WO2023245169A1 - Antimicrobial peptide combinations - Google Patents

Antimicrobial peptide combinations Download PDF

Info

Publication number
WO2023245169A1
WO2023245169A1 PCT/US2023/068585 US2023068585W WO2023245169A1 WO 2023245169 A1 WO2023245169 A1 WO 2023245169A1 US 2023068585 W US2023068585 W US 2023068585W WO 2023245169 A1 WO2023245169 A1 WO 2023245169A1
Authority
WO
WIPO (PCT)
Prior art keywords
chelating agent
acid
antimicrobial
peptide
wild
Prior art date
Application number
PCT/US2023/068585
Other languages
French (fr)
Inventor
Lin BAO
Original Assignee
Vestaron Corporation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Vestaron Corporation filed Critical Vestaron Corporation
Publication of WO2023245169A1 publication Critical patent/WO2023245169A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants

Definitions

  • New antimicrobial combinations comprising an antimicrobial peptide (AMP) and a chelating agent; new formulations; new agricultural compositions; and methods of making and using the same for the control of pathogenic microbes are described.
  • AMP antimicrobial peptide
  • Microbial infections e.g., fungal infections
  • microbial infections e.g., fungal infections
  • pathogenic microbes e.g., fungi, bacteria, oomycetes, etc.
  • World- wide international travel has aided in spreading these deleterious microbes to parts of the planet where native plants have evolved no defenses.
  • the present disclosure describes an antimicrobial combination comprising an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
  • AMP antimicrobial peptide
  • an antimicrobial composition comprising the antimicrobial combination and an excipient; wherein the antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
  • AMP antimicrobial peptide
  • the present disclosure describes a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, or an antimicrobial composition comprising an antimicrobial composition comprising the antimicrobial combination and an excipient; wherein the antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, to: the pathogenic microbe, a locus of the pathogenic microbe, a food supply of the pathogenic microbe, a habitat of the pathogenic microbe, or a breeding ground of the pathogenic microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the pathogenic microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the pathogenic microbe;
  • an antimicrobial composition comprising: a wild-type nodule-specific cysteine-rich 13 peptide (WT-NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
  • WT-NCR13 wild-type nodule-specific cysteine-rich 13 peptide
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000016287% w/w to about 0.010863% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
  • PvDl SEQ ID NO: 19629
  • EDTA an agriculturally acceptable salt thereof
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.000034157% w/w to about 0.0075653% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
  • PvD1a SEQ ID NO: 19630
  • EDTA an agriculturally acceptable salt thereof
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00023018% w/w to about 0.0093402% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
  • Dm-AMP1a SEQ ID NO: 19631
  • EDTA EDTA
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
  • the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.000030081% w/w to about 0.0014937% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
  • SPE10a SEQ ID NO: 19633
  • EDTA an agriculturally acceptable salt thereof
  • an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013667% w/w to about 0.0092686% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
  • So-D2 SEQ ID NO: 19634
  • EDTA an agriculturally acceptable salt thereof
  • FIG. 1 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 at 48 hours.
  • the amount of WT- NCR13 required to achieve IC 50 in K. lactis cells was 304 ppm.
  • YCT306 K. lactis.
  • FIG. 2 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with EDTA at 48 hours.
  • the amount of EDTA required to achieve IC 50 in K. lactis cells was 26 ⁇ M.
  • YCT306 K. lactis.
  • FIG. 3 depicts a dose response curve showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 and 7 ⁇ M EDTA for 48 hours.
  • YCT306 K. lactis.
  • FIG. 4 depicts a dose response curve showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 and 10 ⁇ M EDTA for 48 hours.
  • YCT306 K. lactis.
  • FIG. 5 depicts an isobologram showing the effect of WT-NCR13 and EDTA on K. lactis (YCT306).
  • YCT306 K. lactis
  • synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
  • FIG. 6 depicts a graph showing the growth of M.fructicola as measured via relative OD600 (%), when treated with WT-NCR13 at 72 hours at room temperature.
  • the amount of WT-NCR13 required to achieve IC 50 in M. fructicola cells was 2.24 ppm.
  • FIG. 7 depicts a graph showing the growth of M.fructicola as measured via relative OD600 (%), when treated with EDTA at 72 hours at room temperature.
  • the amount of EDTA required to achieve IC 50 in M. fructicola cells was 6.53 ⁇ M.
  • FIG. 8 depicts a dose response curve showing the growth of M. fructicola as measured via relative OD600 (%), when treated with WT-NCR13 and 3 ⁇ M EDTA for 72 hours.
  • FIG. 9 depicts a dose response curve showing the growth of M. fructicola as measured via relative OD600 (%), when treated with WT-NCR13 and 5 ⁇ M EDTA for 48 hours.
  • FIG. 10 depicts an isobologram showing the effect of WT-NCR13 and EDTA on M. fructicola cells.
  • the amount of WT-NCR13 required to achieve IC 50 was 0.4 ppm (with 28.2% inhibition of growth caused by EDTA).
  • the amount of WT-NCR13 required to achieve IC 50 was 0.24 ppm (with 43.2% inhibition of growth caused by EDTA). Accordingly, these results suggest a synergistic effect.
  • synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
  • FIG. 11 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 at 72 hours at room temperature.
  • the amount of WT-NCR13 required to achieve IC 50 in B. cinerea cells was 2.17 ppm.
  • FIG. 12 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with EDTA at 72 hours at room temperature.
  • the amount of EDTA required to achieve IC 50 in B. cinerea cells was 4.78 ⁇ M.
  • FIG. 13 depicts a dose response curve showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 and 3 ⁇ M EDTA for 72 hours.
  • FIG. 14 depicts a dose response curve showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 and 5 ⁇ M EDTA for 48 hours.
  • FIG. 15 depicts an isobologram showing the effect of WT-NCR13 and EDTA on B. cinerea cells.
  • the amount of WT-NCR13 required to achieve IC 50 was 0.56 ppm (with 22.1% inhibition of growth caused by EDTA).
  • the amount of WT-NCR13 required to achieve IC 50 was 0.17 ppm (with 55.2% inhibition of growth caused by EDTA).
  • FIG. 16 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Botrytis cinerea cells was 4.4611 ⁇ M.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 17 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 18 depicts an isobologram showing the effect of native PVD1 and EDTA on B. cinerea cells.
  • FIG. 19 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Monilinia fructicola cells was 5.8344 ⁇ M.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 20 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
  • the amount of PVD1 required to achieve IC 50 in Monilinia fructicola cells was 0.93984 ppm.
  • FIG. 21 depicts an isobologram showing the effect of native PVD1 and EDTA on Monilinia fructicola cells.
  • FIG. 22 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Phytophthora infestans cells was 14.584 ppm.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 23 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with native PVD1 , and as measured via relative OD600 (%) after 96 hours.
  • the amount of PVD1 required to achieve IC 50 in Phytophthora infestans cells was 152.5 ppm.
  • FIG. 24 depicts an isobologram showing the effect of native PVD1 and EDTA on Phytophthora infestans cells.
  • FIG. 25 depicts a dose-response curve showing the growth of Cercospora sojina when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Cercospora sojina cells was 93.491 ppm.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 26 depicts a dose-response curve showing the growth of Cercospora sojina when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
  • the amount of PVD1 required to achieve IC 50 in Cercospora sojina cells was 302.82 ppm.
  • FIG. 27 depicts an isobologram showing the effect of native PVD1 and EDTA on Cercospora sojina cells.
  • FIG. 28 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Fusarium graminearum cells was 54.782 ppm.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 29 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
  • the amount of PVD1 required to achieve IC 50 in Fusarium graminearum cells was 17.35 ppm.
  • FIG. 30 depicts an isobologram showing the effect of native PVD1 and EDTA on Fusarium graminearum cells.
  • FIG. 31 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the amount of EDTA required to achieve IC 50 in Aspergillus niger cells was 21.184 ppm.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 32 depicts a dose-response curve showing the growth of Aspergillus niger when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
  • the amount of PVD1 required to achieve IC 50 in Aspergillus niger cells was 1.6602 ppm.
  • FIG. 33 depicts an isobologram showing the effect of native PVD1 and EDTA on Aspergillus niger cells.
  • FIG. 34 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 35 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 36 depicts an isobologram showing the effect of PVDla and EDTA on B. cinerea cells.
  • FIG. 37 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 38 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 39 depicts an isobologram showing the effect of PVDla and EDTA on Monilinia fructicola cells.
  • FIG. 40 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 41 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 42 depicts an isobologram showing the effect of PVDla and EDTA on Phytophthora infestans cells.
  • FIG. 43 depicts a dose-response curve showing the growth of Cercospora sojina when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC 50 but having some level of effective inhibition on microbial growth.
  • the box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
  • FIG. 43 depicts a dose-response curve showing the growth of Cercospora sojina when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC 50 as determined in the dose response curve; this estimation in turn helps to determine the
  • FIG. 44 depicts a dose-response curve showing the growth of Cercospora sojina when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 45 depicts an isobologram showing the effect of PVDla and EDTA on Cercospora sojina cells.
  • FIG. 46 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 47 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 48 depicts an isobologram showing the effect of PVDla and EDTA on Fusarium graminearum cells.
  • FIG. 49 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 50 depicts a dose-response curve showing the growth of Aspergillus niger when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 51 depicts an isobologram showing the effect of PVDla and EDTA on Aspergillus niger cells.
  • FIG. 52 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 53 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with Dm-AMP1a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 54 depicts an isobologram showing the effect of Dm-AMP1a and EDTA on B. cinerea cells.
  • FIG. 55 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 56 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with Dm-AMP1a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 57 depicts an isobologram showing the effect of Dm-AMP1a and EDTA on Monilinia fructicola cells.
  • FIG. 58 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 59 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 60 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on B. cinerea cells.
  • FIG. 61 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 62 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 63 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on Monilinia fructicola cells.
  • FIG. 64 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 65 depicts a dose-response curve showing the growth of Aspergillus niger when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 66 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on Aspergillus niger cells.
  • FIG. 67 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 68 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 69 depicts an isobologram showing the effect of SPE10a and EDTA on B. cinerea cells.
  • FIG. 70 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 71 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 72 depicts an isobologram showing the effect of SPE10a and EDTA on
  • FIG. 73 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 74 depicts a dose-response curve showing the growth of Aspergillus niger when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 75 depicts an isobologram showing the effect of SPE10a and EDTA on
  • FIG. 76 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 77 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 78 depicts an isobologram showing the effect of So-D2 and EDTA on B. cinerea cells.
  • FIG. 79 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 80 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 81 depicts an isobologram showing the effect of So-D2 and EDTA on Monilinia fructicola cells.
  • FIG. 82 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours.
  • the box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
  • FIG. 83 depicts a dose-response curve showing the growth of Aspergillus niger when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
  • FIG. 84 depicts an isobologram showing the effect of So-D2 and EDTA on
  • 5’ -end and “3 ’-end” refers to the directionality, i.e., the end-to-end orientation of a nucleotide polymer (e.g., DNA).
  • the 5 ’-end of a polynucleotide is the end of the polynucleotide that has the fifth carbon.
  • Affect refers to how a something influences another thing, e.g., how a peptide, polypeptide, protein, drug, or chemical influences a microbe.
  • Agent refers to one or more chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms and agents produced therefrom, or eukaryote organisms and agents produced therefrom.
  • Agriculturally acceptable salt is synonymous with pharmaceutically acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
  • Agriculturally-acceptable carrier covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in agricultural formulation technology; these are well known to those skilled in agricultural formulations.
  • Agriculturally acceptable salt is used herein synonymously with the term “pharmaceutically acceptable salt.”
  • “Alignment” refers to a method of comparing two or more sequences (e.g., nucleotide, polynucleotide, amino acid, peptide, polypeptide, or protein sequences) for the purpose of determining their relationship to each other. Alignments are typically performed by computer programs that apply various algorithms, however, it is also possible to perform an alignment by hand. Alignment programs typically iterate through potential alignments of sequences and score the alignments using substitution tables, employing a variety of strategies to reach a potential optimal alignment score. Commonly-used alignment algorithms include, but are not limited to, CLUSTALW (see Thompson J. D., Higgins D. G., Gibson T.
  • Exemplary programs that implement one or more of the foregoing algorithms include, but are not limited to, MegAlign from DNAStar (DNAStar, Inc. 3801 Regent St. Madison, Wis. 53705), MUSCLE, T-Coffee, CLUSTALX, CLUSTALV, JalView, Phylip, and Discovery Studio from Accelrys (Accelrys, Inc., 10188 Telesis Ct, Suite 100, San Diego, Calif. 92121).
  • an alignment will introduce “phase shifts” and/or “gaps” into one or both of the sequences being compared in order to maximize the similarity between the two sequences, and scoring refers to the process of quantitatively expressing the relatedness of the aligned sequences.
  • “Ameliorate” or “amelioration” includes the arrest, prevention, decrease, or improvement in one or more the symptoms, signs, and features of the disease being treated, both temporary and long-term.
  • antimicrobial is generally used to refer to the ability of a combination or composition of the present disclosure, to increase mortality or inhibit growth rate of microbes.
  • Antimicrobial activity means that upon or after exposing the microbe to the combinations or compositions of the present disclosure, the microbe either dies, stops, or slows its cellular processes; stops or slows its maintenance; stops or slows its growth; fails to reproduce; and the like.
  • Antimicrobial effect refers to inhibition or stoppage of the normal metabolic processes required for continued life, or continued growth of a microbe. “Antimicrobial effect” includes killing of any individual or group of microbes.
  • Antimicrobial combination or “combination” or “combination of the present disclosure” refers to the result of combining two or more separate components (e.g., a first component and one or more additional components); wherein the combination of the two or more separate components has antimicrobial effect.
  • a “combination” refers to an association of two or more separate components, e.g., the association of an antimicrobial peptide (AMP) and a chelating agent (e.g., EDTA).
  • AMP antimicrobial peptide
  • EDTA chelating agent
  • a combination can be a “mixture.”
  • a mixture refers to a combination of a first component, and one or more additional components, wherein the first component and the one or more additional components are present together in a single entity (e.g., a single unit).
  • a mixture can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components are present in admixture for simultaneous administration.
  • a combination can refer to the association of an AMP and a chelating agent; wherein the AMP and the chelating agent are present in a single entity (e.g., an admixture for simultaneous administration).
  • a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components, are present separately (e.g., more than one unit).
  • a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components may be administered separately, sequentially, simultaneously, concurrently or chronologically staggered.
  • a combination can refer to the association of an AMP and a chelating agent; and wherein the AMP and the chelating agent are present separately (e.g., different units for separate, sequential, simultaneous, concurrent or chronologically- staggered administration) .
  • a combination can refer to the separate, sequential, simultaneous, concurrent or chronologically-staggered application of two or more separate components (e.g., an AMP and a chelating agent).
  • two or more separate components e.g., an AMP and a chelating agent.
  • a “combination” refers to the result of a simultaneous application of both an AMP and a chelating agent.
  • a “combination” refers to the result of a separate application of an AMP and a chelating agent.
  • a “combination” refers to the result of a sequential application of two or more separate components, e.g., a first application an AMP, followed by a second application of a chelating agent, or vice versa. Where the application is sequential or separate, the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • Antimicrobial composition refers to a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient.
  • an antimicrobial composition is distinct from an antimicrobial combination because the former further comprises one or more excipients.
  • Antimicrobially-effective amount refers to an amount of (1) an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or (2) an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; that is sufficient to: inhibit a microbe, bring about the death of at least one microbe; noticeably reduce or decrease microbe growth, feeding, or normal physiological development; inhibit or decrease the normal microbe cellular processes, including maintenance and growth; and/or attenuate or decrease the severity of a microbial infection.
  • Antimicrobially-effective amounts can be measured by use of assays that measure the reduction in growth or decline in their populations of a microbe.
  • One measure of reduction can be to express the decrease in population in logarithmic scale typical of a specific microbial species. That is, a 1 log reduction is equivalent to a 90% reduction versus a control, a 2 log reduction is a 99% reduction, etc.
  • Antimicrobial peptide or “AMP” or “peptide of the present disclosure” refers to any of the peptides described herein that exert an antimicrobial effect against one or more pathogenic microbes.
  • an antimicrobial peptide can be a wild-type peptide, or a mutant peptide.
  • an antimicrobial combination can comprise a wild-type antimicrobial peptide . . . .”
  • an AMP can be a peptide having: (i) a size of about 10 kDa or less; (ii) a cationic charge, often ranging from +2 to +7 at pH 7; and (iii) amphipathic stereogeometry, conferring relatively polarized hydrophilic and hydrophobic facets.
  • an AMP can be an NCR peptide or a defensin.
  • an AMP of the present disclosure can be a wild-type antimicrobial peptide, e.g., a wild-type NCR peptide or defensin.
  • Exemplary wild-type antimicrobial peptides are provide SEQ ID NOs: 1-19628, or 19634.
  • an AMP can be a plant defensin.
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif.
  • an AMP can be a plant defensin having one or more disulfide bonds.
  • an AMP can be a peptide having a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C- terminus of a linear amino acid sequence).
  • an AMP can be a peptide having 3 or 4 disulfide bonds, hi some embodiments, an AMP can be a peptide having a disulfide bond connectivity pattern wherein the disulfide bonds are formed between cysteine residues at the following positions: 1-8, 2-5, 3-6, 4-7.
  • an AMP can have a “gamma core” motif.
  • gamma core refers to a conserved GXC-C or GXC motif having two antiparallel ⁇ -sheets, with an interposed short turn region, and the following characteristics: (1) net cationic charge (+0.5 to +7) with basic residues typically polarized along its axis; (2) periodic charge and hydrophobicity yielding amphipathic stereogeometry; and (3) participation in one to four disulfide bonds.
  • this motif may constitute the entire peptide, or it may link to adjacent structural domains.
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); and 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7.
  • CS cysteine- stabilized
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7; and a “gamma core” motif.
  • CS cysteine- stabilized
  • an antimicrobial peptide of the present disclosure can be a mutant or variant of a wild-type antimicrobial peptide.
  • an AMP comprises a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), relative to a wild-type or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
  • an AMP comprises an alteration, variation, or modification that can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition), in a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, relative to the wildtype or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
  • an AMP can be a mutant peptide having an amino acid sequence as set forth in any one of SEQ ID NOs: 19630-19633.
  • an AMP can be selected from any one of: PvD1a (SEQ ID NO: 19630); Dm- AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); or SPE10a (SEQ ID NO: 19633).
  • an AMP can be any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • the term “antimicrobial peptide” can refer to an isolated peptide.
  • antimicrobial peptide can refer to the peptide and fermentation beer, i.e., fermentation beer comprising the antimicrobial peptide.
  • fermentation beer refers to spent fermentation medium, i.e., fermentation medium supernatant after removal of organisms, that has been inoculated with and consumed by a transformed host cell (e.g., a recombinant cell operable to express an AMP of the present disclosure), hi some embodiments, fermentation beer refers to the solution that is recovered following the fermentation of the transformed host cell.
  • fermentation refers broadly to the enzymatic and anaerobic or aerobic breakdown of organic substances (e.g., a carbon substrate) nutrient substances by microorganisms under controlled conditions (e.g., temperature, oxygen, pH, nutrients, and the like) to produce fermentation products (e.g., one or more peptides of the present disclosure). While fermentation typically describes processes that occur under anaerobic conditions, as used herein it is not intended that the term be solely limited to strict anaerobic conditions, as the term “fermentation” used herein may also occur processes that occur in the presence of oxygen.
  • Agriculturally-acceptable carrier covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in agricultural formulation technology; these are well known to those skilled in such formulations.
  • Agriculturally acceptable salt is synonymous with pharmaceutically acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
  • applying means to dispense and/or otherwise provide, and refers to any method of application or route of administration.
  • applying can refer to, e.g., application of combination of an AMP or an agriculturally acceptable salt thereof, and a chelating agent; as a combination, a mixture, or a composition further comprising one or more excipients, e.g., a sprayable composition, a foam; a burning formulation; a fabric treatment; a surfacetreatment; a dispersant; a microencapsulation, and the like.
  • co-application or “coadminister” it is meant that a combination or composition described herein is applied or administered at the same time, just prior to, or just after the application of: an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and optionally, one or more additional agents or excipients, also referred to herein as a “additional agent.”
  • the antimicrobial peptide of the present disclosure, and chelating agents of the present disclosure can be administered alone or can be co-administered to the locus of a microbe.
  • Coapplication or co-administration is meant to include simultaneous or sequential application.
  • “bp” or “base pair” refers to a molecule comprising two chemical bases bonded to one another.
  • a DNA molecule consists of two winding strands, wherein each strand has a backbone made of an alternating deoxyribose and phosphate groups. Attached to each deoxyribose is one of four bases, i.e., adenine (A), cytosine (C), guanine (G), or thymine (T), wherein adenine forms a base pair with thymine, and cytosine forms a base pair with guanine.
  • A adenine
  • C cytosine
  • G guanine
  • T thymine
  • C-terminus or “C-terminal” refers to the free carboxyl group (i.e., -COOH) that is positioned on the terminal end of a polypeptide.
  • “Chelating agent” or “chelator” or “chelants” or “complexing agents” or “sequestering agents” refer to any agent that binds to a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation — thereby forming a metal complex known as a “chelate.”
  • the term “chelate” includes a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation.
  • the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p-block metal.
  • “Complementary” refers to the topological compatibility or matching together of interacting surfaces of two polynucleotides as understood by those of skill in the art. Thus, two sequences are “complementary” to one another if they are capable of hybridizing to one another to form a stable anti-parallel, double-stranded nucleic acid structure.
  • a first polynucleotide is complementary to a second polynucleotide if the nucleotide sequence of the first polynucleotide is substantially identical to the nucleotide sequence of the polynucleotide binding partner of the second polynucleotide, or if the first polynucleotide can hybridize to the second polynucleotide under stringent hybridization conditions.
