedullary disease of AML.
  • NSG mice were injected subcutaneously with 1x10 s mCherry-expressing MV4- 11 cells alone or in combination with 5x10 s RevCAR-T cells from a clinical-scale run and monitored for tumor growth by optical imaging. Mice were subsequently injected with R-TM123 (indicated dose per g bodyweight, daily, peritumorally) in four cycles of five days separated by application-free periods of two days. The percent tumor signal was referenced to initial measurement (geometric mean, tO) of the respective group.
  • Frigault MJ Lee J, Basil MC, Carpenito C, Motohashi S, Scholler J, Kawalekar OU, Guedan S, McGettigan SE, Posey AD Jr, Ang S, Cooper LJ, Platt JM, Johnson FB, Paulos CM, Zhao Y, Kalos M, Milone MC, June CH (2015) Identification of chimeric antigen receptors that mediate constitutive or inducible proliferation of T cells. Cancer Immunol. Res. 3 (4), 356-367.
  • Neoplasia 1 (2), 123-127.
  • CD28 costimulation is required for interleukin 2 secretion and receptor-mediated T-cell proliferation but does not affect receptor-mediated target cell lysis. Cancer Res. 61 (5), 1976-1982.
  • Kittel-Boselli E Soto KEG, Loureiro LR, Hoffmann A, Bergmann R, Arndt C, Koristka S, Mitwasi N, Kegler A, Bartsch T, Berndt N, Altmann H, Fasslrinner F, Bornhauser M, Bachmann MP, Feldmann A (2021) Targeting Acute Myeloid Leukemia Using the RevCAR Platform: A Programmable, Switchable and Combinatorial Strategy. Cancers (Basel). 13(19), 4785.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Endocrinology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Cell Biology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Hematology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
PCT/US2023/068998 2022-06-23 2023-06-23 Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal Ceased WO2023250489A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
JP2024575443A JP2025524457A (ja) 2022-06-23 2023-06-23 哺乳動物におけるキメラ抗原受容体介在性の免疫応答を刺激するための方法において使用するためのcd123に対する標的化モジュール
CN202380060615.0A CN119790072A (zh) 2022-06-23 2023-06-23 用于刺激哺乳动物的嵌合抗原受体介导的免疫反应的方法中的针对cd123的靶向模块
EP23741575.7A EP4543922A1 (en) 2022-06-23 2023-06-23 Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal
CA3258275A CA3258275A1 (en) 2022-06-23 2023-06-23 Anti-CD123 targeting modules intended for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal
AU2023289687A AU2023289687A1 (en) 2022-06-23 2023-06-23 Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal
US18/878,321 US20250269025A1 (en) 2022-06-23 2023-06-23 Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP22180805.8 2022-06-23
EP22180805.8A EP4296281A1 (en) 2022-06-23 2022-06-23 Targeting modules against cd123 and a tag for use in a method for stimulating a universal chimeric antigen receptor-mediated immune response in a mammal
EP23168260.0 2023-04-17
EP23168260 2023-04-17

Publications (1)

Publication Number Publication Date
WO2023250489A1 true WO2023250489A1 (en) 2023-12-28

Family

ID=87281111

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/068998 Ceased WO2023250489A1 (en) 2022-06-23 2023-06-23 Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal

Country Status (7)

Country Link
US (1) US20250269025A1 (cg-RX-API-DMAC7.html)
EP (1) EP4543922A1 (cg-RX-API-DMAC7.html)
JP (1) JP2025524457A (cg-RX-API-DMAC7.html)
CN (1) CN119790072A (cg-RX-API-DMAC7.html)
AU (1) AU2023289687A1 (cg-RX-API-DMAC7.html)
CA (1) CA3258275A1 (cg-RX-API-DMAC7.html)
WO (1) WO2023250489A1 (cg-RX-API-DMAC7.html)