  • the polynucleotide whose sequence 5’-TATAC-3’ is complementary to a polynucleotide whose sequence is 5’- GTATA-3’.
  • Constant amino acid substitutions refer to amino acid substitutions that take place within the full-length amino acid sequence of a protein, and not outside of the full- length sequence.
  • the term “conservative amino acid substitutions” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • polar, negatively charged residues and their amides e.g., aspartic acid, asparagine, glutamic, acid, glutamine
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • small aliphatic, nonpolar or slightly polar residues e.g., Alanine, serine, threonine, proline, glycine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • large aliphatic, nonpolar residues e.g., methionine, leucine, isoleucine, va
  • amino acid substitutions may be made in nonconserved regions that retain function. In general, such substitutions would not be made for conserved amino acid residues or for amino acid residues residing within a conserved motif, where such residues are essential for protein activity. Examples of residues that are conserved and that may be essential for protein activity include, for example, residues that are identical between all proteins contained in an alignment of similar or related toxins to the sequences of the embodiments (e.g., residues that are identical in an alignment of homologs).
  • residues that are conserved but that may allow conservative amino acid substitutions and still retain activity include, for example, residues that have only conservative substitutions between all proteins contained in an alignment of similar or related toxins to the sequences of the embodiments (e.g., residues that have only conservative substitutions between all proteins contained in the alignment of the homologs).
  • residues that have only conservative substitutions between all proteins contained in an alignment of similar or related toxins to the sequences of the embodiments e.g., residues that have only conservative substitutions between all proteins contained in the alignment of the homologs.
  • residues that have only conservative substitutions between all proteins contained in the alignment of the homologs e.g., residues that have only conservative substitutions between all proteins contained in the alignment of the homologs.
  • functional variants may have minor conserved or nonconserved alterations in the conserved residues.
  • the hydropathic index of amino acids may be considered.
  • the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, (1982) J Mol Biol. 157(l):105-32). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
  • amino acids may be substituted by other amino acids having a similar hydropathic index or score and still result in a protein with similar biological activity, i.e., still obtain a biological functionally equivalent protein.
  • Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, ibid).
  • the substitution of amino acids whose hydropathic indices are within +2 is preferred, those which are within +1 are particularly preferred, and those within +0.5 are even more particularly preferred.
  • hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0.+0.1); glutamate (+3.0.+0.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5.+0.1); alanine (-0.5); histidine (-0.5); cysteine (- 1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
  • “Culture” or “cell culture” refers to the maintenance of cells in an artificial, in vitro environment.
  • “Culturing” refers to the propagation of organisms on or in various kinds of media.
  • the term “culturing” can mean growing a population of cells under suitable conditions in a liquid or solid medium, hi some embodiments, culturing refers to fermentative recombinant production of a peptide of the present disclosure (e.g., a NCR13 peptide, a defensin, etc.) and/or other desired end products (typically in a vessel or reactor).
  • “Cystine” refers to an oxidized cysteine-dimer. Cystines are sulfur-containing amino acids obtained via the oxidation of two cysteine molecules, and are linked with a disulfide bond.
  • Defensin or “defensin peptide” refers to a peptide belonging to the defensin family, which is a large family of cationic, cysteine-rich antimicrobial peptides found in vertebrate and invertebrate animals, plants, and fungi. Defensins are host defense peptides, with members displaying either direct antimicrobial activity, immune signaling activities, or both. Exemplary defensins are provided herein, having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19634
  • “Disulfide bond” or “disulfide bridge” refers to a covalent bond between two cysteine residues derived by the coupling of two thiol groups on their side chains.
  • a disulfide bond occurs via the oxidative folding of two different thiol groups (-SH) present in a polypeptide
  • a polypeptide can comprise four, six, or eight different thiol groups (i.e., four, six, or eight cysteine residues each containing a thiol group); thus, in some embodiments, a polypeptide can form two, three, or more intramolecular disulfide bonds.
  • Disulfide bond scaffold refers to the to the three-dimensional spatial arrangement of disulfide bonds that is shared between two or more proteins (disulfide bond structural motif), and subunits shared between two or more proteins.
  • Disulfide bond structural motif refers to the three-dimensional spatial arrangement of disulfide bonds that is shared between two or more proteins.
  • DNA refers to deoxyribonucleic acid, comprising a polymer of one or more deoxyribonucleotides or nucleotides (i.e., adenine [A], guanine [G], thymine [T], or cytosine [C]), which can be arranged in single-stranded or double-stranded form.
  • deoxyribonucleic acid comprising a polymer of one or more deoxyribonucleotides or nucleotides (i.e., adenine [A], guanine [G], thymine [T], or cytosine [C]), which can be arranged in single-stranded or double-stranded form.
  • nucleotides i.e., adenine [A], guanine [G], thymine [T], or cytosine [C]
  • one or more nucleotides creates a polynucleotide.
  • Excipient refers to any agriculturally acceptable additive, carrier, surfactant, emulsifier, thickener, preservative, solvent, disintegrant, glidant, lubricant, diluent, filler, bulking agent, binder, emollient, stiffening agent, stabilizer, solubilizing agents, dispersing agent, suspending agent, antioxidant, antiseptic, wetting agent, humectant, fragrant, suspending agents, pigments, colorants, isotonic agents, viscosity enhancing agents, mucoadhesive agents, and/or any combination thereof, that can be added to a composition, preparation, and/or formulation, which may be useful in achieving a desired modification to the characteristics of the composition, preparation, and/or formulation.
  • excipients can be formulated alongside a combination of a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, when preparing an antimicrobial composition, e.g., for the purpose of bulking up compositions (thus often referred to as bulking agents, fillers or diluents).
  • an excipient can be used to provide stability, or prevent contamination (e.g., microbial contamination).
  • an excipient can be used to confer a physical property to a composition (e.g., a composition that is a dry granular, or dry flowable powder physical form).
  • a composition e.g., a composition that is a dry granular, or dry flowable powder physical form.
  • Reference to an excipient includes both one and more than one such excipients. Suitable excipients are described in Remington's Pharmaceutical Sciences, by E. W. Martin, the disclosure of which is incorporated herein by reference in its entirety.
  • IC 50 refers to half-maximal inhibitory concentration, which is a measurement of how much of an agent is needed to inhibit a biological process by half, thus providing a measure of potency of said agent.
  • Identity refers to a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing said sequences.
  • identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences.
  • Identity and similarity can be readily calculated by any one of the myriad methods known to those having ordinary skill in the art, including but not limited to those described in: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.
  • methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990).
  • the BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990), the disclosures of which are incorporated herein by reference in their entireties.
  • “Inhibiting” or “inhibit” or “combating” or “combat” or “controlling” or “control,” or any variation of these terms refers to making something (e.g., the number of microbes, the functions and/or activities of the microbes, and/or the deleterious effect of the microbe on a plant or animal susceptible to attack thereof) less in size, amount, intensity, or degree.
  • the application of an antimicrobially-effective amount of antimicrobial combination comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent, to (i) the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; (ii) a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; (iii) an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or (iv) a combination thereof, results in the following effect: a decrease in the number of microbes; an increase in the susceptibility of the microbe to one or more antimicrobial agents; and/or inhibition or impairment of one or more of the microbe’ s activities, such as any physiological function required for normal physiological maintenance and/or survival and/or reproduction
  • vital building blocks e.g. nucleic acids, amino acids, biochemical metabolites
  • growth, reproduction, and/or any other parameter that is essential to the microbe’s survival and/or reproduction relative to the number of microbes or activities thereof that had not been exposed to a antimicrobially- effective amount of an antimicrobial combination comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent.
  • combating, controlling, or inhibiting a microbe includes any measurable decrease or complete inhibition to achieve a desired result.
  • About as used herein means within ⁇ 10%, preferably ⁇ 5% of a given value.
  • combating, controlling, or inhibiting a microbe includes any measurable increase in susceptibility of a microbe to one or more antimicrobial agents to achieve a desired result.
  • About as used herein means within ⁇ 10%, preferably ⁇ 5% of a given value, for example the value: 2, contemplates a range from 1.8 to 2.2, or a range from 2.1 to 1.9 and all values and integers therebetween.
  • the terms “inhibiting” or “combating, controlling, or inhibiting a microbe,” refers to: a decrease in the number of microbes; an increase in the susceptibility of the microbe to one or more antimicrobial agents; and/or inhibition or impairment of one or more of the microbe’ s activities or functions, such as any physiological function required for normal physiological maintenance and/or survival and/or reproduction (e.g. respiration, membrane integrity, energy utilization, synthesis of vital building blocks e.g.
  • an antimicrobially-effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide is applied to (i) the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; (ii) a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; (iii) an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or (iv) a combination thereof, that is at least about 0.1%, at least about 0.2%, at least about 0.3%, at least about 0.4%, at least about 0.5%, at least about 0.6%, at least about 0.7%, at least about 0.8%, at least about 0.9%, at
  • in vivo refers to the natural environment (e.g., an animal or a cell) and to processes or reactions that occur within a natural environment.
  • isolated refers to separating a thing and/or a component from its natural environment, e.g., a wild-type antimicrobial peptide (such as a WT NCR13 peptide) isolated from an organism means that peptide is separated from its natural environment.
  • a wild-type antimicrobial peptide such as a WT NCR13 peptide
  • kb refers to kilobase, i.e., 1000 bases.
  • the term “kb” means a length of nucleic acid molecules.
  • 1 kb refers to a nucleic acid molecule that is 1000 nucleotides long.
  • a length of double- stranded DNA that is 1 kb long contains two thousand nucleotides (i.e., one thousand on each strand).
  • a length of singlestranded RNA that is 1 kb long contains one thousand nucleotides.
  • KDa refers to kilodalton, a unit equaling 1,000 daltons; a “Dalton” is a unit of molecular weight (MW).
  • Knockdown dose 50 or “KD 50 ” refers to the median dose required to cause paralysis or cessation of movement in 50% of a population.
  • LC 50 or “lethal concentration 50%” refers to the concentration of an agent required to kill 50% of a population.
  • “Locus of a microbe” refers to the habitat of a microbe; food supply of a microbe; breeding ground of a microbe; area inhabited or colonized by a microbe; material infested, eaten, or used by a microbe; and/or any environment in which a microbe inhabits, uses, is present in, or is expected to be.
  • the locus of a microbe includes, without limitation, a microbe habitat; a microbe food supply; a microbe breeding ground; a microbe area; a microbe environment; any surface or location that may be frequented and/or infested by a microbe; any plant or animal, or a locus of a plant or animal, susceptible to attack by a microbe; and/or any surface or location where a microbe may be found, may be expected to be found, or is likely to be attacked by a microbe.
  • “Medium” refers to a nutritive solution for culturing cells in cell culture.
  • Metal ion refers to an atom or compound that has an electric charge.
  • metal ions are cations, e.g., a positively charged ion, and can be represented as M z+ , where z is the electrical charge.
  • Metal ions may be dissolved in water, can be referred to as “metal ion in aqueous solution” or “aqua ion,” and may be represented by the formula [M(H20) n ] z+ , where n is the solvation number and z is the electrical charge.
  • Metal-ion chelating agent refers to a chelating agent operable to chelate a metal ion, e.g., a chelating agent operable to chelate one of the following metal ions: Al 3+ ; Ag + ; AS 3+ ; AU + ; AU 3+ ; Ba 2+ ; Be 2+ ; Ca 2+ ; Cd 2+ ; Co 2+ ; Co 3+ ; Cr 2+ ; Cr 3+ ; Cs + ; Cu + ; Cu 2+ ; Fe 2+ ; Fe 3+ ; Ga 3+ ; Hg 2+ ; Hg2 2+ ; In 3+ ; K + ; Li + ; Mg 2+ ; Mn 2+ ; Na + ; Ni 2+ ; Pb 2+ ; Pb ++ , Sn 2+ ; Sn ++ ; Sr 2+ ; and/or Zn 2+ .
  • “Microbe” refers to any microscopic organism, e.g., any multi-cellular or unicellular microorganism, or a virus, including all of the prokaryotes, namely the eubacteria and archaeabacteria, and various forms of eukaryote, comprising the protozoa, fungi (e.g., yeast).
  • “microbe” refers to all bacteria, all archaea, unicellular protista, unicellular animals, unicellular plants, unicellular fungi, unicellular algae, all protozoa, and all chromista.
  • a microbe can be a pathogenic microbe, wherein the microbe causes an infection or disease in a living organism when introduced into said organism; or wherein the presence of the microbe is deleterious to the organism.
  • a microbe can be a pathogen to plants, e.g., a phytopathogen, such as a bacterium, a protozoan, or a fungus.
  • MOA refers to mechanism of action.
  • MW refers to the mass or weight of a molecule, and for proteins is typically measured in “daltons (Da)” or kilodaltons (kDa).
  • MW can be calculated using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), gel chromatography, analytical ultracentrifugation, mass spectrometry, or light scattering.
  • SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
  • the SDS-PAGE method is as follows: the sample of interest is separated on a gel with a set of molecular weight standards. The sample is run, and the gel is then processed with a desired stain, followed by destaining for about 2 to 14 hours.
  • the next step is to determine the relative migration distance (Rf) of the standards and protein of interest.
  • the logarithm of the MW can be determined based on the values obtained for the bands in the standard; e.g., in some embodiments, the logarithm of the molecular weight of an SDS- denatured polypeptide and its relative migration distance (Rf) is plotted into a graph. After plotting the graph, interpolating the value derived will provide the molecular weight of the unknown protein band.
  • Motif refers to dominant feature and/or distinct pattern in a molecule; e.g., a distinct pattern of amino acids that operate in a function-specific protein sequence.
  • a motif is a polynucleotide or polypeptide sequence that is implicated in having some biological significance and/or exerts some effect or is involved in some biological process.
  • “Mutant” refers to an organism, DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), which causes said organism and/or sequence to be different from the naturally occurring or wild-type organism, wild-type sequence, and/or reference sequence with which the mutant is being compared, hi some embodiments, this alteration, variation, or modification can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition).
  • the one or more amino acid substitutions or modifications can be conservative; here, such a conservative amino acid substitution and/or modification in a “mutant” does not substantially diminish the activity of the mutant in relation to its non-mutant form.
  • a “mutant” possesses one or more conservative amino acid substitutions when compared to a peptide with a disclosed and/or claimed sequence, as indicated by a SEQ ID NO.
  • “Native” refers to items found in nature in their natural, unmodified state.
  • N-terminus refers to the free amine group (i.e., -NH2) that is positioned on beginning or start of a polypeptide.
  • NCBI refers to the National Center for Biotechnology Information.
  • NCR refers to nodule-specific cysteine-rich.
  • NCR13 or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide.
  • An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987).
  • OD refers to optical density. Typically, OD is measured using a spectrophotometer. When measuring growth over time of a cell population, OD600 is preferable to UV spectroscopy, this is because at a 600 nm wavelength, the cells will not be harmed as they would under too much UV light.
  • OD600nm or “OD 600nm ” refers to optical densities of the liquid sample measured (for example, a microbial cell culture) when measured in a spectrophotometer at 600 nanometers ( nm ).
  • OD660nm or (JD 660nm refers to optical densities of the liquid sample measured (for example, a microbial cell culture) when measured in a spectrophotometer at 660 nanometers (nm ).
  • “Operable” refers to the ability to be used, the ability to do something, and/or the ability to accomplish some function or result.
  • “operable” refers to the ability of a polynucleotide, DNA sequence, RNA sequence, or other nucleotide sequence or gene to encode a peptide, polypeptide, and/or protein.
  • a polynucleotide may be operable to encode a protein, which means that the polynucleotide contains information that imbues it with the ability to create a protein (e.g., by transcribing mRNA, which is in turn translated to protein).
  • a pathogenic microbe refers to any microbe that is deleterious or pathogenic to an organism; e.g., any microbe that causes or exacerbates an infection or disease in a living organism.
  • a pathogenic microbe can be a pathogen to plants, e.g., a phytopathogen, such as a bacterium, a protozoan, or a fungus; in other embodiments, a pathogenic microbe can be a pathogen to animals.
  • a “plant pathogenic microbe” or “plant pathogen” can refer to a microbe that can cause disease into whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same.
  • Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
  • Wild-type NCR13 or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide.
  • An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987). See NCR13 above.
  • “Pharmaceutically acceptable salt” is synonymous with agriculturally acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
  • Plant shall mean whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
  • plant organs e.g., leaves, stems, roots, etc.
  • Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
  • “Plasmid” refers to a DNA segment that acts as a carrier for a gene of interest (e.g., a gene operable to encode a peptide of the present disclosure, such as NCR13) and, when transformed or transfected into an organism, can replicate and express the DNA sequence contained within the plasmid independently of the host organism.
  • a gene of interest e.g., a gene operable to encode a peptide of the present disclosure, such as NCR13
  • Plasmids are a type of vector, and can be “cloning vectors” (i.e., simple plasmids used to clone a DNA fragment and/or select a host population carrying the plasmid via some selection indicator) or “expression plasmids” (i.e., plasmids used to produce large amounts of polynucleotides and/or polypeptides).
  • cloning vectors i.e., simple plasmids used to clone a DNA fragment and/or select a host population carrying the plasmid via some selection indicator
  • expression plasmids i.e., plasmids used to produce large amounts of polynucleotides and/or polypeptides.
  • Polynucleotide refers to a polymeric-form of nucleotides (e.g., ribonucleotides, deoxyribonucleotides, or analogs thereof) of any length; e.g., a sequence of two or more ribonucleotides or deoxyribonucleotides.
  • polynucleotide includes double- and single- stranded DNA, as well as double- and singlestranded RNA; it also includes modified and unmodified forms of a polynucleotide (modifications to and of a polynucleotide, for example, can include methylation, phosphorylation, and/or capping).
  • a polynucleotide can be one of the following: a gene or gene fragment (for example, a probe, primer, EST, or SAGE tag); genomic DNA; genomic DNA fragment; exon; intron; messenger RNA (mRNA); transfer RNA; ribosomal RNA; ribozyme; cDNA; recombinant polynucleotide; branched polynucleotide; plasmid; vector; isolated DNA of any sequence; isolated RNA of any sequence; nucleic acid probe; primer or amplified copy of any of the foregoing.
  • a gene or gene fragment for example, a probe, primer, EST, or SAGE tag
  • genomic DNA for example, genomic DNA fragment; genomic DNA fragment; exon; intron; messenger RNA (mRNA); transfer RNA; ribosomal RNA; ribozyme; cDNA; recombinant polynucleotide; branched polynucleotide; plasmid; vector; isolated DNA of
  • a polynucleotide can refer to a polymeric-form of nucleotides operable to encode the open reading frame of a gene.
  • a polynucleotide can refer to cDNA.
  • polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
  • the structure of a polynucleotide can also be referenced to by its 5’- or 3’- end or terminus, which indicates the directionality of the polynucleotide.
  • Adjacent nucleotides in a single-strand of polynucleotides are typically joined by a phosphodiester bond between their 3’ and 5’ carbons.
  • different internucleotide linkages could also be used, such as linkages that include a methylene, phosphoramidate linkages, etc.
  • polynucleotide also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment that makes or uses a polynucleotide encompasses both the double-stranded form and each of two complementary single- stranded forms known or predicted to make up the double- stranded form.
  • a polynucleotide can include modified nucleotides, such as methylated nucleotides and nucleotide analogs (including nucleotides with nonnatural bases, nucleotides with modified natural bases such as aza- or deaza-purines, etc.). If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
  • a polynucleotide can also be further modified after polymerization, such as by conjugation with a labeling component. Additionally, the sequence of nucleotides in a polynucleotide can be interrupted by non-nucleotide components. One or more ends of the polynucleotide can be protected or otherwise modified to prevent that end from interacting in a particular way (e.g. forming a covalent bond) with other polynucleotides.
  • a polynucleotide can be composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T).
  • Uracil (U) can also be present, for example, as a natural replacement for thymine when the polynucleotide is RNA. Uracil can also be used in DNA.
  • sequence refers to the alphabetical representation of a polynucleotide or any nucleic acid molecule, including natural and non- natural bases.
  • RNA molecule refers to a polynucleotide having a ribose sugar rather than deoxyribose sugar and typically uracil rather than thymine as one of the pyrimidine bases.
  • An RNA molecule of the disclosure is generally single-stranded, but can also be double- stranded.
  • the RNA molecule can include the single-stranded molecules transcribed from DNA in the cell nucleus, mitochondrion or chloroplast, which have a linear sequence of nucleotide bases that is complementary to the DNA strand from which it is transcribed.
  • a polynucleotide can further comprise one or more heterologous regulatory elements.
  • the regulatory element is one or more promoters; enhancers; silencers; operators; splicing signals; polyadenylation signals; termination signals; RNA export elements, internal ribosomal entry sites (IRES); poly-U sequences; or combinations thereof.
  • Protein has the same meaning as “peptide” and/or “polypeptide” in this document.
  • Ratio refers to the quantitative relation between two amounts showing the number of times one value contains or is contained within the other.
  • Recombinant DNA or “rDNA” refers to DNA that is comprised of two or more different DNA segments.
  • Beneficial or desired results can include, but are not limited to, death of at least one microbe; alleviation or amelioration of one or more symptoms or conditions caused by a pathogenic microbe; diminishment of extent of condition, disorder or disease caused by a pathogenic microbe; stabilization of the state of condition, disorder or disease caused by a pathogenic microbe; prevention of development of condition, disorder or disease caused by a pathogenic microbe; prevention of spread of condition, disorder or disease caused by a pathogenic microbe; delay or slowing of condition, disorder or disease progression, delay or slowing of condition, disorder or disease onset caused by a pathogenic microbe; amelioration or palliation of the condition, disorder or disease state, and remission of a disease or disease state caused by a pathogenic microbe; whether partial or total.
  • “treating” can also mean prolonging survival of an organism beyond that expected in the absence of treatment.
  • Treating can also mean inhibiting the progression of the disease or disorder, slowing the progression of disorder or disease temporarily, although in some instances, it involves halting the progression of the disorder or disease permanently.
  • treatment, treat, or treating refers to a method of reducing the effects of one or more symptoms of a disease or condition caused by a pathogenic microbe.
  • treatment can refer to a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the number of pathogenic microbes, and/or the severity of an established disease, condition, or symptom of the disease or condition caused by a pathogenic microbe.
  • variable.” refers to varietas or variety.
  • the term “var.” is used to indicate a taxonomic category that ranks below the species level and/or subspecies (where present). In some embodiments, the term “var.” represents members differing from others of the same subspecies or species in minor but permanent or heritable characteristics.
  • Vector refers to the DNA segment that accepts a foreign gene of interest (e.g., a wild-type antimicrobial peptide of the present disclosure, such as polynucleotide encoding NCR13).
  • a foreign gene of interest e.g., a wild-type antimicrobial peptide of the present disclosure, such as polynucleotide encoding NCR13.
  • the gene of interest is known as an “insert” or “transgene.”
  • Wild type or “WT” refers to the phenotype and/or genotype (i.e., the appearance or sequence) of an organism, polynucleotide sequence, and/or polypeptide sequence, as it is found and/or observed in its naturally occurring state or condition.
  • Wild-type NCR13 or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide.
  • An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987). See NCR13 above.
  • composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e., one or more) of those steps, compositions of matter, groups of steps or group of compositions of matter.
  • Bio antimicrobial agents e.g., antimicrobial agents based on, or derived from, natural sources (such as an organism or product therefrom), may confer crop protection by suppressing disease incidence, and/or reducing the number of pathogenic microbes or the severity of symptoms caused by the same.
  • biological antimicrobial agents represent a desirable replacement of traditional agrochemicals, and can be used to avoid or remediate the adverse effects thereof.
  • the present disclosure provides antimicrobial combinations comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent; agricultural compositions thereof, further comprising an excipient; and methods of making and using the same.
  • Antimicrobial peptide or “AMP” or “peptide of the present disclosure” refers to any of the peptides described herein that exert an antimicrobial effect against one or more pathogenic microbes.
  • an AMP can be a peptide having: (i) a size of about 10 kDa or less; (ii) a cationic charge, often ranging from +2 to +7 at pH 7; and (iii) amphipathic stereogeometry, conferring relatively polarized hydrophilic and hydrophobic facets.
  • an AMP can be an NCR peptide or a defensin.
  • an AMP of the present disclosure can be a wild-type antimicrobial peptide, e.g., a wild-type NCR peptide or defensin.
  • Exemplary wild-type antimicrobial peptides are provide SEQ ID NOs: 1-19628, or 19634.
  • an AMP can be a plant defensin.
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif.
  • an AMP can be a plant defensin having one or more disulfide bonds.
  • an AMP can be a peptide having a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C- terminus of a linear amino acid sequence).
  • an AMP can be a peptide having 3 or 4 disulfide bonds, hi some embodiments, an AMP can be a peptide having a disulfide bond connectivity pattern wherein the disulfide bonds are formed between cysteine residues at the following positions: 1-8, 2-5, 3-6, 4-7.
  • an AMP can have a “gamma core” motif.
  • gamma core refers to a conserved GXC-C or GXC motif having two antiparallel P-sheets, with an interposed short turn region, and the following characteristics: (1) net cationic charge (+0.5 to +7) with basic residues typically polarized along its axis; (2) periodic charge and hydrophobicity yielding amphipathic stereogeometry; and (3) participation in one to four disulfide bonds.
  • this motif may constitute the entire peptide, or it may link to adjacent structural domains.
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); and 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7.
  • CS cysteine- stabilized
  • an AMP can be a plant defensin having a cysteine- stabilized (CS) ⁇ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7; and a “gamma core” motif.
  • CS cysteine- stabilized
  • an antimicrobial peptide of the present disclosure can be a mutant or variant of a wild-type antimicrobial peptide.
  • an AMP comprises a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), relative to a wild-type or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
  • an AMP comprises an alteration, variation, or modification that can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition), in a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, relative to the wildtype or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
  • an AMP can be a mutant peptide having an amino acid sequence as set forth in any one of SEQ ID NOs: 19629-19633.
  • the AMP can be an isolated peptide, e.g., any of the peptides of the present disclosure.
  • an antimicrobial peptide can refer to the fermentation beer, i.e., the spent fermentation medium or fermentation medium supernatant after removal of organisms, wherein said fermentation medium has been inoculated with and consumed by a transformed host cell, e.g., a recombinant cell operable to express an AMP of the present disclosure.
  • fermentation beer refers to the solution that is recovered following the fermentation of the transformed host cell.
  • the term “fermentation” refers broadly to the enzymatic and anaerobic or aerobic breakdown of organic substances (e.g., a carbon substrate) nutrient substances by microorganisms under controlled conditions (e.g., temperature, oxygen, pH, nutrients, and the like) to produce fermentation products (e.g., one or more peptides of the present disclosure). While fermentation typically describes processes that occur under anaerobic conditions, as used herein it is not intended that the term be solely limited to strict anaerobic conditions, as the term “fermentation” used herein may also occur processes that occur in the presence of oxygen.
  • an antimicrobial combination comprises:
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express PvDl (SEQ ID NO: 19629); and
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express PvD1a (SEQ ID NO: 19630), and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express Dm-AMP1a (SEQ ID NO: 19631), and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express Rs-AFP2a (SEQ ID NO: 19632), and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express SPE10a (SEQ ID NO: 19633), and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express So-D2 (SEQ ID NO: 19634), and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express a wild-type NCR peptide, and (2) a chelating agent.
  • an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express a wild-type defensin, and (2) a chelating agent.
  • the antimicrobial peptide of the present disclosure can be a wild-type NCR peptide, a wild-type defensin.
  • legume plants employ a symbiotic relationship with symbiotic nitrogen-fixing bacteria, commonly termed rhizobia, which allows these plants to take up biologically usable nitrogen, which is fixed by the bacteria in exchange for nutrients and carbon resources. Endosymbiotic rhizobia induce changes in the host plant, which results in the formation of a specialized root organ called a nodule. See Roy et al., Symbiotic Outcome Modified by the Diversification from 7 to over 700 Nodule-Specific Cysteine-Rich Peptides. GENES
  • NCR nodule-specific cysteine-rich
  • NCR peptide gene family have been identified in legumes including, but not limited to, Viciafaba, Medicago sativa, Trifolium repens, Galega orientalis, Pisum sativum, Astragalus sinicus, Cicer arietinum and Glycyrrhiza lepidota.
  • NCR peptides have a structure that resembles antimicrobial defensin peptides, which are effectors of innate immunity in plants and animals, including humans. See Kereszt et al., Impact of Plant Peptides on Symbiotic Nodule Development and Functioning. FRONT PLANT SCI. 2018; 9: 1026. And, NCRs have been shown to exhibit antimicrobial activity, e.g., against gram-negative and gram-positive bacteria as well as unicellular and filamentous fungi.
  • Rhizobium-/egwme symbiosis are polyploidy and host peptide-govemed symbiont differentiation general principles of endo symbiosis? FRONT MICROBIOL. 2014; 5: 326; Maroti et al., Natural roles of antimicrobial peptides in microbes, plants and animals. RES MICROBIOL. 2011 May;162(4):363-74.
  • Defensins are a large family of small, cationic, cysteine- and arginine-rich antimicrobial peptides, found in both vertebrates, invertebrates, and plants. Defensins are divided into five groups according to the spacing pattern of cysteines: plant, invertebrate, a-, P-, and 0-defensins. The latter three are mostly found in mammals, a-defensins are proteins found in neutrophils and intestinal epithelia. P-defensins are the most widely distributed and are secreted by leukocytes and epithelial cells of many kinds. 0-defensins have been rarely found so far e.g. in leukocytes of rhesus macaques. Defensins are active against bacteria, fungi and many enveloped and nonenveloped viruses.
  • a defensin can be identified by comparing a candidate amino acid sequence with the hidden markov model profiles (HMM profiles) of the PF AM database by using the freely available HMMER software package.
  • the PFAM defensin families include Defensin_l or "Mammalian defensin” (PFAM accession no. PF00323), Defensin_2 or “Arthropod defensin” (PFAM accession no. PF01097), Defensin_beta or “Beta Defensin” (PFAM accession no.
  • PF0071 1 Defensin_propep or “Defensin propeptide” (PFAM accession no. PF00879), Gamma-thionin or “Gamma-thionins family” or plant defensins (PFAM accession no. PF00304).
  • a defensin of the present disclosure can be a defensing belonging to the alpha-defensin class, the beta-defensin class, the theta-defensin class, the insect or arthropod defensin classes, or the plant defensin class.
  • the amino acid sequence of a defensin according to the invention comprises 4, 6 or 8 cysteine residues, preferably 4 or 6 cysteine residues, more preferably 6 cysteine residues.
  • a wild-type antimicrobial peptide of the present disclosure can be a defensin isolated from Medicago truncatula.
  • a wild-type antimicrobial peptide of the present disclosure can be an MtDef5 defensin
  • Exemplary defensins include, but not limited to, a-defensins (e.g., neutrophil defensin 1, defensin alpha 1, neutrophil defensin 3, neutrophil defensin 4, defensin 5, defensin 6), P-defensins (e.g., beta-defensin 1, beta-defensin 2, beta-defensin 103, beta- defensin 107, beta-defensin 110, beta-defensin 136), and 0-defensins.
  • a-defensins e.g., neutrophil defensin 1, defensin alpha 1, neutrophil defensin 3, neutrophil defensin 4, defensin 5, defensin 6
  • P-defensins e.g., beta-defensin 1, beta-defensin 2, beta-defensin
  • the anti-microbial polypeptide comprises or consists of a cathelicidin (e.g., hCAP18).
  • a cathelicidin e.g., hCAP18
  • plant defensins include, but are not limited to, MsDefl , MtDef2, MtDef4, NaDl, Rs-AFPl, Rs-AFP2, KP4, and KP6.
  • exemplary defensins are provided herein, having an amino acid sequence consisting of SEQ ID NOs: 838-19634.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type NCR peptide.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type defensin peptide.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Viciafaba, Medicago sativa, Trifolium repens, Galega orientalis, Pisum sativum, Astragalus sinicus, Cicer arietinum or Glycyrrhiza lepidota
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Medicago truncatula.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Cicer arietinum.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Medicago truncatula.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a defensin.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide is a wild-type peptide having an amino acid sequence consisting of a sequence as set forth in any one of SEQ ID NOs: 1- 19628.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type NCR peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1-837.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type defensin peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-19628.
  • an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type plant defensin peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-4109.
  • Wild-type antimicrobial peptides can be isolated or derived from organisms using a variety of methods well known to those having ordinary skill in the art.
  • a wild-type NCR peptide of the present disclosure can be isolated from a wild-type organism, e.g., Cicer arietinum (Chickpea) (Garbanzo) or Medicago plants such as Medicago sativa, and M. truncatula. using methods well known in the art.
  • a wild-type antimicrobial peptide of the present disclosure can be recombinantly expressed, or chemically synthesized, likewise using methods well known in the art and/or described herein.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-837.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type plant defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type plant defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-4109.
  • a wild-type NCR peptide of the present disclosure comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in Table 1.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 1-837.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19628.
  • a wild-type antimicrobial peptide of the present disclosure can be a wild-type plant defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-4109.
  • a wild-type NCR peptide of the present disclosure can consist of an amino acid sequence as provided in Table 1.
  • Table 1 Prepropeptide wild-type NCR peptides of the present disclosure.
  • the table below shows wild-type NCR peptides of the present disclosure, in their prepropeptide form (Full length), comprising a putative secretory signal sequence and mature protein (highlighted in bold).
  • a wild-type antimicrobial peptide of the present disclosure comprises a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in Table 2.
  • a wild-type NCR peptide of the present disclosure can consist of an amino acid sequence as provided in Table 2.
  • Table 2 Mature wild-type NCR peptides of the present disclosure.
  • the table below shows the mature wild-type NCR peptides of the present disclosure without the putative secretory signal sequence.
  • an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type NCR peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.
  • an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the wild-type NCR peptide has an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
  • NCR nodule-specific cysteine-rich
  • an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the wild-type NCR peptide is a wild-type NCR13 peptide.
  • NCR nodule-specific cysteine-rich
  • MAKTLKVVYTVILLVSLFLLLIAATKPCQSDKDCKKFACRKPKVPKCINGFCKC VR (SEQ ID NO: 14); here, the full length peptide comprises a putative secretory signal sequence and mature protein (highlighted in bold).
  • an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR13 peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14.
  • an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of: “TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR” (SEQ ID NO: 1).
  • an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
  • an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
  • an antimicrobial combination comprises a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of: TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1).
  • an antimicrobial combination comprises a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence consisting of: TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1).
  • the wild-type antimicrobial peptide sequences of the present disclosure do not comprise any: mutations, amino acid substitutions, and/or amino acid additions outside of the full-length wild-type amino acid sequences as described herein.
  • the wild-type antimicrobial peptide sequences of the present disclosure do not comprise a substitution and/or addition of any one or more amino acids to the N-terminus of any of the wild-type antimicrobial peptide sequences described herein, e.g., any one of SEQ ID NO: N-terminus of any of the wild-type antimicrobial peptide sequences described herein, e.g., any one
  • a wild-type antimicrobial peptide of the present disclosure comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type antimicrobial peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628; wherein the foregoing percent identity is calculated based on the degree of sequence relatedness within the full-length of the polypeptide sequences being compared, and not outside of them.
  • any of the aforementioned wild-type antimicrobial peptides e.g., a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
  • an antimicrobial combination of the present disclosure comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition of the present disclosure, comprising a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and one or more excipients.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • AMP antimicrobial peptide
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19629; wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19630 wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC SEQ ID NO: 19633; wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • a chelating agent wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • conservative amino acid substitutions refers to amino acid substitutions to a molecule that do not affect the functional and/or chemical characteristics of the molecule (i.e., the AMP). Accordingly, conservative amino acid substitutions are generally therefore based on the relative similarity of the amino acid sidechain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary conservative amino acid substitutions are well known to those having ordinary skill in the art. For example, in some embodiments, conservative amino acid substitutions are those in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
  • amino acids with basic side chains e.g., lysine, arginine, histidine
  • acidic side chains e.g., aspartic acid, glutamic acid
  • polar, negatively charged residues and their amides e.g., aspartic acid, asparagine, glutamic, acid, glutamine
  • uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
  • small aliphatic, nonpolar or slightly polar residues e.g., alanine, serine, threonine, proline, glycine
  • nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
  • large aliphatic, nonpolar residues e.g., methionine, leucine, isoleucine
  • a wild-type antimicrobial peptide of the present disclosure can be recombinantly expressed, or chemically synthesized, likewise using methods well known in the art and/or described herein.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-837.
  • a polynucleotide of the present disclosure is operable to encode a wild-type defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-19628.
  • a polynucleotide of the present disclosure is operable to encode a wild-type plant defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type plant defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-4109.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide of the present disclosure comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 1-837.
  • a polynucleotide of the present disclosure is operable to encode a wild-type defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19628.
  • a polynucleotide of the present disclosure is operable to encode a wild-type plant defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-4109.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide consisting of an amino acid sequence as provided in Table 1.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
  • a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide that is a wild-type NCR13 peptide.
  • a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR13 peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14.
  • a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
  • TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR SEQ ID NO: 1.
  • a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
  • a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
  • the polynucleotides of the present disclosure that are operable to encode any of the wild-type antimicrobial peptide amino acid sequences described herein, do not encode a wild-type antimicrobial peptide having any: mutations, amino acid substitutions, and/or amino acid additions outside of the full-length wild-type amino acid sequences as described herein.
  • the wild-type antimicrobial peptide sequences of the present disclosure do not comprise a substitution and/or addition of any one or more amino acids to the N-terminus of any of the wild-type antimicrobial peptide sequences described herein, e.g., any one of SEQ ID NO: 1-19628.
  • a polynucleotide encoding a wild-type antimicrobial peptide of the present disclosure encodes a peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type antimicrobial peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628; wherein the foregoing percent identity is calculated based on the degree of sequence relatedness within the full-length of the polypeptide sequences being compared
  • a polynucleotide of the present disclosure is operable to encode an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19629; wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19630 wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
  • GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • any of the aforementioned polynucleotides encoding the wild-type antimicrobial peptides of the present disclosure e.g., a polynucleotide encoding a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising
  • any of the aforementioned polynucleotides encoding an antimicrobial peptide of the present disclosure e.g., a polynucleotide encoding a PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634) can be used to make an antimicrobial combination of the present disclosure comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition of the present disclosure, comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and one or more excipients.
  • the wild-type antimicrobial peptide of the present disclosure can be obtained via any method well known in the art.
  • the wild-type antimicrobial peptides of the present disclosure can be obtained directly from the source, e.g., isolating an antimicrobial peptide (such as an NCR13 peptide) from a legume.
  • the wild-type antimicrobial peptide of the present disclosure can be isolated a plant or animal.
  • a WT-NCR peptide can be isolated from Cicer arietinum nodules.
  • seeds from Cicer arietinum can be surface sterilized with HgCh. Surface-sterilized seeds can then be germinated at room temperature and the seedlings be planted. The seedlings can then be inoculated with their respective rhizobial species: Mesorhizobium ciceri (HAMBI2949). When the nodules are fully developed and pink, they can be harvested to isolate the peptides.
  • the antimicrobial peptides of the present disclosure can be produced using recombinant methods.
  • an antimicrobial peptide of the present disclosure can be created using any known method for producing a protein.
  • an antimicrobial peptide of the present disclosure can be created using a recombinant expression system, such as yeast expression system or a bacterial expression system.
  • a recombinant expression system such as yeast expression system or a bacterial expression system.
  • the host cell can be any host cell that satisfies the requirements of the end-user.
  • a user may desire to use one specific type of host cell (e.g., a yeast cell or a bacteria cell) as opposed to another; the preference of a given host cell can range from desired codon usage, availability and cost, among other considerations.
  • a polynucleotide operable to encode a wild-type antimicrobial peptide (mature or full length) of the present disclosure can be cloned into a vector using a variety of cloning strategies, and commercial cloning kits and materials readily available to those having ordinary skill in the art.
  • the mRNA, cDNA or other nucleotide coding formats of the wild-type antimicrobial peptide sequence desired to be recombinantly produced are available in various molecular biology databases, for example, NCBI, EMBL, GenBank, DDBJ, EnsemblPlants, Pfam, Swiss Prot, or UniProt, and can be searched using established nucleotide and/or protein databases and bioinformatics depositories, such as, BLASTn and TBLASTn, and PubMed databases. Genomic sequences of the full length and mature forms of NCR peptides are also published in various scientific reports known to those of skill in the art, for example, as provided in www.plantphysiol.org.
  • the polynucleotide can be cloned into a vector using such strategies as the SnapFast; Gateway; TOPO; Gibson; LIC; InFusionHD; or Electra strategies.
  • strategies as the SnapFast; Gateway; TOPO; Gibson; LIC; InFusionHD; or Electra strategies.
  • a polynucleotide encoding wild-type antimicrobial peptide of the present disclosure can be cloned into a vector such as a plasmid, cosmid, virus (bacteriophage, animal viruses, and plant viruses), and/or artificial chromosome (e.g., YACs).
  • a vector such as a plasmid, cosmid, virus (bacteriophage, animal viruses, and plant viruses), and/or artificial chromosome (e.g., YACs).
  • a polynucleotide encoding an antimicrobial peptide of the present disclosure can be inserted into other commercially available plasmids and/or vectors that are readily available to those having skill in the art, e.g., plasmids are available from Addgene (a non-profit plasmid repository); GenScript®; Takara®; Qiagen®; and PromegaTM.
  • Addgene a non-profit plasmid repository
  • GenScript® a non-profit plasmid repository
  • Takara® Takara®
  • Qiagen® Qiagen®
  • PromegaTM PromegaTM
  • the polynucleotide sequence encoding an antimicrobial peptide of the present disclosure can be chemically synthesized using commercially available polynucleotide synthesis services, such as those offered by GENEWIZ® (e.g., TurboGENETM; PriorityGENE; and FragmentGENE), or SIGMA-ALDRICH® (e.g., Custom DNA and RNA Oligos Design and Order Custom DNA Oligos).
  • GENEWIZ® e.g., TurboGENETM; PriorityGENE; and FragmentGENE
  • SIGMA-ALDRICH® e.g., Custom DNA and RNA Oligos Design and Order Custom DNA Oligos.
  • Exemplary method for generating DNA and or custom chemically synthesized polynucleotides are well known in the art, and are illustratively provided in U.S. Patent No. 5,736,135, Serial No. 08/389,615, filed on Feb.
  • Chemically synthesizing polynucleotides allows for a DNA sequence to be generated that is tailored to produce a desired peptide based on the arrangement of nucleotides within said sequence (i.e., the arrangement of cytosine [C], guanine [G], adenine [A] or thymine [T] molecules); the mRNA sequence that is transcribed from the chemically synthesized DNA polynucleotide can be translated to a sequence of amino acids, each amino acid corresponding to a codon in the mRNA sequence.
  • Obtaining an antimicrobial peptide of the present disclosure from a chemically synthesized DNA polynucleotide sequence and/or a DNA polynucleotide sequence can be achieved by cloning the DNA sequence into an appropriate vector.
  • the vector can be a plasmid, which can introduce a heterologous gene and/or expression cassette into yeast cells to be transcribed and translated.
  • the term “vector” is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated.