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2990416A1 (en) 2014-08-29 2016-03-02 GEMoaB Monoclonals GmbH Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
EP3581200A1 (en) 2018-06-13 2019-12-18 GEMoaB Monoclonals GmbH Reversed universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2990416A1 (en) 2014-08-29 2016-03-02 GEMoaB Monoclonals GmbH Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
EP3581200A1 (en) 2018-06-13 2019-12-18 GEMoaB Monoclonals GmbH Reversed universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
BRUDNO JNKOCHENDERFER JN: "Toxicities of chimeric antigen receptor T cells: recognition and management", BLOOD, vol. 127, 2016, pages 3321 - 3330, XP055547499, DOI: 10.1182/blood-2016-04-703751
CARTELLIERI MBACHMANN MFELDMANN ABIPPES CSTAMOVA SWEHNER RTEMME ASCHMITZ M, CHIMERIC ANTIGEN RECEPTOR-ENGINEERED T CELLS FOR IMMUNOTHERAPY OF CANCER J. BIOMED. BIOTECHNOL., 2010
CARTELLIERI MFELDMANN AKORISTKA SARNDT CLOFF SEHNINGER AVON BONIN MBEJESTANI EPEHNINGER GBACHMANN MP: "Switching CAR T cells on and off: a novel modular platform for retargeting of T cells to AML blasts", BLOOD CANCER J., vol. 6, no. 8, 2016, pages e458, XP055532158, DOI: 10.1038/bcj.2016.61
CHICHILI GRHUANG LLI HBURKE SHE LTANG QJIN LGORLATOV SCICCARONE VCHEN F: "A CD3xCD123 bispecific DART for redirecting host T cells to myelogenous leukemia: preclinical activity and safety in nonhuman primates", SCI TRANSL MED, vol. 7, no. 289, 2015, pages 289ra282, XP055653881, DOI: 10.1126/scitranslmed.aaa5693
DAROWSKI DKOBOLD SJOST CKLEIN C: "Combining the best of two worlds: highly flexible chimeric antigen receptor adaptor molecules (CAR-adaptors) for the recruitment of chimeric antigen receptor T cells", MABS, vol. 11, no. 4, 2019, pages 621 - 631, XP055688147, DOI: 10.1080/19420862.2019.1596511
DIANA DAROWSKI ET AL: "Combining the best of two worlds: highly flexible chimeric antigen receptor adaptor molecules (CAR-adaptors) for the recruitment of chimeric antigen receptor T cells", MABS, vol. 11, no. 4, 17 April 2019 (2019-04-17), US, pages 621 - 631, XP055688147, ISSN: 1942-0862, DOI: 10.1080/19420862.2019.1596511 *
FEDOROV VDTHEMELI MSADELAIN M: "PD-1- and CTLA-4-based inhibitory chimeric antigen receptors (iCARs) divert off-target immunotherapy responses", SCI. TRANSL. MED., vol. 5, no. 215, 2013, pages 215ra172, XP055210508, DOI: 10.1126/scitranslmed.3006597
FELDMANN AHOFFMANN ABERGMANN RKORISTKA SBERNDT NARNDT CRODRIGUES LOUREIRO LKITTEL-BOSELLI EMITWASI NKEGLER A: "Versatile chimeric antigen receptor platform for controllable and combinatorial T cell therapy", ONCOIMMUNOLOGY, vol. 9, no. 1, 2020, pages 1785608, XP055878973, DOI: 10.1080/2162402X.2020.1785608
FELDMANN ANJA ET AL: "Versatile chimeric antigen receptor platform for controllable and combinatorial T cell therapy", ONCOIMMUNOLOGY, vol. 9, no. 1, 1 January 2020 (2020-01-01), XP055878973, DOI: 10.1080/2162402X.2020.1785608 *