  • a vector may contain “vector elements” such as an origin of replication (ORI); a gene that confers antibiotic resistance to allow for selection; multiple cloning sites; a promoter region; a selection marker for non-bacterial transfection; and a primer binding site.
  • vector elements such as an origin of replication (ORI); a gene that confers antibiotic resistance to allow for selection; multiple cloning sites; a promoter region; a selection marker for non-bacterial transfection; and a primer binding site.
  • a nucleic acid sequence can be “exogenous,” which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found.
  • Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
  • viruses bacteriophage, animal viruses, and plant viruses
  • artificial chromosomes e.g., YACs
  • One of skill in the art would be well equipped to construct a vector through standard recombinant techniques, which are described in Sambrook et al., 1989 and Ausubel et al., 1996, both incorporated herein by reference.
  • a vector may encode a targeting molecule.
  • a targeting molecule is one that directs the desired nucleic acid to a particular tissue, cell, or other location.
  • Peptide synthesis or the chemical synthesis of peptides and/or polypeptides can be used to generate wild-type antimicrobial peptides of the present disclosure. These methods can be performed by those having ordinary skill in the art, and/or through the use of commercial vendors (e.g., GenScript®; Piscataway, New Jersey). For example, in some embodiments, chemical peptide synthesis can be achieved using Liquid phase peptide synthesis (LPPS), or solid phase peptide synthesis (SPPS).
  • LPPS Liquid phase peptide synthesis
  • SPPS solid phase peptide synthesis
  • peptide synthesis can generally be achieved by using a strategy wherein the coupling the carboxyl group of a subsequent amino acid to the N- terminus of a preceding amino acid generates the nascent polypeptide chain — a process that is opposite to the type of polypeptide synthesis that occurs in nature.
  • Peptide deprotection is an important first step in the chemical synthesis of polypeptides. Peptide deprotection is the process in which the reactive groups of amino acids are blocked through the use of chemicals in order to prevent said amino acid’ s functional group from taking part in an unwanted or non-specific reaction or side reaction; in other words, the amino acids are “protected” from taking part in these undesirable reactions. [0381] Prior to synthesizing the peptide chain, the amino acids must be “deprotected” to allow the chain to form (i.e., amino acids to bind).
  • Chemicals used to protect the N-termini include 9-fluorenyhnethoxycarbonyl (Fmoc), and tert-butoxycarbonyl (Boc), each of which can be removed via the use of a mild base (e.g., piperidine) and a moderately strong acid (e.g., trifluoracetic acid (TFA)), respectively.
  • a mild base e.g., piperidine
  • a moderately strong acid e.g., trifluoracetic acid (TFA)
  • the C-terminus protectant required is dependent on the type of chemical peptide synthesis strategy used: e.g., LPPS requires protection of the C-terminal amino acid, whereas SPPS does not owing to the solid support which acts as the protecting group.
  • Side chain amino acids require the use of several different protecting groups that vary based on the individual peptide sequence and N-terminal protection strategy; typically, however, the protecting group used for side chain amino acids are based on the tert-butyl (tBu) or benzyl (Bzl) protecting groups.
  • Amino acid coupling is the next step in a peptide synthesis procedure.
  • the incoming amino acid’ s C-terminal carboxylic acid must be activated: this can be accomplished using carbodiimides such as diisopropylcarbodiimide (DIC), or dicyclohexylcarbodiimide (DCC), which react with the incoming amino acid’s carboxyl group to form an O-acylisourea intermediate.
  • DIC diisopropylcarbodiimide
  • DCC dicyclohexylcarbodiimide
  • the O-acylisourea intermediate is subsequently displaced via nucleophilic attack via the primary amino group on the N- terminus of the growing peptide chain.
  • the reactive intermediate generated by carbodiimides can result in the racemization of amino acids.
  • reagents such as 1 -hydroxybenzotriazole (HOBt) are added in order to react with the O- acylisourea intermediate.
  • HOBt 1 -hydroxybenzotriazole
  • Other couple agents include 2-(1H-benzotriazol-1- yl)-l,l,3,3-tetramethyluronium hexafluorophosphate (HBTU), and benzotriazol- 1-yl-oxy- tris(dimethylamino)phosphonium hexafluorophosphate (BOP), with the additional activating bases.
  • HBTU 2-(1H-benzotriazol-1- yl)-l,l,3,3-tetramethyluronium hexafluorophosphate
  • BOP benzotriazol- 1-yl-oxy- tris(dimethylamino)phosphonium hexafluorophosphate
  • peptides can be purified based on the peptide’ s physiochemical characteristics (e.g., charge, size, hydrophobicity, etc.).
  • Techniques that can be used to purify peptides include Purification techniques include Reverse-phase chromatography (RPC); Size-exclusion chromatography; Partition chromatography; High- performance liquid chromatography (HPLC); and Ion exchange chromatography (IEC).
  • RPC Reverse-phase chromatography
  • Size-exclusion chromatography Size-exclusion chromatography
  • Partition chromatography Partition chromatography
  • HPLC High- performance liquid chromatography
  • IEC Ion exchange chromatography
  • any of the methods described herein can be used to generate the wild-type antimicrobial peptides described herein, e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs 1-19628.
  • any of the methods described herein can be used to generate any of the antimicrobial peptides described herein, e.g., an antimicrobial peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs 19629-19633.
  • the present disclosure provides combinations comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and agricultural compositions thereof, further comprising an excipient; and methods of making and using the same.
  • chelating agent refers to any agent that binds to a mono-, di-, tri-, tetra-, penta-, or hexa- valent cation — thereby forming a metal complex known as a “chelate”.
  • chelate includes a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation, hi some embodiments, the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p-block metal.
  • chelating agents are compounds that form complexes with certain metal ions, thereby inactivating the ions so that they cannot react with other elements, and becoming a binding agent that suppresses chemical activity by forming chelates.
  • Chelation describes the process of forming two or more separate bonds between a ligand and a single central atom.
  • the ligand may be any organic compound, a silicate, or a phosphate.
  • the chelate effect describes the enhanced affinity of chelating ligands for a metal ion compared to the affinity of a collection of similar nonchelating ligands for the same metal.
  • a chelate can be a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa- valent cation, wherein the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p- block metal.
  • the chelate may be a simple complex with the cation, involving only non-ionic-bond, non-covalent attractions; in yet other embodiments, the chelate may be a complex involving ionic bonds and/or other non-covalent attractions. In the latter case, the chelating agent may become ionized by reaction with the cation and/or with a solvent, e.g., water.
  • an oxo-acid-type group of the (neutral) chelating agent e.g., a phosphonate group or phosphonate ester group
  • a phosphonate group or phosphonate ester group may lose a hydrogen from a hydroxyl thereof, and the resulting oxide moiety might then participate in ionic bonding with the metal ion.
  • the chelating agent is capable of removing a metal ion from a system by forming a complex (i.e., a chelate) so that the metal ion cannot readily participate in and/or catalyze chemical reactions.
  • the chelating agent is capable interfering with, or elimination of, a metalloenzyme's functionality.
  • a chelating agent can be a ligand.
  • a chelating agent can be an atom, hi some embodiments, a chelating agent can be an ion.
  • a composition may contain a chelating agent.
  • a chelating agent can be any organic or inorganic compound that will bind to a metal ion, e.g., a metal ion having a valence greater than one.
  • chelating agents are capable of forming more than one bond.
  • Ethylene diamine for example, is bidentate (two links), tripyridyl is tridentate (three) and ethylene diamine tetra acetic acid (EDTA) is hexadentate (six) which makes it particularly effective as a chelating agent.
  • EDTA ethylene diamine tetra acetic acid
  • a chelating agent is operable to bind to a metal ion.
  • a chelating agent is operable to bind to a metal ion, e.g., without limitation: Al 3+ ; Ag + ; As 3+ ; Au + ; Au 3+ ; Ba 2+ ; Be 2+ ; Ca 2+ ; Cd 2+ ; Co 2+ ; Co 3+ ; Cr 2+ ; Cr 3+ ; Cs + ; Cu + ; Cu 2+ ; Fe 2+ ; Fe 3+ ; Ga 3+ ; Hg 2+ ; Hg 2 2+ ; In 3+ ; K + ; Li + ; Mg 2+ ; Mn 2+ ; Na + ; Ni 2+ ; Pb 2+ ; Pb ++ ; Sn 2+ ; Sn ++ ; Sr 2+ ; or Zn 2+ .
  • a metal ion e.g., without limitation: Al 3+ ; Ag + ; As 3+ ; Au + ; Au 3+ ; Ba 2+ ; Be 2+
  • a chelating agent is operable to bind Zn 2+ , Ca 2+ , Hg 2+ , Cd 2+ , Pb 2+ , Na + , Mg 2+ , Mn 2+ , Fe 2+ , Co 2+ , Ni 2+ , and Cu 2+ .
  • a chelating agent is operable to bind Mg 2+ , Mn 2+ , Zn 2+ , Co 2+ , or Fe 2+ , or Cu 2+ .
  • a chelating agent is operable to bind Zn 2+ , Ca 2+ , Mg 2+ , Hg 2+ , Cd 2+ , or Pb 2+ .
  • a chelating agent is operable to bind Ca 2+ ; Co 2+ ; Cu 2+ , Mg 2+ ; Fe 3+ , or Pb 2+ .
  • a chelating agent is operable to bind Ca 2+ , Mg 2+ , Fe 2+ or Pb 2+ .
  • a chelating agent is operable to bind Na + , K + , Li + , Mg 2+ , or Ca 2+ .
  • the metal ion is Ca 2+ or Mg 2+ .
  • a chelating agent that is operable to bind to a metal ion and form a chelate therewith is described herein as “[metal-ion] chelating agent.”
  • an Al 3+ chelating agent is operable to bind an Al 3+ metal ion;
  • an Ag + chelating agent is operable to bind an Ag + metal ion;
  • an As 3+ chelating agent is operable to bind an As 3+ metal ion;
  • an Au + chelating agent is operable to bind an Au + metal ion;
  • an Au 3+ chelating agent is operable to bind an Au 3+ metal ion;
  • a Ba 2+ chelating agent is operable to bind a Ba 2+ metal ion;
  • a Be 2+ chelating agent is operable to bind a Be 2+ metal ion;
  • a Ca 2+ chelating agent is operable to bind a Ca 2+ metal ion;
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Sn ++ chelating agent; a Sr 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Zn 2+ chelating agent.
  • the chelating agent may contain an amino group and may be, for example, an amino-polycarboxylate or a phosphonate.
  • the amino-containing chelating agent may be a monomeric molecule comprising one, two or three amino groups (typically secondary or tertiary amino groups), and it may contain two, three, four or five carboxyl groups or even more carboxyl groups.
  • the chelating agents may be phosphorus containing, hi other embodiments, the chelating agents do not contain phosphorous.
  • the chelating agents may be carboxylates or be based on carboxylate groups.
  • the chelating agents may be chelating agents which originate from plant material, such as starch-containing materials
  • the chelating agent can be a metal-ion chelating agent.
  • the chelating agent can be a metal-ion chelating agent such as: an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent; a Hg 2+ chelating agent; a Hg2 2+ chelating agent; a In 3+ chelating agent; a K + chelating agent;
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Al 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Ag + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an As 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Au + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Au 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ba 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Be 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ca 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cd 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Co 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Co 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cr 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cr 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cs + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cu + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cu 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Fe 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Fe 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ga 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Hg 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Hg2 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a hi 3+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a K + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Li + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Mg 2 " 1 " chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Mn 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Na + chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Ni 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Pb 2+ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Pb ++ chelating agent.
  • an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Sn 2+ chelating agent.
  • the chelating agent can be: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]eth
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is EDTA, or an s EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
  • the present disclosure contemplates mixtures, combinations, compositions, products, and transgenic organisms that contain — or, in the case of transgenic organisms, express or otherwise produce — any of the AMPs as described herein in combination with a chelating agent.
  • a combination can be a “mixture.”
  • a mixture refers to a combination of a first component, and one or more additional components, wherein the first component and the one or more additional components are present together in a single entity (e.g., a single unit).
  • a mixture can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components are present in admixture for simultaneous administration.
  • a combination can refer to the association of an AMP and a chelating agent; wherein the AMP and the chelating agent are present in a single entity (e.g., an admixture for simultaneous administration).
  • a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components, are present separately (e.g., more than one unit).
  • a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components may be administered separately, sequentially, simultaneously, concurrently or chronologically staggered.
  • a combination can refer to the association of an AMP and a chelating agent; and wherein the AMP and the chelating agent are present separately (e.g., different units for separate, sequential, simultaneous, concurrent or chronologically- staggered administration) .
  • a combination can refer to the separate, sequential, simultaneous, concurrent or chronologically-staggered application of two or more separate components (e.g., an AMP and a chelating agent).
  • two or more separate components e.g., an AMP and a chelating agent.
  • a “combination” refers to the result of a simultaneous application of both an AMP and a chelating agent.
  • a “combination” refers to the result of a separate application of an AMP and a chelating agent.
  • a “combination” refers to the result of a sequential application of two or more separate components, e.g., a first application an AMP, followed by a second application of a chelating agent, or vice versa. Where the application is sequential or separate, the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • any of the wild-type antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
  • a wild-type antimicrobial peptide of the present disclosure having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type defensin peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide is a is a wild-type NCR 1 peptide (NCR01), a wild-type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wildtype NCR 4 peptide (NCR04), a wild-type NCR 5 peptide (NCR05), a wild-type NCR 6 peptide (NCR06), a wild-type NCR 7 peptide (NCR07), a wild-type NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and where
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and where
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild- type NCR 13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NOs: 1 or 14.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1-19628 [0488]
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide consists of an amino acid sequence set forth in SEQ ID NOs: 1.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an AU 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent; a Hg
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-B
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • a chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
  • the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; aBa 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
  • chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; dibenzyl DTPA; dibenzyl DTPA; dibenzyl DTPA;
  • N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine DTPA-BMA
  • N-[2- [bis(carboxymethyl)amino]-3 -(4-ethoxyphenyl)propyl)]-N- [2- [bis(carboxymethyl)amino]ethyl]glycine EOB-DTPA
  • 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid BOPTA
  • N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid DTPA-GLU
  • DO3A 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid
  • DO3A 1,4,7,10- teraazacyclododecane 1,4 ,7
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequences set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]eth
  • EDTA ethylened
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP 1-Hydroxyethy
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA.
  • a chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA.
  • a wild-type antimicrobial peptide of the present disclosure having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
  • any of the mutant antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
  • an antimicrobial peptide selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a chelating agent.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • AMP antimicrobial peptide
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19629; wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19630 wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • a chelating agent wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • a chelating agent wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-
  • EDTA ethylened
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO:
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • PvDl SEQ ID NO: 19629
  • PvD1a SEQ ID NO: 19630
  • Dm-AMP1a SEQ ID NO: 19631
  • Rs-AFP2a SEQ ID NO: 19632
  • SPE10a SEQ ID NO: 19633
  • So-D2 SEQ ID NO: 19634
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19629; wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC SEQ ID NO: 19630 wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and a chelating agent; wherein the combination is a mixture.
  • PvDl SEQ ID NO: 19629
  • PvD1a SEQ ID NO: 19630
  • Dm-AMP1a SEQ ID NO: 19631
  • Rs-AFP2a SEQ ID NO: 19632
  • SPE10a SEQ ID NO: 19633
  • So-D2 SEQ ID NO: 19634
  • a chelating agent wherein the combination is a mixture.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied separately.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied sequential
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO:
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO:
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and a chelating agent, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent;
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); be
  • an AMP selected from:
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 1963
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, wherein the ratio of (1):(2) ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000: 1 , about 1 :5 to about 5000: 1 , about 6: 10 to about 5000: 1 , about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:l, or from about 1 :10 to about 1000:1, or from about 1:10 to about 500:1, or from about 1 :10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, wherein the ratio of (1):(2) ranges from about 1:10 to about 5000:1, or ranges from about 1:10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:l, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1 :10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1 :10 to about 19:1, about 1 :10 to about 20:1, about 1:10 to about 21:1, about 1:10 to about 22:l, about 1:10 to about 23:
  • the AMP can be any antimicrobial peptide described herein, for example, an AMP having an amino acid sequence of any one of SEQ ID NOs: 1-19634 , or an agriculturally acceptable salt thereof.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 5000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 5000:1, about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 3000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 1000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 500:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) ranges from about 1 :10 to about 400:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 300:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 5000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 3000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 1000:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 500:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 400:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) ranges from about 1 :1 to about 300:1.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1 :10 to about 1:8.75, from about 1 :10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1 :7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1 :5.75, from about 1:10 to about 1:5.5, from about 1:10 to
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1 :8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1:10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2)
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 319.6030164.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 317.1530072.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 252.4672893.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 145.4905117.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 129.4347391.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 124.2900619.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 87.94027452.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 86.24648324.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 77.5140482.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.897205.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.44210553.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 72.98700605.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 53.38351062.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 50.94513553.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 49.98224086.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 40.88162007.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 37.17101954.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 34.35145587.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.97249146.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.69789197.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 32.90403423.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.89973577.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.85696326.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 26.92272685.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.34350224.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 22.07788497.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.02784114.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 20.15554593.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.31431086.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.17059524.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.81691793.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.3653315.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 15.94308131.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 15.84806932.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 12.25073038.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 11.87450341.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.72015899.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.61784715.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.0903766.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 9.56792468.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.89924782.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.77691845.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.563483639.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 7.655822524.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 5.84571854.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 4.758355866.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 4.155776786.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.778146876.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.014708952.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.620072693.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.582603977.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.212878425.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 1.886062254.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.860604057.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.826172189.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.355945504.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.11798779.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.055796564.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.977591312.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.770646517.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.750571954.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.730349113.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.599431023.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.536093495.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.40062441.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 0.356748372.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.327975307.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.254984024.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.22877018.
  • an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.139327165.
  • an antimicrobial combination of the present disclosure can further comprise one or more excipients.
  • an antimicrobial combination of the present disclosure is formulated in separate compositions.
  • an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated as powders, dusts, pellets, granules, sprays, emulsions, colloids, solutions, or combinations thereof.
  • an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated using the same excipients or different excipients. [0665] In some embodiments, an antimicrobial combination of the present disclosure is formulated is formulated in a single composition.
  • an antimicrobial combination of the present disclosure is formulated is formulated in a single composition, wherein the single composition is formulated as a powder, a dust, a pellet, a granule, a spray, an emulsion, a colloid, a solution, or combinations thereof.
  • an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated using the same excipients or different excipients.
  • an antimicrobial combination of the present disclosure comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; can further comprise one or more excipients.
  • the excipient can be any agriculturally acceptable additive, carrier, surfactant, emulsifier, thickener, preservative, solvent, disintegrant, glidant, lubricant, diluent, filler, bulking agent, binder, emollient, stiffening agent, stabilizer, solubilizing agents, dispersing agent, suspending agent, antioxidant, antiseptic, wetting agent, humectant, fragrant, suspending agents, pigments, colorants, isotonic agents, viscosity enhancing agents, mucoadhesive agents, and/or any combination thereof.
  • the excipient can be added to an antimicrobial composition, preparation, and/or formulation of the present disclosure, which may aid in achieving a desired modification to the characteristics of the antimicrobial composition, preparation, and/or formulation.
  • modifications include, but are not limited to, physical stability, chemical stability, therapeutic efficacy, and/or any combination thereof.
  • excipients can be formulated alongside a combination of a an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, when preparing an antimicrobial composition, e.g., for the purpose of bulking up compositions (thus often referred to as bulking agents, fillers or diluents).
  • an excipient can be used to provide stability, or prevent contamination.
  • an excipient can be used to confer a physical property to a composition (e.g., a composition that is a dry granular, or dry flowable powder physical form).
  • Reference to an excipient includes both one and more than one such excipients. Suitable excipients are described in Remington's Pharmaceutical Sciences, by E.W. Martin, the disclosure of which is incorporated herein by reference in its entirety.
  • the excipient can be independently selected from thickeners, viscosity enhancing agents, bulking agents, penetration enhancers, buffers, preservatives, diluents, binders, lubricants, glidants, disintegrants, fillers, solubilizing agents, pH modifying agents, preservatives, stabilizing agents, anti-oxidants, wetting or emulsifying agents, suspending agents, pigments, colorants, isotonic agents, emulsifiers, and diagnostic agents.
  • thickeners viscosity enhancing agents, bulking agents, penetration enhancers, buffers, preservatives, diluents, binders, lubricants, glidants, disintegrants, fillers, solubilizing agents, pH modifying agents, preservatives, stabilizing agents, anti-oxidants, wetting or emulsifying agents, suspending agents, pigments, colorants, isotonic agents, emulsifiers, and diagnostic agents.
  • an antimicrobial composition of the present disclosure comprising an excipient may contain an amount of excipient ranging from about 0.005 wt% to about 99 wt%.
  • any of the antimicrobial compositions of the present disclosure can be formulated according to the methods described herein, and used to inhibit microbe growth and/or proliferation, and/or kill the microbes, and/or control the damage caused by their actions, especially their damage to plants.
  • Antimicrobial compositions of the present disclosure can be formulated for use as agrochemical compositions.
  • agrochemical compositions can include, but is not limited to, aerosols and/or aerosolized products (e.g., sprays, fumigants, powders, dusts, and/or gases); granules, dusts, powders, or seed dressings.
  • the antimicrobial compositions may be formulated as a powder, dust, pellet, granule, spray, emulsion, colloid, solution, or such like, and may be prepared by such conventional means as desiccation, lyophilization, homogenization, extraction, filtration, centrifugation, or sedimentation, hi all such compositions, the antimicrobial peptide may be present in a concentration of from about 1 % to about 99% by weight.
  • compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline and/or other buffer.
  • the formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application.
  • Suitable carriers can be solid or liquid and are well known in the art.
  • compositions may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional compositions techniques. Suitable compositions and application methods are described in U.S. Pat. No. 6,468,523, the disclosure of which is incorporated by reference herein in its entirety.
  • the active ingredients of the present disclosure can be applied in the form of compositions and can be applied to the crop area or plant to be treated, simultaneously or in succession, with other non-active compounds.
  • These compounds can be fertilizers, weed killers, cryoprotectants, surfactants, detergents, soaps, dormant oils, polymers, and/or time-release or biodegradable carriers that permit long-term dosing of a target area following a single application of the composition.
  • One or more of these non-active compounds can be prepared, if desired, together with further agriculturally acceptable carriers, surfactants or application-promoting adjuvants customarily employed in the art of composition.
  • Suitable carriers and adjuvants can be solid or liquid and correspond to the substances ordinarily employed in composition technology, e.g. natural or regenerated mineral substances, solvents, dispersants, wetting agents, tackifiers, binders or fertilizers.
  • Methods of applying an active ingredients of the present disclosure or an agrochemical composition of the present disclosure that has an antimicrobial peptide and a chelating agent, as produced by the methods described herein of the present disclosure include leaf application, seed coating and soil application.
  • the number of applications and the rate of application depend on the intensity of infestation by the corresponding pest.
  • antimicrobial compositions of the present disclosure may be prophylactically applied to an environmental area to prevent infection by a pathogenic microbe, which may be killed or reduced in numbers in a given area by the methods of the present disclosure, hi some embodiments, the microbe comes into contact with, an antimicrobially-effective amount of the antimicrobial compositions of the present disclosure as described herein.
  • the antimicrobial compositions of the present disclosure may be made by formulating the peptide and chelating agent with the desired agriculturally-acceptable carrier.
  • the combinations and/or compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline and/or other buffer.
  • the formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application.
  • Suitable agricultural carriers can be solid or liquid and are well known in the art.
  • the composition may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional composition techniques. Suitable composition and application methods are described in U.S. Pat. No. 6,468,523, herein incorporated by reference in its entirety.
  • an antimicrobial composition of the present disclosure can be formulated at a pH ranging from about 5 to about 11 ; from about 5.5 to about 11 ; from about 6 to about 11 ; from about 6.5 to about 11; from about 7 to about 11 ; from about 7.5 to about 11 ; from about 8 to about 11 ; from about 8.5 to about 11 ; from about 9 to about 11 ; from about 9.5 to about 11; from about 10 to about 11; or from about 10.5 to about 11.
  • an antimicrobial composition of the present disclosure can be formulated at a pH ranging from about 5 to about 11; from about 5 to about 10.5; from about 5 to about 10; from about 5 to about 9.5; from about 5 to about 9; from about 5 to about 8.5; from about 5 to about 8; from about 5 to about7.5; from about 5 to about7; from about 5 to about 6.5; from about 5 to about 6; or from about 5 to about 5.5.
  • an antimicrobial composition of the present disclosure can be formulated into a granule form (granular formulation).
  • Methods of generating a granular formulation are well known in the art, and include: crystallization, precipitation, pan-coating, fluid bed coating, agglomeration (e.g., fluid bed agglomeration), rotary atomization, extrusion, prilling, spheronization, size reduction methods, drum granulation, and/or high shear granulation, and the like.
  • the granular formulation can be generated via agglomeration, e.g., spray-drying agglomeration; rewet agglomeration; fluid bed agglomeration; and the like.
  • agglomeration e.g., spray-drying agglomeration; rewet agglomeration; fluid bed agglomeration; and the like.
  • the type of agglomeration can be fluid bed agglomeration.
  • Exemplary methods of fluid bed agglomeration are provided in U.S. Patent No. 7,582,147 ; the disclosure of which is incorporated herein by reference in its entirety.
  • the granular formulation can be generated via fluid bed agglomeration.
  • the granular formulation can be generated by spraying the active and inert ingredients onto a blank carrier in a fluid bed.
  • the granular formulation can be generated by spraying the active and inert ingredients (excipients) onto a blank carrier and granulated in pan granulator.
  • the granular formulation can be generated by mixing the active and inert powders (i.e., one or more excipients described herein) and water, and subsequently granulated by passing the ingredients through an extruder.
  • the granular formulation can be generated by mixing the active and inert powders (i.e., one or more excipients described herein) with water, and granulated by roll compaction.
  • Antimicrobial compositions comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, can include, but are not limited to, aerosols and/or aerosolized products, e.g., sprays, fumigants, powders, dusts, and/or gases; and/or seed dressings.
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide or a wild-type defensin.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-837.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type defensin peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type plant defensin peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type plant defensin peptide amino acid sequences set forth in any one of SEQ ID NOs:
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild- type NCR 13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild- type NCR 13 peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the WT-NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; aBa 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent; a Hg 2+ chelating agent
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(car
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
  • compositions or formulations can be made using any of the wild-type antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA, or a EDTA derived salt thereof), and any of the excipients described herein.
  • wild-type antimicrobial peptides described herein e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in SEQ ID NOs: 1-19628
  • any of the chelating agents described herein e.g., EDTA, or a EDTA derived salt thereof
  • excipients described herein e.g., EDTA, or a EDTA derived salt thereof
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a wildtype antimicrobial peptide consisting of an amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, or an EDTA derived salt thereof.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
  • the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; aBa 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent; a Hg 2+
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
  • chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA);
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is EDTA, or
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt
  • N,N',N"-triacetic acid NOTA
  • 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid AAZTA
  • 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid DOTA
  • benzo-DOTA dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14, or an agriculturally acceptable salt
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype NCR13 peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
  • the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA);
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide or a wild-type defensin.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1- 837.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type defensin peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-19628.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type plant defensin peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-4109.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild- type NCR 13 peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the WT-NCR13 peptide consists of an amino acid sequence as set forth in SEQ ID NO: 1 .
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; aBa 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+ chelating agent; a Cr 2+ chelating agent; a Cr 3+ chelating agent; a Cs + chelating agent; a Cu + chelating agent; a Cu 2+ chelating agent; a Fe 2+ chelating agent; a Fe 3+ chelating agent; a Ga 3+ chelating agent; a Hg 2+ chelating agent
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(car
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
  • compositions or formulations described herein can be made using any of the wild-type antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA, or a EDTA derived
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, or an EDTA
  • any of the mutant antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial composition comprising an antimicrobial combination of the present disclosure, i.e., an antimicrobial composition comprising: an AMP, or an agriculturally acceptable salt thereof, a chelating agent; and an excipient.
  • antimicrobial composition comprises: an antimicrobial peptide selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient (e.g., any excipient as described herein).
  • an antimicrobial peptide selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excip
  • an antimicrobial composition comprises an antimicrobial combination of: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; and an excipient; wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of:
  • GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of:
  • GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
  • AMP antimicrobial peptide
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein (1) and (2) are applied sequentially; and wherein the first and second excipient is the same or different.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and one or more excipients; wherein the chelating agent is a metal- ion chelating agent.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an AS 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating agent; a Co 2+ chelating agent; a Co 3+
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A)
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • DTPMP 1.4.7.10-tetra(methylenephosphonic) acid
  • MGDA N,N-bis(carboxymethyl)alanine
  • EGTA ethylene glycol tetraacetic acid
  • EDDS ethylenediamine-N,N-disuccinic acid
  • LDA L- Glutamic acid
  • PAA poly(acrylic acid)
  • PAA PMA copoly(acrylic acid/maleic acid)
  • STP Sodium tripolyphosphate
  • HEDP 1-Hydroxyethylidene-1,- Diphosphonic Acid
  • HEDP ethylenediamine tetra(methylene phosphonic acid)
  • ETMP A ethylenediaminetetramethylenetetraphosphonic acid
  • DTPMP diethylenetriamine penta (methylene phosphonic acid)
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; and further comprising an excipient; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and an excipient.
  • PvDl SEQ ID NO: 19629
  • PvD1a SEQ ID NO: 19630
  • Dm-AMP1a SEQ ID NO: 19631
  • Rs-AFP2a SEQ ID NO: 19632
  • SPE10a SEQ ID NO: 19633
  • So-D2 SEQ ID NO: 19634
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630); and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC SEQ ID NO: 19633; and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
  • an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); a chelating agent; and an excipient; wherein the combination is a mixture.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and further comprises an excipient; wherein (1) and (2) are applied simultaneously.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and further comprising an excipient; wherein (1) and (2) are applied separately.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent;
  • an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and an excipient; wherein (1) and (2) are applied sequentially.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and an
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination comprising: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and an excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination comprising: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), and (2) a chelating agent; and further comprising an excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein (1) and (2) are applied sequentially; and wherein the first and second excipient is the same or different.
  • PvDl SEQ ID NO: 19629
  • PvD1a SEQ ID NO: 19630
  • Dm-AMP1a SEQ ID NO: 19631
  • Rs-AFP2a SEQ ID NO: 19632
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
  • an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent, wherein the chelating agent is an Al 3+ chelating agent; an Ag + chelating agent; an As 3+ chelating agent; an Au + chelating agent; an Au 3+ chelating agent; a Ba 2+ chelating agent; a Be 2+ chelating agent; a Ca 2+ chelating agent; a Cd 2+ chelating
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2 "-nitrilotriacetate (NTA); citrate; 2-hydroxypropan-1,2,3- tricarbox
  • an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
  • an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (
  • Examples of spray products of the present disclosure can include field sprayable compositions for agricultural usage and indoor sprays for use in interior spaces in a residential or commercial space, hi some embodiments, residual sprays or space sprays having an antimicrobial peptide, a chelating agent, and an excipient can be used to reduce or eliminate microbes in an interior space.
  • SSI Surface spraying indoors
  • SSI involves applying the composition onto the walls and other surfaces of a house with a residual antimicrobial (e.g., an antimicrobial peptide).
  • the composition having an antimicrobial peptide, a chelating agent, and an excipient will inhibit growth and/or proliferation of microbes that come in contact with these surfaces.
  • the traditional methods for generating a space-spray include thermal fogging (whereby a dense cloud of a composition having an antimicrobial peptide and a chelating agent is produced giving the appearance of a thick fog) and Ultra Low Volume (ULV), whereby droplets are produced by a cold, mechanical aerosolgenerating machine. Ready-to-use aerosols such as aerosol cans may also be used.
  • a sprayable composition may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
  • a sprayable composition may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • the antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient may be made available in a spray product as an aerosol-based application, including aerosolized foam applications. Pressurized cans are the typical vehicle for the formation of aerosols.
  • An aerosol propellant that is compatible with the composition having an antimicrobial peptide, a chelating agent, and an excipient are used.
  • a liquefied-gas type propellant is used.
  • Suitable propellants include compressed air, carbon dioxide, butane and nitrogen.
  • the concentration of the propellant in the active compound composition is from about 5 percent to about 40 percent by weight of the pyridine composition, preferably from about 15 percent to about 30 percent by weight of the composition having an antimicrobial peptide, a chelating agent, and an excipient.
  • antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient can also include one or more foaming agents.
  • Foaming agents that can be used include sodium laureth sulfate, cocamide DEA, and cocamidopropyl betaine.
  • the sodium laureth sulfate, cocamide DEA and cocamidopropyl are used in combination.
  • the concentration of the foaming agent(s) in the active compound composition is from about 10 percent to about 25 percent by weight, more preferably 15 percent to 20 percent by weight of the composition.
  • a foam may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
  • a foam may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • fabrics and garments may be made that contain an antimicrobially-effective composition of an antimicrobial peptide, a chelating agent, and an excipient.
  • concentration of the wild-type antimicrobial peptide in the polymeric material, fiber, yarn, weave, net, or substrate described herein can be varied within a relatively wide concentration range from, for example, 0.05 to 15 percent by weight, preferably 0.2 to 10 percent by weight, more preferably 0.4 to 8 percent by weight, especially 0.5 to 5, such as 1 to 3, percent by weight.
  • the concentration of the antimicrobial composition of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient (whether for treating surfaces or for coating a fiber, yam, net, weave) can be varied within a relatively wide concentration range from, for example 0.1 to 70 percent by weight, such as 0.5 to 50 percent by weight, preferably 1 to 40 percent by weight, more preferably 5 to 30 percent by weight, especially 10 to 20 percent by weight.
  • the concentration of the wild-type antimicrobial peptide may be chosen according to the field of application such that the requirements concerning inhibitory or lethal efficacy, durability and toxicity are met. Adapting the properties of the material can also be accomplished and so custom-tailored textile fabrics are obtainable in this way.
  • an effective amount of an antimicrobial peptide can depend on the specific use pattern, the microbe against which control is most desired and the environment in which the wild-type antimicrobial peptide will be used. Therefore, an effective amount of an antimicrobial peptide is sufficient that inhibition or killing is achieved.
  • a fabric treatment may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
  • a fabric treatment may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • the present disclosure provides compositions having an antimicrobial peptide, a chelating agent, and an excipient, for coating walls, floors and ceilings inside of buildings, and for coating a substrate or non-living material.
  • inventive compositions having an antimicrobial peptide, a chelating agent, and an excipient can be prepared using known techniques for the purpose in mind. Preparations of antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient could be so formulated to also contain a binder to facilitate the binding of the compound to the surface or other substrate. Agents useful for binding are known in the art and tend to be polymeric in form.
  • binder suitable for a compositions to be applied to a wall surface having particular porosities and/or binding characteristics would be different compared to a fiber, yarn, weave or net — thus, a skilled person, based on known teachings, would select a suitable binder based on the desired surface and/or substrate.
  • Typical binders include but are not limited to poly vinyl alcohol, modified starch, poly vinyl acrylate, polyacrylic, polyvinyl acetate co polymer, polyurethane, and modified vegetable oils.
  • Suitable binders can include latex dispersions derived from a wide variety of polymers and co-polymers and combinations thereof.
  • Suitable latexes for use as binders in the inventive compositions comprise polymers and copolymers of styrene, alkyl styrenes, isoprene, butadiene, acrylonitrile lower alkyl acrylates, vinyl chloride, vinylidene chloride, vinyl esters of lower carboxylic acids and alpha, beta-ethylenically unsaturated carboxylic acids, including polymers containing three or more different monomer species copolymerized therein, as well as post-dispersed suspensions of silicones or polyurethanes. Also suitable may be a polytetrafluoroethylene (PTFE) polymer for binding the active ingredient to other surfaces.
  • PTFE polytetrafluoroethylene
  • a surface-treatment composition may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
  • a surface-treatment composition may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • an antimicrobial composition of the present disclosure comprises an antimicrobial peptide, a chelating agent, and an excipient, wherein the excipient can be a diluent or carrier (e.g., such as water), a polymeric binder, and/or additional components such as a dispersing agent, a polymerizing agent, an emulsifying agent, a thickener, an alcohol, a fragrance, or any other inert excipients used in the preparation of sprayable actives known in the art.
  • a diluent or carrier e.g., such as water
  • a polymeric binder e.g., such as water
  • additional components such as a dispersing agent, a polymerizing agent, an emulsifying agent, a thickener, an alcohol, a fragrance, or any other inert excipients used in the preparation of sprayable actives known in the art.
  • a dispersant may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%. [0808] In some embodiments, a dispersant may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • an antimicrobial composition comprising an antimicrobial peptide, a chelating agent, and an excipient, can be prepared in a number of different forms or formulation types, such as suspensions or capsules suspensions. And a person skilled in the art can prepare the relevant composition based on the properties of the wild-type antimicrobial peptide, its uses, and also its application type.
  • the wild-type antimicrobial peptide used in the methods, embodiments, and other aspects of the present disclosure may be encapsulated in a suspension or capsule suspension formulation.
  • An encapsulated wild-type antimicrobial peptide protein can provide improved wash- fastness, and also a longer period of activity.
  • the formulation can be organic based or aqueous based, preferably aqueous based.
  • a suspension may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
  • a suspension may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
  • Microencapsulated wild-type antimicrobial peptides suitable for use in the compositions and methods according to the present disclosure may be prepared with any suitable technique known in the art. For example, various processes for microencapsulating material have been previously developed. These processes can be divided into three categories: physical methods, phase separation, and interfacial reaction.
  • microcapsule wall material and core particles are physically brought together and the wall material flows around the core particle to form the microcapsule.
  • microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase in which the wall material is dissolved and caused to physically separate from the continuous phase, such as by coacervation, and deposit around the core particles.
  • interfacial reaction category microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase and then an interfacial polymerization reaction is caused to take place at the surface of the core particles.
  • concentration of the wild-type antimicrobial peptide and/or chelating agent present in the microcapsules can vary from 0.1 to 99% by weight of the microcapsule.
  • a microencapsulation may contain an amount of an antimicrobial peptide ranging from about 0.005 wt% to about 99 wt%.
  • a microencapsulation may contain an amount of a chelating agent ranging from about 0.005 wt% to about 99 wt%.
  • compositions or formulations described herein can be made using any of the wild-type antimicrobial peptides described herein (e.g., an antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least
  • compositions or formulations described herein can additionally contain other known biologically active agents, such as, for example, a fungicide, herbicide, or insecticide.
  • the combinations used in the antimicrobial compositions of the present disclosure comprising an antimicrobial peptide; a chelating agent; and an excipient, methods, embodiments and other aspects according to the present disclosure, may be formed by mixing all ingredients together with water, and optionally using suitable mixing and/or dispersing aggregates, hi general, such a combination is formed at a temperature of from 10 to 70°C, preferably 15 to 50°C, more preferably 20 to 40°C.
  • an antimicrobial composition of the present disclosure comprising one or more of (Al and A2), (B), (C), and/or (D) is possible, wherein it is possible to use: an antimicrobial peptide (Al) and a chelating agent (A2); solid polymer (B); optional additional additives (D); and to disperse them in the aqueous component (C).
  • an antimicrobial peptide (Al) and a chelating agent (A2) an antimicrobial peptide (Al) and a chelating agent (A2)
  • solid polymer B
  • optional additional additives (D) optional additional additives
  • disperse them in the aqueous component (C) If a binder is present in a composition of the present disclosure, it is preferred to use dispersions of the polymeric binder (B) in water as well as aqueous compositions of the wild-type antimicrobial peptide (Al) and chelating agent (A2) in water which have been separately prepared before.
  • Such separate compositions may contain additional additives for stabilizing (Al and A2) and/or (B) in the respective compositions and are commercially available.
  • additional additives for stabilizing (Al and A2) and/or (B) in the respective compositions are commercially available.
  • additional water (component (C)) are added.
  • combinations of the abovementioned ingredients based on the foregoing scheme are likewise possible, e.g., using a pre-formed dispersion of (Al and A2) and/or (B) and mixing it with solid (Al and A2) and/or (B).
  • a dispersion of the polymeric binder (B) may be a premanufactured dispersion already made by a chemicals manufacturer.
  • dispersions made in small-scale by an end-user.
  • Such dispersions may be made by providing a mixture of about 20 percent of the binder (B) in water, heating the mixture to temperature of 90°C to 100°C and intensively stirring the mixture for several hours. It is possible to manufacture the composition as a final product so that it can be readily used by the end-user for the process according to the present disclosure. And, it is of course similarly possible to manufacture a concentrate, which may be diluted by the end-user with additional water (C) to the desired concentration for use.
  • a composition (having an antimicrobial peptide, a chelating agent, and an excipient) suitable for SSI application or a coating formulation (having an antimicrobial peptide, a chelating agent, and an excipient), contains the active ingredient and a carrier, such as water, and may also one or more co-formulants selected from a dispersant, a wetter, an anti-freeze, a thickener, a preservative, an emulsifier and a binder or sticker.
  • a carrier such as water
  • co-formulants selected from a dispersant, a wetter, an anti-freeze, a thickener, a preservative, an emulsifier and a binder or sticker.
  • an exemplary solid combination of an antimicrobial peptide and a chelating agent is generally milled to a desired particle size, such as the particle size distribution d(0.5) is generally from 3 to 20, preferably 5 to 15, especially 7 to 12, pm.
  • an antimicrobial combination or an antimicrobial composition to the end-user as a kit, e.g., comprising at least a first component of an antimicrobial peptide (Al) and a chelating agent (A2) (either separately or as a mixture); and a second component comprising at least one polymeric binder (B).
  • Further additives (D) may be a third separate component of the kit, or may be already mixed with components (Al and A2) and/or (B).
  • the end-user may prepare the antimicrobial combination for use by mixing (Al) and (A2) and mixing.
  • the end-user may prepare the antimicrobial composition for use by just adding water (C) to the components of the kit and mixing.
  • kits may also be compositions in water.
  • the kit can consist of one composition of an antimicrobial peptide (Al) and a chelating agent (A2) and optionally water
  • the amount of an antimicrobial peptide and a chelating agent thereof can be up to 50, preferably 1 to 50, such as 10 to 40, especially 15 to 30, percent by weight, based on weight of the composition.
  • the amount of polymeric binder (B) may be in the range of 0.01 to 30, preferably 0.5 to 15, more preferably 1 to 10, especially 1 to 5, percent by weight, based on weight of the composition. If present, in general the amount of additional components (D) is from 0.1 to 20, preferably 0.5 to 15, percent by weight, based on weight of the composition.
  • suitable amounts of pigments and/or dyestuffs and/or fragrances are in general 0.01 to 5, preferably 0.1 to 3, more preferably 0.2 to 2, percent by weight, based on weight of the composition.
  • a composition ready for use comprises 0.1 to 40, preferably 1 to 30, percent of components (Al and A2), (B), and optionally (D), the residual amount being water (C).
  • a concentration of a concentrate to be diluted by the end-user may comprise 5 to 70, preferably 10 to 60, percent of components (Al and A2), (B), and optionally (D), the residual amount being water (C).