FINNEY HMAKBAR ANLAWSON AD: "Activation of resting human primary T cells with chimeric receptors: costimulation from CD28, inducible costimulator, CD134, and CD137 in series with signals from the TCR zeta chain", J. IMMUNOL., vol. 172, no. 1, 2004, pages 104 - 113, XP002605937
FRIGAULT MJLEE JBASIL MCCARPENITO CMOTOHASHI SSCHOLLER JKAWALEKAR OUGUEDAN SMCGETTIGAN SEPOSEY AD JR: "Identification of chimeric antigen receptors that mediate constitutive or inducible proliferation of T cells", CANCER IMMUNOL. RES., vol. 3, no. 4, 2015, pages 356 - 367, XP055271039, DOI: 10.1158/2326-6066.CIR-14-0186
GADE TPHASSEN WSANTOS EGUNSET GSAUDEMONT AGONG MCBRENTJENS RZHONG XSSTEPHAN MSTEFANSKI J: "Targeted elimination of prostate cancer by genetically directed human T lymphocytes", CANCER RES., vol. 65, no. 19, 2005, pages 9080 - 9088, XP002571428, DOI: 10.1158/0008-5472.CAN-05-0436
GONG MCLATOUCHE JBKRAUSE AHESTON WDWBANDER NHSADELAIN M: "Cancer patient T cells genetically targeted to prostate-specific membrane antigen specifically lyse prostate cancer cells and release cytokines in response to prostate-specific membrane antigen", NEOPLASIA, vol. 1, no. 2, 1999, pages 123 - 127, XP055348359, DOI: 10.1038/sj.neo.7900018
GUEDAN SMADAR ACASADO-MEDRANO VSHAW CEWING ALIU FYOUNG RMJUNE CH: "Posey AD (2020) Single residue in CD28-costimulated CAR T cells limits long-term persistence and antitumor durability", J CLIN INVEST, pages 133215
GUEDAN SPOSEY ADSHAW CWING ADA TPATEL PRMCGETTIGAN SECASADO-MEDRANO VKAWALEKAR OUURIBE-HERRANZ M: "Enhancing CAR T cell persistence through ICOS and 41 BB costimulation", JCI INSIGHT., vol. 3, no. 1, 2018, pages 96976
HIJAZI YKLINGER MKRATZER AWU BBAEUERLE PAKUFER PWOLF ANAGORSEN DZHU M: "Pharmacokinetic and Pharmacodynamic Relationship of Blinatumomab in Patients with Non-Hodgkin Lymphoma", CURR CLIN PHARMACOL, vol. 13, no. 1, 2018, pages 55 - 64
HOMBACH AAABKEN H: "Costimulation by chimeric antigen receptors revisited the T cell antitumor response benefits from combined CD28-OX40 signalling", INT. J. CANCER., vol. 129, no. 12, 2011, pages 2935 - 2944, XP055214912, DOI: 10.1002/ijc.25960
HOMBACH ASENT DSCHNEIDER CHEUSER CKOCH DPOHL CSELIGER BABKEN H: "T-cell activation by recombinant receptors: CD28 costimulation is required for interleukin 2 secretion and receptor-mediated T-cell proliferation but does not affect receptor-mediated target cell lysis", CANCER RES., vol. 61, no. 5, 2001, pages 1976 - 1982, XP055472191
HUTT MFARBER-SCHWARZ AUNVERDORBEN FRICHTER FKONTERMANN RE: "Plasma Half-life Extension of Small Recombinant Antibodies by Fusion to Immunoglobulin-binding Domains", J BIOL CHEM., vol. 287, no. 7, 2012, pages 4462 - 4469, XP055272877, DOI: 10.1074/jbc.M111.311522
KAGOYA YTANAKA SGUO TANCZUROWSKI MWANG CHSASO KBUTLER MOMINDEN MDHIRANO N: "A novel chimeric antigen receptor containing a JAK-STAT signaling domain mediates superior antitumor effects", NAT MED., vol. 24, no. 3, 2018, pages 352 - 359, XP055479221, DOI: 10.1038/nm.4478