  • v/v or “% v/v” or “volume per volume” refers to the volume concentration of a solution (“v/v” stands for volume per volume).
  • v/v can be used when both components of a solution are liquids.
  • w/w or “% w/w” or “weight per weight” or “wt/wt” or “% wt/wt” refers to the weight concentration of a composition or solution, i.e., percent weight in weight (“w/w” stands for weight per weight).
  • w/w expresses the number of grams (g) of a constituent in 100 g of solution or mixture.
  • a mixture consisting of 30 g of ingredient X, and 70 g of water would be expressed as “ingredient X 30% w/w.”
  • Percent weight per weight (% w/w) is calculated as follows: (weight of solute (g)/ weight of solution (g)) x 100; or (mass of solute (g)/ mass of solution (g)) x 100.
  • w/v or “% w/v” or “weight per volume” refers to the mass concentration of a solution, i.e., percent weight in volume (“w/v” stands for weight per volume).
  • w/v expresses the number of grams (g) of a constituent in 100 mL of solution. For example, if 1 g of ingredient X is used to make up a total volume of 100 mL, then a “1 % w/v solution of ingredient X” has been made. Percent weight per volume (% w/v) is calculated as follows: (Mass of solute (g)/ Volume of solution (mL)) x 100.
  • an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and at least one excipient; wherein the antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, the chelating agent is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, and the at least one excipient is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition.
  • the antimicrobial composition shall include (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; (2) a chelating agent; and at least one excipient; wherein the (1) antimicrobial peptide (AMP) is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, (2) the chelating agent is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, and the at least one excipient is in an amount ranging from about 0.000001 % w/w to about 99.99999% w/w of the total composition, and wherein the ratio of (1) the antimicrobial peptide (AMP) to the (2) chelating agent, in the composition, ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1 :5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about
  • an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, and at least one excipient, wherein the ratio of (1 ):(2) from about 1 : 10 to about 5000: 1 , or from 1 : 10 to about 5000: 1 , about 1 :5 to about 5000: 1 , about 3 : 10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1 :10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1:10 to about 500:1, or from about 1:10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:1
  • an antimicrobial composition comprises (1) an antimicrobial peptide or an agriculturally acceptable salt thereof, (2) a chelating agent, and at least one excipient, wherein the (1) antimicrobial peptide, comprises, or consists of an amino acid sequence of any one of SEQ ID NOs: 1-19634, and wherein (1) the antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 98%
  • an antimicrobial composition of the present disclosure comprises: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof;
  • the (1) wild- type antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 9%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about6%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about3%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about0%; from about 1
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 9
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide or agriculturally acceptable salt thereof in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 3
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10%
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%,
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10000 to 10000:0.0001.
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1): (2) is a ratio ranging from 1:1 to 10,000:1; or 1:1 to 1000:1; or 1:1 to 100:1; or 1:1 to 90:1; or 1:1 to 80:1 ; or 1:1 to 70:1 ; or 1:1 to 60:1; or 1:1 to 50:1 ; or 1:1 to 40:1; or 1:1 to 30:1; or 1:1 to 20:1; or 1 :1 to 10:1; or 1:1 to 9:1; or 1 :1 to 8:1; or 1:1 to 7:1; or 1:1 to 6:1; or 1 :1 to 5:1; or 1:1 to 4:1; or 1:1 to 3:1; or 1:1 to 2:1; or 2:1 to 1:1; or 3:1 to 1:1; or 4:1 to 1:1; or 5:1 to 1:1; or 6:1 to 1:1; or 7:1 to 1 :1; or 8:1 to 1:1;
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 10,000:0.0001, or 0.0001:10,000 to 1000:0.0001, or 0.0001:10,000 to 100:0.0001, or 0.0001 :10,000 to 100:0.0001; or 0.0001:10,000 to 95:0.0001; or 0.0001:10,000 to 90:0.0001; or 0.0001:10,000 to 85:0.0001; or 0.0001:10,000 to 80:0.0001; or 0.0001:10,000 to 75:0.0001; or 0.0001:10,000 to 70:0.0001; or 0.0001 :10,000 to 65:0.0001; or 0.0001:10,000 to 60:0.0001; or 0.0001 :10,000 to 55:0.0001 ; or 0.0001:10,000 to 50:0.0001; or 0.0001 :10,000 to 45:0.0001 ; or 0.0001 :10,000
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 10:20, 10:25, 10:30, 10:35, 10:40, 10:45, 10:50, 10:55, 10:60, 10:65, 10:70, 10:75, 10:80, 10:85, 10:90, 10:95, 10:100, 20:25, 20:30, 20:35, 20:40, 20:45, 20:50, 20:55, 20:60, 20:65, 20:70, 20:75, 20:80, 20:85, 20:90, 20:95, 20:100, 30:35, 30:40, 30:45, 30:50, 30:55, 30:60, 30:65, 30:70, 30:75, 30:80, 30:85, 30:90, 30:95, 30:100, 40:45,
  • a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 100:95, 100:90, 95:90, 100:80, 95:80, 90:80, 85:80, 100:70, 95:70, 90:70, 85:70, 80:70, 75:70, 100:60, 95:60, 90:60, 85:60, 80:60, 75:60, 70:60, 65:60, 100:50, 95:50, 90:50, 85:50, 80:50, 75:50, 70:50, 65:50, 60:50, 55:50, 100:40, 95:40, 90:40, 85:40, 80:40, 75:40, 70:40, 65:40, 60:40, 55:40, 50:40, 45:40, 100:30, 95:30, 90:30, 85:30, 80:
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10000 to 10000:0.0001.
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001: 10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1): (2) is a ratio ranging from 1:1 to 10,000:1; or 1:1 to 1000:1; or 1:1 to 100:1; or 1:1 to 90:1; or 1:1 to 80:1 ; or 1:1 to 70:1 ; or 1:1 to 60:1; or 1:1 to 50:1 ; or 1:1 to 40:1; or 1:1 to 30:1; or 1:1 to 20:1; or 1 :1 to 10:1; or 1:1 to 9:1; or 1 :1 to 8:1; or 1:1 to 7:1; or 1:1 to 6:1; or 1 :1 to 5:1; or 1:1 to 4:1; or 1:1 to 3:1; or 1:1 to 2:1; or 2:1 to 1:1; or 3:1 to 1:1; or 4:1 to 1:1; or 5:1 to 1:1; or 6:1 to 1:1; or 7:1 to 1 :1; or 8:1 to 1:1;
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 10,000:0.0001, or 0.0001:10,000 to 1000:0.0001, or 0.0001:10,000 to 100:0.0001, or 0.0001 :10,000 to 100:0.0001; or 0.0001:10,000 to 95:0.0001; or 0.0001:10,000 to 90:0.0001; or 0.0001:10,000 to 85:0.0001; or 0.0001:10,000 to 80:0.0001; or 0.0001:10,000 to 75:0.0001; or 0.0001:10,000 to 70:0.0001; or 0.0001 :10,000 to 65:0.0001; or 0.0001:10,000 to 60:0.0001; or 0.0001 :10,000 to 55:0.0001 ; or 0.0001:10,000 to 50:0.0001; or 0.0001 :10,000 to 45:0.0001 ; or 0.0001 :10,000
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 10:20, 10:25, 10:30, 10:35, 10:40, 10:45, 10:50, 10:55, 10:60, 10:65, 10:70, 10:75, 10:80, 10:85, 10:90, 10:95, 10:100, 20:25, 20:30, 20:35, 20:40, 20:45, 20:50, 20:55, 20:60, 20:65, 20:70, 20:75, 20:80, 20:85, 20:90, 20:95, 20:100, 30:35, 30:40, 30:45, 30:50, 30:55, 30:60, 30:65, 30:70, 30:75, 30:80, 30:85, 30:90, 30:95, 30:100, 40:45,
  • a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 100:95, 100:90, 95:90, 100:80, 95:80, 90:80, 85:80, 100:70, 95:70, 90:70, 85:70, 80:70, 75:70, 100:60, 95:60, 90:60, 85:60, 80:60, 75:60, 70:60, 65:60, 100:50, 95:50, 90:50, 85:50, 80:50, 75:50, 70:50, 65:50, 60:50, 55:50, 100:40, 95:40, 90:40, 85:40, 80:40, 75:40, 70:40, 65:40, 60:40, 55:40, 50:40, 45:40, 100:30, 95:30, 90:30, 85:30, 80:
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is present in the composition in an amount ranging from about 0.000001% w/w to about 0.01% w/w of the total weight of the composition, or from about 0.000010% w/w to about 0.00500% w/w, of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000017% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00004% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000024% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000056% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00077% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00399% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000070% w/w to about 0.000400% w/w, of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000088% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000146% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000205% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000292% w/w of the total weight of the composition.
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the concentration of the wild-type antimicrobial peptide ranges from about 0.000001% to about 99.9% w/w of the total composition, for example, in some embodiments the concentration is about 0.00001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%
  • an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide consisting of an amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof;
  • the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w
  • the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.

Abstract

New antimicrobial combinations for use against pathogenic microbes are described, along with methods of making and using the same. The present disclosure is also related to and describes novel combinations of antimicrobial peptides such as nodule-specific cysteine-rich (NCR) peptides, defensins, with chelating agents. New formulations, and new methods of using the antimicrobial combinations for the control of pathogenic microbes are also described

Description

ANTIMICROBIAL PEPTIDE COMBINATIONS
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of, and priority to, United States Provisional Application Serial No. 63/366,609 filed on June 17, 2022, the disclosure of which is incorporated by reference herein in its entirety.
SEQUENCE LISTING
[0002] This application incorporates by reference in its entirety the Sequence Listing XML entitled “225312-530336.xml” (19,709,625 bytes), which was created on May 24, 2023, and filed electronically herewith.
TECHNICAL FIELD
[0003] New antimicrobial combinations comprising an antimicrobial peptide (AMP) and a chelating agent; new formulations; new agricultural compositions; and methods of making and using the same for the control of pathogenic microbes are described.
BACKGROUND
[0004] The lives and livelihoods of millions of people depend on several agriculturally important crops. Deleterious microbes that threaten these agriculturally important crops represent a dire threat to global food security and the economy.
[0005] Microbial infections, e.g., fungal infections, are a particular problem in damp climates, and are of major concern during crop storage; indeed, the degree and severity of fungal infections can be exacerbated by modem growing methods — as harvesting and storage systems frequently provide a favorable environment for these plant pathogens. Adding to the problems caused by microbial infections are the rich diversity of pathogenic microbes (e.g., fungi, bacteria, oomycetes, etc.) that can contribute to plant disease. World- wide international travel has aided in spreading these deleterious microbes to parts of the planet where native plants have evolved no defenses. Moreover, the emphasis on intensive monoculture practices of commercially relevant crops in concert with traditional disease-mitigation strategies has allowed pathogenic microbes to become resistant and thrive. [0006] The incidence of plant diseases has traditionally been controlled by agronomic practices that include crop rotation, the use of agrochemicals, and conventional breeding techniques. The use of chemicals to control plant pathogens, however, increases costs to farmers and causes harmful effects on the ecosystem. Accordingly, consumers and government regulators alike are becoming increasingly concerned with the environmental hazards associated with the production and use of synthetic agrochemicals for protecting plants from pathogens. Thus, there is a significant need for novel alternatives for the control of plant pathogens that possess a lower risk of pollution and environmental hazards than is characteristic of traditional agrochemical-based methods.
[0007] Accordingly, there is a need for alternative, environmentally friendly antimicrobial agents and compositions to protect economically important commodity and staple calorie crops from the threats posed by pathogenic microbes.
SUMMARY
[0008] The present disclosure describes an antimicrobial combination comprising an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
[0009] In addition, the present disclosure describes an antimicrobial composition comprising the antimicrobial combination and an excipient; wherein the antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
[0010] In addition, the present disclosure describes a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, or an antimicrobial composition comprising an antimicrobial composition comprising the antimicrobial combination and an excipient; wherein the antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, to: the pathogenic microbe, a locus of the pathogenic microbe, a food supply of the pathogenic microbe, a habitat of the pathogenic microbe, or a breeding ground of the pathogenic microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the pathogenic microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the pathogenic microbe; or any combination thereof
[0011] In addition, the present disclosure describes an
[0012] In addition, the present disclosure describes an antimicrobial composition comprising: a wild-type nodule-specific cysteine-rich 13 peptide (WT-NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition. [0013] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000016287% w/w to about 0.010863% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition. [0014] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.000034157% w/w to about 0.0075653% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
[0015] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00023018% w/w to about 0.0093402% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[0016] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[0017] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.000030081% w/w to about 0.0014937% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[0018] In addition, the present disclosure describes an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013667% w/w to about 0.0092686% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
BRIEF DESCRIPTION OF THE DRAWINGS
[0019] FIG. 1 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 at 48 hours. Here, the amount of WT- NCR13 required to achieve IC50 in K. lactis cells was 304 ppm. Here, YCT306 = K. lactis. [0020] FIG. 2 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with EDTA at 48 hours. Here, the amount of EDTA required to achieve IC50 in K. lactis cells was 26 μM. Here, YCT306 = K. lactis.
[0021] FIG. 3 depicts a dose response curve showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 and 7 μM EDTA for 48 hours. Here, YCT306 = K. lactis.
[0022] FIG. 4 depicts a dose response curve showing the growth of K. lactis as measured via relative OD600 (%), when treated with WT-NCR13 and 10 μM EDTA for 48 hours. Here, YCT306 = K. lactis.
[0023] FIG. 5 depicts an isobologram showing the effect of WT-NCR13 and EDTA on K. lactis (YCT306). Using 7 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 39.9 ppm (with 1.6% inhibition of growth caused by EDTA). Using 10 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 7.7 ppm (with 4.7% inhibition of growth caused by EDTA). Accordingly, these results suggest a synergistic effect. As shown in the isobologram here, synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
[0024] FIG. 6 depicts a graph showing the growth of M.fructicola as measured via relative OD600 (%), when treated with WT-NCR13 at 72 hours at room temperature. Here, the amount of WT-NCR13 required to achieve IC50 in M. fructicola cells was 2.24 ppm. [0025] FIG. 7 depicts a graph showing the growth of M.fructicola as measured via relative OD600 (%), when treated with EDTA at 72 hours at room temperature. Here, the amount of EDTA required to achieve IC50 in M. fructicola cells was 6.53 μM.
[0026] FIG. 8 depicts a dose response curve showing the growth of M. fructicola as measured via relative OD600 (%), when treated with WT-NCR13 and 3 μM EDTA for 72 hours.
[0027] FIG. 9 depicts a dose response curve showing the growth of M. fructicola as measured via relative OD600 (%), when treated with WT-NCR13 and 5 μM EDTA for 48 hours.
[0028] FIG. 10 depicts an isobologram showing the effect of WT-NCR13 and EDTA on M. fructicola cells. Using 3 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 0.4 ppm (with 28.2% inhibition of growth caused by EDTA). Using 5 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 0.24 ppm (with 43.2% inhibition of growth caused by EDTA). Accordingly, these results suggest a synergistic effect. As shown in the isobologram here, synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
[0029] FIG. 11 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 at 72 hours at room temperature. Here, the amount of WT-NCR13 required to achieve IC50 in B. cinerea cells was 2.17 ppm.
[0030] FIG. 12 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with EDTA at 72 hours at room temperature. Here, the amount of EDTA required to achieve IC50 in B. cinerea cells was 4.78 μM. [0031] FIG. 13 depicts a dose response curve showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 and 3 μM EDTA for 72 hours.
[0032] FIG. 14 depicts a dose response curve showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 and 5 μM EDTA for 48 hours.
[0033] FIG. 15 depicts an isobologram showing the effect of WT-NCR13 and EDTA on B. cinerea cells. Using 3 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 0.56 ppm (with 22.1% inhibition of growth caused by EDTA). Using 5 μM EDTA, the amount of WT-NCR13 required to achieve IC50 was 0.17 ppm (with 55.2% inhibition of growth caused by EDTA). These results suggest a synergistic effect when EDTA is 3 μM; however, at 5 μM of EDTA, the data was inconclusive, as this amount exceeded the IC50 (i.e., 55.2% inhibition).
[0034] FIG. 16 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Botrytis cinerea cells was 4.4611 μM. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0035] FIG. 17 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours.
Here, the amount of PVD1 required to achieve IC50 in Botrytis cinerea cells was 58.555 ppm. [0036] FIG. 18 depicts an isobologram showing the effect of native PVD1 and EDTA on B. cinerea cells.
[0037] FIG. 19 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Monilinia fructicola cells was 5.8344 μM. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0038] FIG. 20 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours. Here, the amount of PVD1 required to achieve IC50 in Monilinia fructicola cells was 0.93984 ppm.
[0039] FIG. 21 depicts an isobologram showing the effect of native PVD1 and EDTA on Monilinia fructicola cells.
[0040] FIG. 22 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Phytophthora infestans cells was 14.584 ppm. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0041] FIG. 23 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with native PVD1 , and as measured via relative OD600 (%) after 96 hours. Here, the amount of PVD1 required to achieve IC50 in Phytophthora infestans cells was 152.5 ppm.
[0042] FIG. 24 depicts an isobologram showing the effect of native PVD1 and EDTA on Phytophthora infestans cells.
[0043] FIG. 25 depicts a dose-response curve showing the growth of Cercospora sojina when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Cercospora sojina cells was 93.491 ppm. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0044] FIG. 26 depicts a dose-response curve showing the growth of Cercospora sojina when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours. Here, the amount of PVD1 required to achieve IC50 in Cercospora sojina cells was 302.82 ppm.
[0045] FIG. 27 depicts an isobologram showing the effect of native PVD1 and EDTA on Cercospora sojina cells.
[0046] FIG. 28 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Fusarium graminearum cells was 54.782 ppm. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0047] FIG. 29 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours. Here, the amount of PVD1 required to achieve IC50 in Fusarium graminearum cells was 17.35 ppm.
[0048] FIG. 30 depicts an isobologram showing the effect of native PVD1 and EDTA on Fusarium graminearum cells.
[0049] FIG. 31 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. Here, the amount of EDTA required to achieve IC50 in Aspergillus niger cells was 21.184 ppm. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0050] FIG. 32 depicts a dose-response curve showing the growth of Aspergillus niger when treated with native PVD1, and as measured via relative OD600 (%) after 96 hours. Here, the amount of PVD1 required to achieve IC50 in Aspergillus niger cells was 1.6602 ppm.
[0051] FIG. 33 depicts an isobologram showing the effect of native PVD1 and EDTA on Aspergillus niger cells. [0052] FIG. 34 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0053] FIG. 35 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
[0054] FIG. 36 depicts an isobologram showing the effect of PVDla and EDTA on B. cinerea cells.
[0055] FIG. 37 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0056] FIG. 38 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with PVDla, and as measured via relative OD600 (%) after 96 hours. [0057] FIG. 39 depicts an isobologram showing the effect of PVDla and EDTA on Monilinia fructicola cells.
[0058] FIG. 40 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%).
[0059] FIG. 41 depicts a dose-response curve showing the growth of Phytophthora infestans when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
[0060] FIG. 42 depicts an isobologram showing the effect of PVDla and EDTA on Phytophthora infestans cells.
[0061] FIG. 43 depicts a dose-response curve showing the growth of Cercospora sojina when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box on the left provides an estimate of the EDTA dose required for targeted inhibition based on this experimental IC50 as determined in the dose response curve; this estimation in turn helps to determine the EDTA dose required for combination bioassay, i.e., doses less than IC50 but having some level of effective inhibition on microbial growth. The box on the right shows the actual EDTA doses used in this experiment, and show the estimated inhibition (%). [0062] FIG. 44 depicts a dose-response curve showing the growth of Cercospora sojina when treated with PVDla, and as measured via relative OD600 (%) after 96 hours. [0063] FIG. 45 depicts an isobologram showing the effect of PVDla and EDTA on Cercospora sojina cells.
[0064] FIG. 46 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0065] FIG. 47 depicts a dose-response curve showing the growth of Fusarium graminearum when treated with PVDla, and as measured via relative OD600 (%) after 96 hours.
[0066] FIG. 48 depicts an isobologram showing the effect of PVDla and EDTA on Fusarium graminearum cells.
[0067] FIG. 49 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0068] FIG. 50 depicts a dose-response curve showing the growth of Aspergillus niger when treated with PVDla, and as measured via relative OD600 (%) after 96 hours. [0069] FIG. 51 depicts an isobologram showing the effect of PVDla and EDTA on Aspergillus niger cells.
[0070] FIG. 52 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0071] FIG. 53 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with Dm-AMP1a, and as measured via relative OD600 (%) after 96 hours.
[0072] FIG. 54 depicts an isobologram showing the effect of Dm-AMP1a and EDTA on B. cinerea cells.
[0073] FIG. 55 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%). [0074] FIG. 56 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with Dm-AMP1a, and as measured via relative OD600 (%) after 96 hours. [0075] FIG. 57 depicts an isobologram showing the effect of Dm-AMP1a and EDTA on Monilinia fructicola cells.
[0076] FIG. 58 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0077] FIG. 59 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
[0078] FIG. 60 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on B. cinerea cells.
[0079] FIG. 61 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0080] FIG. 62 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
[0081] FIG. 63 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on Monilinia fructicola cells.
[0082] FIG. 64 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0083] FIG. 65 depicts a dose-response curve showing the growth of Aspergillus niger when treated with Rs-AFP2a, and as measured via relative OD600 (%) after 96 hours.
[0084] FIG. 66 depicts an isobologram showing the effect of Rs-AFP2a and EDTA on Aspergillus niger cells.
[0085] FIG. 67 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0086] FIG. 68 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
[0087] FIG. 69 depicts an isobologram showing the effect of SPE10a and EDTA on B. cinerea cells.
[0088] FIG. 70 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%). [0089] FIG. 71 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
[0090] FIG. 72 depicts an isobologram showing the effect of SPE10a and EDTA on
Monilinia fructicola cells.