KERSHAW MHWESTWOOD JAPARKER LLWANG GESHHAR ZMAVROUKAKIS SAWHITE DEWUNDERLICH JRCANEVARI SROGERS-FREEZER L: "A phase I study on adoptive immunotherapy using gene-modified T cells for ovarian cancer", CLIN. CANCER RES., vol. 12, no. 20, 2006, pages 6106 - 6115, XP055887683, DOI: 10.1158/1078-0432.CCR-06-1183
KITTEL-BOSELLI ENRICO ET AL: "Targeting Acute Myeloid Leukemia Using the RevCAR Platform: A Programmable, Switchable and Combinatorial Strategy", CANCERS, vol. 13, no. 19, 24 September 2021 (2021-09-24), pages 4785, XP093002269, DOI: 10.3390/cancers13194785 *
KITTEL-BOSELLI ESOTO KEGLOUREIRO LRHOFFMANN ABERGMANN RARNDT CKORISTKA SMITWASI NKEGLER ABARTSCH T: "Targeting Acute Myeloid Leukemia Using the RevCAR Platform: A Programmable, Switchable and Combinatorial Strategy", CANCERS (BASEL, vol. 13, no. 19, 2021, pages 4785, XP093002269, DOI: 10.3390/cancers13194785
LAMERS CHSLEIJFER SWILLEMSEN RADEBETS RKRUIT WHJGRATAMA JWSTOTER G: "Adoptive immuno-gene therapy of cancer with single chain antibody [scFv(lg)] gene modified T lymphocytes", J. BIOL. REGUL. HOMEOST. AGENTS., vol. 18, no. 2, 2004, pages 134 - 140
M CARTELLIERI ET AL: "Switching CAR T cells on and off: a novel modular platform for retargeting of T cells to AML blasts", BLOOD CANCER JOURNAL, vol. 6, no. 8, 1 August 2016 (2016-08-01), pages e458 - e458, XP055532158, DOI: 10.1038/bcj.2016.61 *
MANI RGOSWAMI SGOPALAKRISHNAN BRAMASWAMY RWASMUTH RTRAN MMO XGORDON ABUCCI DLUCAS DM: "The interleukin-3 receptor CD123 targeted SL-401 mediates potent cytotoxic activity against CD34(+)CD123(+) cells from acute myeloid leukemia/myelodysplastic syndrome patients and healthy donors", HAEMATOLOGICA, vol. 103, no. 8, 2018, pages 1288 - 1297, XP002798130, DOI: 10.3324/haematol.2018.188193
MATSUO YMACLEOD RAUPHOFF CCDREXLER HGNISHIZAKI CKATAYAMA YKIMURA GFUJII NOMOTO EHARADA M: "Two acute monocytic leukemia (AML-M5a) cell lines (MOLM-13 and MOLM-14) with interclonal phenotypic heterogeneity showing MLL-AF9 fusion resulting from an occult chromosome insertion, ins(11;9)(q23;p22p23", LEUKEMIA, vol. 11, no. 9, 1997, pages 1469 - 1477, XP037782764, DOI: 10.1038/sj.leu.2400768
MILONE MCFISH JDCARPENITO CCARROLL RGBINDER GKTEACHEY DSAMANTA MLAKHAL MGLOSS BDANET-DESNOYERS G: "Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo", MOL. THER., vol. 17, no. 8, 2009, pages 1453 - 1464
MORGAN RAYANG JCKITANO MDUDLEY MELAURENCOT CMROSENBERG SA: "Case Report of a Serious Adverse Event Following the Administration of T Cells Transduced With a Chimeric Antigen Receptor Recognizing ERBB2", MOL. THER., vol. 18, 2010, pages 843 - 851, XP055023624, DOI: 10.1038/mt.2010.24
PINTHUS JHWAKS TKAUFMAN-FRANCIS KSCHINDLER DGHARMELIN AKANETY HRAMON JESHHAR Z: "Immuno-gene therapy of established prostate tumors using chimeric receptor-redirected human lymphocytes", CANCER RES., vol. 63, no. 10, 2003, pages 2470 - 2476