[0091] FIG. 73 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0092] FIG. 74 depicts a dose-response curve showing the growth of Aspergillus niger when treated with SPE10a, and as measured via relative OD600 (%) after 96 hours.
[0093] FIG. 75 depicts an isobologram showing the effect of SPE10a and EDTA on
Aspergillus niger cells.
[0094] FIG. 76 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0095] FIG. 77 depicts a dose-response curve showing the growth of Botrytis cinerea when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
[0096] FIG. 78 depicts an isobologram showing the effect of So-D2 and EDTA on B. cinerea cells.
[0097] FIG. 79 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0098] FIG. 80 depicts a dose-response curve showing the growth of Monilinia fructicola when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
[0099] FIG. 81 depicts an isobologram showing the effect of So-D2 and EDTA on Monilinia fructicola cells.
[0100] FIG. 82 depicts a dose-response curve showing the growth of Aspergillus niger when treated with EDTA, and as measured via relative OD600 (%) after 96 hours. The box shows the doses of EDTA evaluated, and the corresponding percent inhibition (%).
[0101] FIG. 83 depicts a dose-response curve showing the growth of Aspergillus niger when treated with So-D2, and as measured via relative OD600 (%) after 96 hours.
[0102] FIG. 84 depicts an isobologram showing the effect of So-D2 and EDTA on
Aspergillus niger cells.
DETAILED DESCRIPTION [0103] DEFINITIONS
[0104] “5’ -end” and “3 ’-end” refers to the directionality, i.e., the end-to-end orientation of a nucleotide polymer (e.g., DNA). The 5 ’-end of a polynucleotide is the end of the polynucleotide that has the fifth carbon.
[0105] “Affect” refers to how a something influences another thing, e.g., how a peptide, polypeptide, protein, drug, or chemical influences a microbe.
[0106] “Agent” refers to one or more chemical substances, molecules, nucleotides, polynucleotides, peptides, polypeptides, proteins, poisons, insecticides, pesticides, organic compounds, inorganic compounds, prokaryote organisms and agents produced therefrom, or eukaryote organisms and agents produced therefrom.
[0107] “Agriculturally acceptable salt” is synonymous with pharmaceutically acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
[0108] “Agriculturally-acceptable carrier” covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in agricultural formulation technology; these are well known to those skilled in agricultural formulations. [0109] “Agriculturally acceptable salt” is used herein synonymously with the term “pharmaceutically acceptable salt.”
[0110] “Alignment” refers to a method of comparing two or more sequences (e.g., nucleotide, polynucleotide, amino acid, peptide, polypeptide, or protein sequences) for the purpose of determining their relationship to each other. Alignments are typically performed by computer programs that apply various algorithms, however, it is also possible to perform an alignment by hand. Alignment programs typically iterate through potential alignments of sequences and score the alignments using substitution tables, employing a variety of strategies to reach a potential optimal alignment score. Commonly-used alignment algorithms include, but are not limited to, CLUSTALW (see Thompson J. D., Higgins D. G., Gibson T. J., CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice, Nucleic Acids Research 22: 4673-4680, 1994); CLUSTALV (see Larkin M. A., et al., CLUSTALW2, ClustalW and ClustalX version 2, Bioinformatics 23(21): 2947-2948, 2007); Mafft; Kalign; ProbCons; and T-Coffee (see Notredame et al., T-Coffee: A novel method for multiple sequence alignments, Journal of Molecular Biology 302: 205-217, 2000). Exemplary programs that implement one or more of the foregoing algorithms include, but are not limited to, MegAlign from DNAStar (DNAStar, Inc. 3801 Regent St. Madison, Wis. 53705), MUSCLE, T-Coffee, CLUSTALX, CLUSTALV, JalView, Phylip, and Discovery Studio from Accelrys (Accelrys, Inc., 10188 Telesis Ct, Suite 100, San Diego, Calif. 92121). hi some embodiments, an alignment will introduce “phase shifts” and/or “gaps” into one or both of the sequences being compared in order to maximize the similarity between the two sequences, and scoring refers to the process of quantitatively expressing the relatedness of the aligned sequences.
[0111] “Ameliorate” or “amelioration” includes the arrest, prevention, decrease, or improvement in one or more the symptoms, signs, and features of the disease being treated, both temporary and long-term.
[0112] As used herein, “antimicrobial” is generally used to refer to the ability of a combination or composition of the present disclosure, to increase mortality or inhibit growth rate of microbes.
[0113] “Antimicrobial activity” means that upon or after exposing the microbe to the combinations or compositions of the present disclosure, the microbe either dies, stops, or slows its cellular processes; stops or slows its maintenance; stops or slows its growth; fails to reproduce; and the like.
[0114] “Antimicrobial effect” refers to inhibition or stoppage of the normal metabolic processes required for continued life, or continued growth of a microbe. “Antimicrobial effect” includes killing of any individual or group of microbes.
[0115] “Antimicrobial combination” or “combination” or “combination of the present disclosure” refers to the result of combining two or more separate components (e.g., a first component and one or more additional components); wherein the combination of the two or more separate components has antimicrobial effect. Thus, as used herein, a “combination” refers to an association of two or more separate components, e.g., the association of an antimicrobial peptide (AMP) and a chelating agent (e.g., EDTA).
[0116] In some embodiments, a combination can be a “mixture.” For example, in some embodiments, a mixture refers to a combination of a first component, and one or more additional components, wherein the first component and the one or more additional components are present together in a single entity (e.g., a single unit). Thus, in some embodiments, a mixture can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components are present in admixture for simultaneous administration. Accordingly, in some embodiments, a combination can refer to the association of an AMP and a chelating agent; wherein the AMP and the chelating agent are present in a single entity (e.g., an admixture for simultaneous administration).
[0117] In some embodiments, a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components, are present separately (e.g., more than one unit). For example, in some embodiments, a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components may be administered separately, sequentially, simultaneously, concurrently or chronologically staggered.
[0118] Accordingly, in some embodiments, a combination can refer to the association of an AMP and a chelating agent; and wherein the AMP and the chelating agent are present separately (e.g., different units for separate, sequential, simultaneous, concurrent or chronologically- staggered administration) .
[0119] In some embodiments, a combination can refer to the separate, sequential, simultaneous, concurrent or chronologically-staggered application of two or more separate components (e.g., an AMP and a chelating agent).
[0120] For example, in some embodiments, a “combination” refers to the result of a simultaneous application of both an AMP and a chelating agent.
[0121] In another embodiment, a “combination” refers to the result of a separate application of an AMP and a chelating agent.
[0122] In a further embodiments, a “combination” refers to the result of a sequential application of two or more separate components, e.g., a first application an AMP, followed by a second application of a chelating agent, or vice versa. Where the application is sequential or separate, the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0123] “Antimicrobial composition” refers to a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient. In some embodiments, an antimicrobial composition is distinct from an antimicrobial combination because the former further comprises one or more excipients. [0124] “Antimicrobially-effective amount” refers to an amount of (1) an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or (2) an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; that is sufficient to: inhibit a microbe, bring about the death of at least one microbe; noticeably reduce or decrease microbe growth, feeding, or normal physiological development; inhibit or decrease the normal microbe cellular processes, including maintenance and growth; and/or attenuate or decrease the severity of a microbial infection. This amount will vary depending on such factors including but not limited to: the specific target microbe to be controlled; the specific environment, location, plant, crop, or agricultural site to be treated; the environmental conditions, method, rate, concentration, stability, and quantity applied. Further, those having ordinary skill in the art will recognize that the antimicrobially-effective amount may also vary with respect to climatic conditions, environmental considerations, and/or frequency of application and/or severity of microbe infestation. Antimicrobially-effective amounts can be measured by use of assays that measure the reduction in growth or decline in their populations of a microbe. One measure of reduction can be to express the decrease in population in logarithmic scale typical of a specific microbial species. That is, a 1 log reduction is equivalent to a 90% reduction versus a control, a 2 log reduction is a 99% reduction, etc.
[0125] “Antimicrobial peptide” or “AMP” or “peptide of the present disclosure” refers to any of the peptides described herein that exert an antimicrobial effect against one or more pathogenic microbes.
[0126] In some embodiments, an antimicrobial peptide (AMP) can be a wild-type peptide, or a mutant peptide. As used herein, where an embodiment describes an antimicrobial combination or an AMP that is a wild-type antimicrobial peptide, the embodiment will describe the AMP as such, e.g., “in some embodiments, an antimicrobial combination can comprise a wild-type antimicrobial peptide . . . .”
[0127] In some embodiments, an AMP can be a peptide having: (i) a size of about 10 kDa or less; (ii) a cationic charge, often ranging from +2 to +7 at pH 7; and (iii) amphipathic stereogeometry, conferring relatively polarized hydrophilic and hydrophobic facets.
[0128] In some embodiments, an AMP can be an NCR peptide or a defensin. For example, in some embodiments, an AMP of the present disclosure can be a wild-type antimicrobial peptide, e.g., a wild-type NCR peptide or defensin. Exemplary wild-type antimicrobial peptides are provide SEQ ID NOs: 1-19628, or 19634.
[0129] In some embodiments, an AMP can be a plant defensin.
[0130] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif.
[0131] In some embodiments, an AMP can be a plant defensin having one or more disulfide bonds. In some embodiments, an AMP can be a peptide having a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C- terminus of a linear amino acid sequence). In some embodiments, an AMP can be a peptide having 3 or 4 disulfide bonds, hi some embodiments, an AMP can be a peptide having a disulfide bond connectivity pattern wherein the disulfide bonds are formed between cysteine residues at the following positions: 1-8, 2-5, 3-6, 4-7.
[0132] In some embodiments, an AMP can have a “gamma core” motif. As used herein, the term “gamma core” refers to a conserved GXC-C or GXC motif having two antiparallel β-sheets, with an interposed short turn region, and the following characteristics: (1) net cationic charge (+0.5 to +7) with basic residues typically polarized along its axis; (2) periodic charge and hydrophobicity yielding amphipathic stereogeometry; and (3) participation in one to four disulfide bonds. In some embodiments, this motif may constitute the entire peptide, or it may link to adjacent structural domains.
[0133] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); and 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7.
[0134] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7; and a “gamma core” motif.
[0135] In some embodiments, an antimicrobial peptide of the present disclosure can be a mutant or variant of a wild-type antimicrobial peptide. For example, in some embodiments, an AMP comprises a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), relative to a wild-type or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived. Accordingly, in some embodiments, an AMP comprises an alteration, variation, or modification that can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition), in a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, relative to the wildtype or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
[0136] In some embodiments, an AMP can be a mutant peptide having an amino acid sequence as set forth in any one of SEQ ID NOs: 19630-19633. For example, in some embodiments, an AMP can be selected from any one of: PvD1a (SEQ ID NO: 19630); Dm- AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); or SPE10a (SEQ ID NO: 19633).
[0137] In some illustrative embodiments, an AMP can be any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0138] In some embodiments, the term “antimicrobial peptide” can refer to an isolated peptide. In yet other embodiments, antimicrobial peptide can refer to the peptide and fermentation beer, i.e., fermentation beer comprising the antimicrobial peptide. As used herein, the term “fermentation beer” refers to spent fermentation medium, i.e., fermentation medium supernatant after removal of organisms, that has been inoculated with and consumed by a transformed host cell (e.g., a recombinant cell operable to express an AMP of the present disclosure), hi some embodiments, fermentation beer refers to the solution that is recovered following the fermentation of the transformed host cell. The term “fermentation” refers broadly to the enzymatic and anaerobic or aerobic breakdown of organic substances (e.g., a carbon substrate) nutrient substances by microorganisms under controlled conditions (e.g., temperature, oxygen, pH, nutrients, and the like) to produce fermentation products (e.g., one or more peptides of the present disclosure). While fermentation typically describes processes that occur under anaerobic conditions, as used herein it is not intended that the term be solely limited to strict anaerobic conditions, as the term “fermentation” used herein may also occur processes that occur in the presence of oxygen.
[0139] “Agriculturally-acceptable carrier” covers all adjuvants, inert components, dispersants, surfactants, tackifiers, binders, etc. that are ordinarily used in agricultural formulation technology; these are well known to those skilled in such formulations.
[0140] “Agriculturally acceptable salt” is synonymous with pharmaceutically acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
[0141] “Applying” or “application” or “apply” or “administering” or “administration” or “administer” means to dispense and/or otherwise provide, and refers to any method of application or route of administration. For example, applying can refer to, e.g., application of combination of an AMP or an agriculturally acceptable salt thereof, and a chelating agent; as a combination, a mixture, or a composition further comprising one or more excipients, e.g., a sprayable composition, a foam; a burning formulation; a fabric treatment; a surfacetreatment; a dispersant; a microencapsulation, and the like. By “co-application” or “coadminister” it is meant that a combination or composition described herein is applied or administered at the same time, just prior to, or just after the application of: an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and optionally, one or more additional agents or excipients, also referred to herein as a “additional agent.” The antimicrobial peptide of the present disclosure, and chelating agents of the present disclosure, can be administered alone or can be co-administered to the locus of a microbe. Coapplication or co-administration is meant to include simultaneous or sequential application. [0142] “bp” or “base pair” refers to a molecule comprising two chemical bases bonded to one another. For example, a DNA molecule consists of two winding strands, wherein each strand has a backbone made of an alternating deoxyribose and phosphate groups. Attached to each deoxyribose is one of four bases, i.e., adenine (A), cytosine (C), guanine (G), or thymine (T), wherein adenine forms a base pair with thymine, and cytosine forms a base pair with guanine.
[0143] “C-terminus” or “C-terminal” refers to the free carboxyl group (i.e., -COOH) that is positioned on the terminal end of a polypeptide.
[0144] “Chelating agent” or “chelator” or “chelants” or “complexing agents” or “sequestering agents” (all used interchangeably) refer to any agent that binds to a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation — thereby forming a metal complex known as a “chelate.” Thus, as used herein, the term “chelate” includes a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation. In some embodiments, the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p-block metal.
[0145] “Complementary” refers to the topological compatibility or matching together of interacting surfaces of two polynucleotides as understood by those of skill in the art. Thus, two sequences are “complementary” to one another if they are capable of hybridizing to one another to form a stable anti-parallel, double-stranded nucleic acid structure. A first polynucleotide is complementary to a second polynucleotide if the nucleotide sequence of the first polynucleotide is substantially identical to the nucleotide sequence of the polynucleotide binding partner of the second polynucleotide, or if the first polynucleotide can hybridize to the second polynucleotide under stringent hybridization conditions. Thus, the polynucleotide whose sequence 5’-TATAC-3’ is complementary to a polynucleotide whose sequence is 5’- GTATA-3’.
[0146] “Conservative amino acid substitutions” refer to amino acid substitutions that take place within the full-length amino acid sequence of a protein, and not outside of the full- length sequence. As used herein, the term “conservative amino acid substitutions” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include: amino acids with basic side chains (e.g., lysine, arginine, histidine); acidic side chains (e.g., aspartic acid, glutamic acid); polar, negatively charged residues and their amides (e.g., aspartic acid, asparagine, glutamic, acid, glutamine; uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine); small aliphatic, nonpolar or slightly polar residues (e.g., Alanine, serine, threonine, proline, glycine); nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); large aliphatic, nonpolar residues (e.g., methionine, leucine, isoleucine, valine, cystine); beta-branched side chains (e.g., threonine, valine, isoleucine); aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine); large aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan).
[0147] Amino acid substitutions may be made in nonconserved regions that retain function. In general, such substitutions would not be made for conserved amino acid residues or for amino acid residues residing within a conserved motif, where such residues are essential for protein activity. Examples of residues that are conserved and that may be essential for protein activity include, for example, residues that are identical between all proteins contained in an alignment of similar or related toxins to the sequences of the embodiments (e.g., residues that are identical in an alignment of homologs). Examples of residues that are conserved but that may allow conservative amino acid substitutions and still retain activity include, for example, residues that have only conservative substitutions between all proteins contained in an alignment of similar or related toxins to the sequences of the embodiments (e.g., residues that have only conservative substitutions between all proteins contained in the alignment of the homologs). However, one of skill in the art would understand that functional variants may have minor conserved or nonconserved alterations in the conserved residues. Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff, et al., (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), herein incorporated by reference.
[0148] In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, (1982) J Mol Biol. 157(l):105-32). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
[0149] It is known in the art that certain amino acids may be substituted by other amino acids having a similar hydropathic index or score and still result in a protein with similar biological activity, i.e., still obtain a biological functionally equivalent protein. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics (Kyte and Doolittle, ibid). These are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4); threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine (-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5); glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine (-3.9) and arginine (-4.5). In making such changes, the substitution of amino acids whose hydropathic indices are within +2 is preferred, those which are within +1 are particularly preferred, and those within +0.5 are even more particularly preferred.
[0150] It is also understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Pat. No. 4,554,101, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein.
[0151] As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0.+0.1); glutamate (+3.0.+0.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5.+0.1); alanine (-0.5); histidine (-0.5); cysteine (- 1.0); methionine (-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine (-2.3); phenylalanine (-2.5); tryptophan (-3.4).
[0152] “Culture” or “cell culture” refers to the maintenance of cells in an artificial, in vitro environment.
[0153] “Culturing” refers to the propagation of organisms on or in various kinds of media. For example, the term “culturing” can mean growing a population of cells under suitable conditions in a liquid or solid medium, hi some embodiments, culturing refers to fermentative recombinant production of a peptide of the present disclosure (e.g., a NCR13 peptide, a defensin, etc.) and/or other desired end products (typically in a vessel or reactor). [0154] “Cystine” refers to an oxidized cysteine-dimer. Cystines are sulfur-containing amino acids obtained via the oxidation of two cysteine molecules, and are linked with a disulfide bond.
[0155] “Defensin” or “defensin peptide” refers to a peptide belonging to the defensin family, which is a large family of cationic, cysteine-rich antimicrobial peptides found in vertebrate and invertebrate animals, plants, and fungi. Defensins are host defense peptides, with members displaying either direct antimicrobial activity, immune signaling activities, or both. Exemplary defensins are provided herein, having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19634
[0156] “Disulfide bond” or “disulfide bridge” refers to a covalent bond between two cysteine residues derived by the coupling of two thiol groups on their side chains. In some embodiments, a disulfide bond occurs via the oxidative folding of two different thiol groups (-SH) present in a polypeptide, hi some embodiments, a polypeptide can comprise four, six, or eight different thiol groups (i.e., four, six, or eight cysteine residues each containing a thiol group); thus, in some embodiments, a polypeptide can form two, three, or more intramolecular disulfide bonds.
[0157] “Disulfide bond scaffold” refers to the to the three-dimensional spatial arrangement of disulfide bonds that is shared between two or more proteins (disulfide bond structural motif), and subunits shared between two or more proteins.
[0158] “Disulfide bond structural motif’ refers to the three-dimensional spatial arrangement of disulfide bonds that is shared between two or more proteins.
[0159] “DNA” refers to deoxyribonucleic acid, comprising a polymer of one or more deoxyribonucleotides or nucleotides (i.e., adenine [A], guanine [G], thymine [T], or cytosine [C]), which can be arranged in single-stranded or double-stranded form. For example, one or more nucleotides creates a polynucleotide.
[0160] “Excipient” refers to any agriculturally acceptable additive, carrier, surfactant, emulsifier, thickener, preservative, solvent, disintegrant, glidant, lubricant, diluent, filler, bulking agent, binder, emollient, stiffening agent, stabilizer, solubilizing agents, dispersing agent, suspending agent, antioxidant, antiseptic, wetting agent, humectant, fragrant, suspending agents, pigments, colorants, isotonic agents, viscosity enhancing agents, mucoadhesive agents, and/or any combination thereof, that can be added to a composition, preparation, and/or formulation, which may be useful in achieving a desired modification to the characteristics of the composition, preparation, and/or formulation. Such modifications include, but are not limited to, physical stability, chemical stability, therapeutic efficacy, and/or any combination thereof, hi some embodiments, excipients can be formulated alongside a combination of a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, when preparing an antimicrobial composition, e.g., for the purpose of bulking up compositions (thus often referred to as bulking agents, fillers or diluents). In yet other embodiments, an excipient can be used to provide stability, or prevent contamination (e.g., microbial contamination). In other embodiments, an excipient can be used to confer a physical property to a composition (e.g., a composition that is a dry granular, or dry flowable powder physical form). Reference to an excipient includes both one and more than one such excipients. Suitable excipients are described in Remington's Pharmaceutical Sciences, by E. W. Martin, the disclosure of which is incorporated herein by reference in its entirety.
[0161] “IC50” or “IC50” refers to half-maximal inhibitory concentration, which is a measurement of how much of an agent is needed to inhibit a biological process by half, thus providing a measure of potency of said agent.
[0162] “Identity” refers to a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing said sequences. The term “identity” also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences. “Identity” and “similarity” can be readily calculated by any one of the myriad methods known to those having ordinary skill in the art, including but not limited to those described in: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994:, Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988), the disclosures of which are incorporated herein by reference in their entireties. Furthermore, methods to determine identity and similarity are codified in publicly available computer programs. For example in some embodiments, methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(1): 387 (1984)), BLASTP, BLASTN, and FASTA (Altschul, S. F. et al., J. Molec. Biol. 215: 403-410 (1990). The BLAST X program is publicly available from NCBI and other sources (BLAST Manual, Altschul, S., et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S., et al., J. Mol. Biol. 215: 403-410 (1990), the disclosures of which are incorporated herein by reference in their entireties.