QUENTMEIER HMARTELLI MPDIRKS WGBOLLI NLISO AMACLEOD RANICOLETTI IMANNUCCI RPUCCIARINI ABIGERNA B: "Cell line OCI/AML3 bears exon-12 NPM gene mutation-A and cytoplasmic expression of nucleophosmin", LEUKEMIA, vol. 19, no. 10, 2005, pages 1760 - 1767, XP055545505, DOI: 10.1038/sj.leu.2403899
ROSSI JPACZKOWSKI PSHEN YWMORSE KFLYNN BKAISER ANG CGALLATIN KCAIN TFAN R: "Preinfusion polyfunctional anti-CD19 chimeric antigen receptor T cells are associated with clinical outcomes in NHL", BLOOD, vol. 132, no. 8, 2018, pages 804 - 814
SHATROVA ANMITYUSHOVA EVVASSILIEVA 10AKSENOV NDZENIN VVNIKOLSKY NNMARAKHOVA, II: "Time-Dependent Regulation of IL-2R a-Chain (CD25) Expression by TCR Signal Strength and IL-2-Induced STAT5 Signaling in Activated Human Blood T Lymphocytes", PLOS ONE, vol. 11, no. 12, 2016, pages e0167215
SOTILLO EBARRETT DMBLACK K.BAGASHEV AOLDRIDGE DWU GSUSSMAN RLANAUZE CRUELLA MGAZZARA MR: "Convergence of Acquired Mutations and Alternative Splicing of CD19 Enables Resistance to CART-19 Immunotherapy", CANCER DISCOV., vol. 5, 2015, pages 1282 - 1295, XP055376174, DOI: 10.1158/2159-8290.CD-15-1020
TDPFER KCARTELLIERI MMICHEN SWIEDEMUTH RMULLER NLINDEMANN DBACHMANN MFUSSEL MSCHACKERT GTEMME A: "DAP12-based activating chimeric antigen receptor for NK cell tumor immunotherapy", J. IMMUNOL., vol. 194, no. 7, 2015, pages 3201 - 3212, XP055439156, DOI: 10.4049/jimmunol.1400330
TIACCI ESPANHOL-ROSSETO AMARTELLI MPPASQUALUCCI LQUENTMEIER HGROSSMANN VDREXLER HGFALINI B: "The NPM1 wild-type OCI-AML2 and the NPM1-mutated OCI-AML3 cell lines carry DNMT3A mutations", LEUKEMIA, vol. 26, no. 3, 2012, pages 554 - 557, XP037785188, DOI: 10.1038/leu.2011.238
TITOV APETUKHOV ASTALIAROVA AMOTORIN DBULATOV ESHUVALOV OSOOND SMPIACENTINI MMELINO GZARITSKEY A: "The biological basis and clinical symptoms of CART therapy-associated toxicites", CELL DEATH DIS, vol. 9, 2018, pages 897, XP055541213, DOI: 10.1038/s41419-018-0918-x
WANG JJENSEN MLIN YSUI XCHEN ELINDGREN CGTILL BRAUBITSCHEK AFORMAN SJQIAN X: "Optimizing adoptive polyclonal T cell immunotherapy of lymphomas, using a chimeric T cell receptor possessing CD28 and CD137 costimulatory domains", HUM. GENE THER., vol. 18, no. 8, 2007, pages 712 - 725, XP002605938, DOI: 10.1089/HUM.2007.028
ZHANG TLEMOI BASENTMAN CL: "Chimeric NK-receptor-bearing T cells mediate antitumor immunotherapy", BLOOD., vol. 106, no. 5, 2005, pages 1544 - 1551, XP003000079, DOI: 10.1182/blood-2004-11-4365
ZHANG YHUO MZHOU JXIE S: "PKSolver: An add-in program for pharmacokinetic and pharmacodynamic data analysis in Microsoft Excel", COMPUT METHODS PROGRAMS BIOMED., vol. 99, no. 3, 2010, pages 306 - 14, XP027198151
ZHAO YWANG QJYANG SKOCHENDERFER JNZHENG ZZHONG XSADELAIN MESHHAR ZROSENBERG SAMORGAN RA: "A herceptin-based chimeric antigen receptor with modified signaling domains leads to enhanced survival of transduced T lymphocytes and antitumor activity", J. IMMUNOL., vol. 183, no. 9, 2009, pages 5563 - 5574, XP055081967, DOI: 10.4049/jimmunol.0900447

Also Published As

Publication number Publication date
US20250269025A1 (en) 2025-08-28
CN119790072A (zh) 2025-04-08
EP4543922A1 (en) 2025-04-30
JP2025524457A (ja) 2025-07-30
AU2023289687A1 (en) 2025-01-02
CA3258275A1 (en) 2023-12-28

Similar Documents

Publication Publication Date Title
CN108884164B (zh) 用于免疫疗法的经修饰细胞
AU2023288854A1 (en) Engineered human t cells comprising a switchable chimeric antigen cell surface receptor and methods for generating them
US20230183351A1 (en) A targeting module comprising pd-l1 and/or pd-l2 for use in a method for stimulating a chimeric antigen receptor mediated immune response in a mammal
US20250302875A1 (en) TARGETING MODULES AGAINST IL13R-alpha-2 AND/OR HER2 FOR USE IN A METHOD FOR STIMULATING A CHIMERIC ANTIGEN RECEPTOR-MEDIATED IMMUNE RESPONSE IN A MAMMAL
US20250269025A1 (en) Targeting modules against cd123 for use in a method for stimulating a chimeric antigen receptor-mediated immune response in a mammal
EP4296281A1 (en) Targeting modules against cd123 and a tag for use in a method for stimulating a universal chimeric antigen receptor-mediated immune response in a mammal
KR20240034205A (ko) 항EGFRviii 항체, 폴리펩타이드, 상기 폴리펩타이드를 발현하는 세포, 상기 세포를 포함하는 의약 조성물, 상기 세포의 제조 방법 및 상기 폴리펩타이드를 코딩하는 염기서열을 포함하는 폴리뉴클레오티드 또는 벡터
EP4566619A1 (en) Targeting modules against cd19 and cd20 for use in a method for stimulating a reversed chimeric antigen receptor-mediated immune response in a mammal
EP4566620A1 (en) Switchable universal chimeric antigen receptors and their use
EP4342907A1 (en) Switchable chimeric antigen receptors and their use
EP4382119A1 (en) A kit for use in the treatment of hematological cancer
AU2024393901A1 (en) Targeting modules against cd19 and cd20 for use in a method for stimulating a reversed
HK40125822A (en) Targeting modules against cd19 and cd20 for use in a method for stimulating a reversed chimeric antigen receptor-mediated immune response in a mammal
HK40125821A (en) Switchable universal chimeric antigen receptors and their use
WO2024121297A1 (en) A kit for use in the treatment of hematological cancer
JP2025524457A5 (cg-RX-API-DMAC7.html)
HK40068149A (en) Universal chimeric antigen receptor expressing immune cells and method of manufacturing the same and the therapeutic use of the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23741575

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: AU2023289687

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2024575443

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 18878321

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2023289687

Country of ref document: AU

Date of ref document: 20230623

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2023741575

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023741575

Country of ref document: EP

Effective date: 20250123

WWE Wipo information: entry into national phase

Ref document number: 202380060615.0

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 202380060615.0

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2023741575

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 18878321

Country of ref document: US