[0163] “Inhibiting” or “inhibit” or “combating” or “combat” or “controlling” or “control,” or any variation of these terms, refers to making something (e.g., the number of microbes, the functions and/or activities of the microbes, and/or the deleterious effect of the microbe on a plant or animal susceptible to attack thereof) less in size, amount, intensity, or degree. For example, in some embodiments, the application of an antimicrobially-effective amount of antimicrobial combination comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent, to (i) the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; (ii) a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; (iii) an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or (iv) a combination thereof, results in the following effect: a decrease in the number of microbes; an increase in the susceptibility of the microbe to one or more antimicrobial agents; and/or inhibition or impairment of one or more of the microbe’ s activities, such as any physiological function required for normal physiological maintenance and/or survival and/or reproduction (e.g. respiration, membrane integrity, energy utilization, synthesis of vital building blocks e.g. nucleic acids, amino acids, biochemical metabolites), growth, reproduction, and/or any other parameter that is essential to the microbe’s survival and/or reproduction, relative to the number of microbes or activities thereof that had not been exposed to a antimicrobially- effective amount of an antimicrobial combination comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent.
[0164] In some embodiments, combating, controlling, or inhibiting a microbe, includes any measurable decrease or complete inhibition to achieve a desired result. For example, there may be a decrease of about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more, in the number of microbes or the activities thereof treated with the compositions of the present disclosure, compared to untreated microbes. About as used herein means within ± 10%, preferably ± 5% of a given value. [0165] In some embodiments, combating, controlling, or inhibiting a microbe, includes any measurable increase in susceptibility of a microbe to one or more antimicrobial agents to achieve a desired result. For example, there may be an increase in susceptibility of the microbe of about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or more, in the susceptibility of microbes treated with the compositions of the present disclosure, compared to untreated microbes. About as used herein means within ± 10%, preferably ± 5% of a given value, for example the value: 2, contemplates a range from 1.8 to 2.2, or a range from 2.1 to 1.9 and all values and integers therebetween.
[0166] Thus, in some embodiments, the terms “inhibiting” or “combating, controlling, or inhibiting a microbe,” refers to: a decrease in the number of microbes; an increase in the susceptibility of the microbe to one or more antimicrobial agents; and/or inhibition or impairment of one or more of the microbe’ s activities or functions, such as any physiological function required for normal physiological maintenance and/or survival and/or reproduction (e.g. respiration, membrane integrity, energy utilization, synthesis of vital building blocks e.g. nucleic acids, amino acids, biochemical metabolites), growth, reproduction, and/or any other parameter that is essential to the microbe’s survival and/or reproduction, when an antimicrobially-effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide is applied to (i) the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; (ii) a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; (iii) an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or (iv) a combination thereof, that is at least about 0.1%, at least about 0.2%, at least about 0.3%, at least about 0.4%, at least about 0.5%, at least about 0.6%, at least about 0.7%, at least about 0.8%, at least about 0.9%, at least about 1 %, at least about 1.25 %, at least about 1.5%, at least about 1.75%, at least about 2%, at least about 2.25%, at least about 2.5%, at least about 2.75%, at least about 3%, at least about 3.25%, at least about 3.5%, at least about 3.75%, at least about 4%, at least about 4.25%, at least about 4.5%, at least about 4.75%, at least about 5%, at least about 5.25%, at least about 5.5%, at least about 5.75%, at least about 6%, at least about 6.25%, at least about 6.5%, at least about 6.75%, at least about 7%, at least about 7.25%, at least about 7.5%, at least about 7.75%, at least about 8%, at least about 8.25%, at least about 8.5%, at least about 8.75%, at least about 9%, at least about 9.25%, at least about 9.5%, at least about 9.75%, at least about 10%, at least about 11%, at least about 12%, at least about 13%, at least about 14%, at least about 15%, at least about 16%, at least about 17%, at least about 18%, at least about 19%, at least about 20%, at least about 21 %, at least about 22%, at least about 23%, at least about 24%, at least about 25%, at least about 26%, at least about 27%, at least about 28%, at least about 29%, at least about 30%, at least about 31 %, at least about 32%, at least about 33%, at least about 34%, at least about 35%, at least about 36%, at least about 37%, at least about 38%, at least about 39%, at least about 40%, at least about 41%, at least about 42%, at least about 43%, at least about 44%, at least about 45%, at least about 46%, at least about 47%, at least about 48%, at least about 49%, at least about 50%, at least about 50%, at least about 51%, at least about 52%, at least about 53%, at least about 54%, at least about 55%, at least about 56%, at least about 57%, at least about 58%, at least about 59%, at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 100%, or a greater than a 100%, relative to the number of microbes; the level of the susceptibility of the microbes to one or more antimicrobial agents; and/or the activities or functions of the microbes that have not received a that have received a antimicrobially-effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
[0167] “in vivo” refers to the natural environment (e.g., an animal or a cell) and to processes or reactions that occur within a natural environment.
[0168] “Inoperable” refers to the condition of a thing not functioning, malfunctioning, or no longer able to function.
[0169] “Isolated” refers to separating a thing and/or a component from its natural environment, e.g., a wild-type antimicrobial peptide (such as a WT NCR13 peptide) isolated from an organism means that peptide is separated from its natural environment.
[0170] “kb” refers to kilobase, i.e., 1000 bases. As used herein, the term “kb” means a length of nucleic acid molecules. For example, 1 kb refers to a nucleic acid molecule that is 1000 nucleotides long. A length of double- stranded DNA that is 1 kb long, contains two thousand nucleotides (i.e., one thousand on each strand). Alternatively, a length of singlestranded RNA that is 1 kb long, contains one thousand nucleotides.
[0171] “kDa” refers to kilodalton, a unit equaling 1,000 daltons; a “Dalton” is a unit of molecular weight (MW). [0172] “Knockdown dose 50” or “KD50” refers to the median dose required to cause paralysis or cessation of movement in 50% of a population.
[0173] “LC50” or “lethal concentration 50%” refers to the concentration of an agent required to kill 50% of a population.
[0174] “Locus of a microbe” refers to the habitat of a microbe; food supply of a microbe; breeding ground of a microbe; area inhabited or colonized by a microbe; material infested, eaten, or used by a microbe; and/or any environment in which a microbe inhabits, uses, is present in, or is expected to be. In some embodiments, the locus of a microbe includes, without limitation, a microbe habitat; a microbe food supply; a microbe breeding ground; a microbe area; a microbe environment; any surface or location that may be frequented and/or infested by a microbe; any plant or animal, or a locus of a plant or animal, susceptible to attack by a microbe; and/or any surface or location where a microbe may be found, may be expected to be found, or is likely to be attacked by a microbe.
[0175] “Medium” (plural “media”) refers to a nutritive solution for culturing cells in cell culture.
[0176] “Metal ion” refers to an atom or compound that has an electric charge. Generally, “metal ions” are cations, e.g., a positively charged ion, and can be represented as Mz+, where z is the electrical charge. “Metal ions” may be dissolved in water, can be referred to as “metal ion in aqueous solution” or “aqua ion,” and may be represented by the formula [M(H20)n]z+, where n is the solvation number and z is the electrical charge.
[0177] “Metal-ion chelating agent” refers to a chelating agent operable to chelate a metal ion, e.g., a chelating agent operable to chelate one of the following metal ions: Al3+; Ag+; AS3+; AU+; AU3+; Ba2+; Be2+; Ca2+; Cd2+; Co2+; Co3+; Cr2+; Cr3+; Cs+; Cu+; Cu2+; Fe2+; Fe3+; Ga3+; Hg2+; Hg22+; In3+; K+; Li+; Mg2+; Mn2+; Na+; Ni2+; Pb2+; Pb++, Sn2+; Sn++; Sr2+; and/or Zn2+.
[0178] “Microbe” refers to any microscopic organism, e.g., any multi-cellular or unicellular microorganism, or a virus, including all of the prokaryotes, namely the eubacteria and archaeabacteria, and various forms of eukaryote, comprising the protozoa, fungi (e.g., yeast). Thus, as used herein, “microbe” refers to all bacteria, all archaea, unicellular protista, unicellular animals, unicellular plants, unicellular fungi, unicellular algae, all protozoa, and all chromista. In some embodiments, a microbe can be a pathogenic microbe, wherein the microbe causes an infection or disease in a living organism when introduced into said organism; or wherein the presence of the microbe is deleterious to the organism. For example, in some embodiments, a microbe can be a pathogen to plants, e.g., a phytopathogen, such as a bacterium, a protozoan, or a fungus.
[0179] “MOA” refers to mechanism of action.
[0001] “Molecular weight (MW)” refers to the mass or weight of a molecule, and for proteins is typically measured in “daltons (Da)” or kilodaltons (kDa). In some embodiments, MW can be calculated using sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), gel chromatography, analytical ultracentrifugation, mass spectrometry, or light scattering. In some embodiments, the SDS-PAGE method is as follows: the sample of interest is separated on a gel with a set of molecular weight standards. The sample is run, and the gel is then processed with a desired stain, followed by destaining for about 2 to 14 hours. The next step is to determine the relative migration distance (Rf) of the standards and protein of interest. The migration distance can be determined using the following equation: Rf= (migration distance of the protein)/(Migration distance of the dye front). Next, the logarithm of the MW can be determined based on the values obtained for the bands in the standard; e.g., in some embodiments, the logarithm of the molecular weight of an SDS- denatured polypeptide and its relative migration distance (Rf) is plotted into a graph. After plotting the graph, interpolating the value derived will provide the molecular weight of the unknown protein band.
[0180] “Motif’ refers to dominant feature and/or distinct pattern in a molecule; e.g., a distinct pattern of amino acids that operate in a function-specific protein sequence. In some embodiments, a motif is a polynucleotide or polypeptide sequence that is implicated in having some biological significance and/or exerts some effect or is involved in some biological process.
[0181] “Mutant” refers to an organism, DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), which causes said organism and/or sequence to be different from the naturally occurring or wild-type organism, wild-type sequence, and/or reference sequence with which the mutant is being compared, hi some embodiments, this alteration, variation, or modification can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition). In some embodiments, the one or more amino acid substitutions or modifications can be conservative; here, such a conservative amino acid substitution and/or modification in a “mutant” does not substantially diminish the activity of the mutant in relation to its non-mutant form. For example, in some embodiments, a “mutant” possesses one or more conservative amino acid substitutions when compared to a peptide with a disclosed and/or claimed sequence, as indicated by a SEQ ID NO.
[0182] “Native” refers to items found in nature in their natural, unmodified state.
[0183] “N-terminus” refers to the free amine group (i.e., -NH2) that is positioned on beginning or start of a polypeptide.
[0184] “NCBI” refers to the National Center for Biotechnology Information.
[0185] “NCR” refers to nodule-specific cysteine-rich.
[0186] “NCR13” or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide. An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987).
[0187] “OD” refers to optical density. Typically, OD is measured using a spectrophotometer. When measuring growth over time of a cell population, OD600 is preferable to UV spectroscopy, this is because at a 600 nm wavelength, the cells will not be harmed as they would under too much UV light.
[0188] “OD600nm” or “OD600nm” refers to optical densities of the liquid sample measured (for example, a microbial cell culture) when measured in a spectrophotometer at 600 nanometers ( nm ).
[0189] OD660nm or (JD660nm refers to optical densities of the liquid sample measured (for example, a microbial cell culture) when measured in a spectrophotometer at 660 nanometers (nm ).
[0190] “One letter code” means the peptide sequence which is listed in its one letter code to distinguish the various amino acids in the primary structure of a protein: alanine=A, arginine=R, asparagine=N, aspartic acid=D, asparagine or aspartic acid=B, cysteine=C, glutamic acid=E, ghitamine=Q, glutamine or glutamic acid=Z, glycine=G, histidine=H, isoleucine=I, leucine=L, lysine=K, methionine=M, phenylalanine=F, proline=P, serine=S, threonine=T, tryptophan=W, tyrosine=Y, and valine=V.
[0191] “Operable” refers to the ability to be used, the ability to do something, and/or the ability to accomplish some function or result. For example, in some embodiments, “operable” refers to the ability of a polynucleotide, DNA sequence, RNA sequence, or other nucleotide sequence or gene to encode a peptide, polypeptide, and/or protein. For example, in some embodiments, a polynucleotide may be operable to encode a protein, which means that the polynucleotide contains information that imbues it with the ability to create a protein (e.g., by transcribing mRNA, which is in turn translated to protein).
[0192] “Pathogenic microbe” refers to any microbe that is deleterious or pathogenic to an organism; e.g., any microbe that causes or exacerbates an infection or disease in a living organism. For example, in some embodiments, a pathogenic microbe can be a pathogen to plants, e.g., a phytopathogen, such as a bacterium, a protozoan, or a fungus; in other embodiments, a pathogenic microbe can be a pathogen to animals. As used herein, a “plant pathogenic microbe” or “plant pathogen” can refer to a microbe that can cause disease into whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
[0193] “Peptide of the present disclosure.” See “antimicrobial peptide” or “AMP” above.
[0194] “Wild-type NCR13” or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide. An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987). See NCR13 above.
[0195] “Pharmaceutically acceptable salt” is synonymous with agriculturally acceptable salt, and as used herein refers to a compound that is modified by making acid or base salts thereof.
[0196] “Plant” shall mean whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
[0197] “Plasmid” refers to a DNA segment that acts as a carrier for a gene of interest (e.g., a gene operable to encode a peptide of the present disclosure, such as NCR13) and, when transformed or transfected into an organism, can replicate and express the DNA sequence contained within the plasmid independently of the host organism. Plasmids are a type of vector, and can be “cloning vectors” (i.e., simple plasmids used to clone a DNA fragment and/or select a host population carrying the plasmid via some selection indicator) or “expression plasmids” (i.e., plasmids used to produce large amounts of polynucleotides and/or polypeptides). [0198] “Polynucleotide” refers to a polymeric-form of nucleotides (e.g., ribonucleotides, deoxyribonucleotides, or analogs thereof) of any length; e.g., a sequence of two or more ribonucleotides or deoxyribonucleotides. As used herein, the term “polynucleotide” includes double- and single- stranded DNA, as well as double- and singlestranded RNA; it also includes modified and unmodified forms of a polynucleotide (modifications to and of a polynucleotide, for example, can include methylation, phosphorylation, and/or capping). In some embodiments, a polynucleotide can be one of the following: a gene or gene fragment (for example, a probe, primer, EST, or SAGE tag); genomic DNA; genomic DNA fragment; exon; intron; messenger RNA (mRNA); transfer RNA; ribosomal RNA; ribozyme; cDNA; recombinant polynucleotide; branched polynucleotide; plasmid; vector; isolated DNA of any sequence; isolated RNA of any sequence; nucleic acid probe; primer or amplified copy of any of the foregoing.
[0199] In yet other embodiments, a polynucleotide can refer to a polymeric-form of nucleotides operable to encode the open reading frame of a gene.
[0200] In some embodiments, a polynucleotide can refer to cDNA.
[0201] In some embodiments, polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The structure of a polynucleotide can also be referenced to by its 5’- or 3’- end or terminus, which indicates the directionality of the polynucleotide. Adjacent nucleotides in a single-strand of polynucleotides are typically joined by a phosphodiester bond between their 3’ and 5’ carbons. However, different internucleotide linkages could also be used, such as linkages that include a methylene, phosphoramidate linkages, etc. This means that the respective 5’ and 3’ carbons can be exposed at either end of the polynucleotide, which may be called the 5’ and 3’ ends or termini. The 5’ and 3’ ends can also be called the phosphoryl (PO4) and hydroxyl (OH) ends, respectively, because of the chemical groups attached to those ends. The term polynucleotide also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment that makes or uses a polynucleotide encompasses both the double-stranded form and each of two complementary single- stranded forms known or predicted to make up the double- stranded form.
[0202] In some embodiments, a polynucleotide can include modified nucleotides, such as methylated nucleotides and nucleotide analogs (including nucleotides with nonnatural bases, nucleotides with modified natural bases such as aza- or deaza-purines, etc.). If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. [0203] In some embodiments, a polynucleotide can also be further modified after polymerization, such as by conjugation with a labeling component. Additionally, the sequence of nucleotides in a polynucleotide can be interrupted by non-nucleotide components. One or more ends of the polynucleotide can be protected or otherwise modified to prevent that end from interacting in a particular way (e.g. forming a covalent bond) with other polynucleotides.
[0204] In some embodiments, a polynucleotide can be composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); and thymine (T). Uracil (U) can also be present, for example, as a natural replacement for thymine when the polynucleotide is RNA. Uracil can also be used in DNA. Thus, the term “sequence” refers to the alphabetical representation of a polynucleotide or any nucleic acid molecule, including natural and non- natural bases.
[0205] The term “RNA molecule” or ribonucleic acid molecule refers to a polynucleotide having a ribose sugar rather than deoxyribose sugar and typically uracil rather than thymine as one of the pyrimidine bases. An RNA molecule of the disclosure is generally single-stranded, but can also be double- stranded. In the context of an RNA molecule from an RNA sample, the RNA molecule can include the single-stranded molecules transcribed from DNA in the cell nucleus, mitochondrion or chloroplast, which have a linear sequence of nucleotide bases that is complementary to the DNA strand from which it is transcribed.
[0206] In some embodiments, a polynucleotide can further comprise one or more heterologous regulatory elements. For example, in some embodiments, the regulatory element is one or more promoters; enhancers; silencers; operators; splicing signals; polyadenylation signals; termination signals; RNA export elements, internal ribosomal entry sites (IRES); poly-U sequences; or combinations thereof.
[0207] “ppm” refers to parts per million. As used herein, 1 ppm = 1 pg per gram, or 1 ppm = 0.0001% w/w (1% w/w = 10,000 ppm).
[0208] “Protein” has the same meaning as “peptide” and/or “polypeptide” in this document.
[0209] “Ratio” refers to the quantitative relation between two amounts showing the number of times one value contains or is contained within the other.
[0210] “Recombinant DNA” or “rDNA” refers to DNA that is comprised of two or more different DNA segments.
[0211] “sp.” refers to species. [0212] “ssp.” or “subsp.” refers to subspecies.
[0213] “Susceptible to attack by a microbe (or microbes)” or “susceptible to a microbial infection” or “susceptible to microbial disease” and the like, refer to plants, or human or animal patients or subjects, susceptible to a microbe pathogen or microbial infections.
[0214] “Treatment” or “treating” or “treatment of’ or “combatting” or “controlling” or “inhibiting” a pathogenic microbe; or a condition, disease, or disorder in a plant or animal susceptible to an attack by the microbe that is caused by a pathogenic microbe; or symptoms associated with a condition, disease, or disorder in a plant or animal susceptible to an attack by the microbe that is caused by a pathogenic microbe, refers to an approach for obtaining beneficial or desired results in the plant or animal susceptible to an attack by the microbe, e.g., crops susceptible to colonization and/or infestation by microbes. Beneficial or desired results can include, but are not limited to, death of at least one microbe; alleviation or amelioration of one or more symptoms or conditions caused by a pathogenic microbe; diminishment of extent of condition, disorder or disease caused by a pathogenic microbe; stabilization of the state of condition, disorder or disease caused by a pathogenic microbe; prevention of development of condition, disorder or disease caused by a pathogenic microbe; prevention of spread of condition, disorder or disease caused by a pathogenic microbe; delay or slowing of condition, disorder or disease progression, delay or slowing of condition, disorder or disease onset caused by a pathogenic microbe; amelioration or palliation of the condition, disorder or disease state, and remission of a disease or disease state caused by a pathogenic microbe; whether partial or total. In some embodiments, “treating” can also mean prolonging survival of an organism beyond that expected in the absence of treatment.
“Treating” can also mean inhibiting the progression of the disease or disorder, slowing the progression of disorder or disease temporarily, although in some instances, it involves halting the progression of the disorder or disease permanently. As used herein the terms treatment, treat, or treating refers to a method of reducing the effects of one or more symptoms of a disease or condition caused by a pathogenic microbe. Thus, in some embodiments, treatment can refer to a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% reduction in the number of pathogenic microbes, and/or the severity of an established disease, condition, or symptom of the disease or condition caused by a pathogenic microbe. It is understood that treatment does not necessarily refer to the death of all pathogenic microbes and/or the cure or complete ablation of the disease, condition, or symptoms of the disease or condition caused by a pathogenic microbe. [0215] “var.” refers to varietas or variety. The term “var.” is used to indicate a taxonomic category that ranks below the species level and/or subspecies (where present). In some embodiments, the term “var.” represents members differing from others of the same subspecies or species in minor but permanent or heritable characteristics.
[0216] “Vector” refers to the DNA segment that accepts a foreign gene of interest (e.g., a wild-type antimicrobial peptide of the present disclosure, such as polynucleotide encoding NCR13). The gene of interest is known as an “insert” or “transgene.”
[0217] “Wild type” or “WT” refers to the phenotype and/or genotype (i.e., the appearance or sequence) of an organism, polynucleotide sequence, and/or polypeptide sequence, as it is found and/or observed in its naturally occurring state or condition.
[0218] “Wild-type NCR13” or “WT-NCR13” or “WT NCR13” or “NCR13 peptide” refers to a wild-type NCR13 peptide. An exemplary NCR13 peptide is proved herein, having an amino acid sequence consisting of: (designated as single letter amino acid sequence): TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1) (NCBI Accession No. DAA64987). See NCR13 above.
[0219] Throughout this specification, unless specifically stated otherwise or the context requires otherwise, reference to a single step, composition of matter, group of steps or group of compositions of matter shall be taken to encompass one and a plurality (i.e., one or more) of those steps, compositions of matter, groups of steps or group of compositions of matter.
[0220] The present disclosure is performed without undue experimentation using, unless otherwise indicated, conventional techniques of molecular biology, microbiology, virology, recombinant DNA technology, solid phase and liquid nucleic acid synthesis, peptide synthesis in solution, solid phase peptide synthesis, immunology, cell culture, and formulation. Such procedures are described, for example, in Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratories, New York, Second Edition (1989), whole of Vols I, n, and HI; DNA Cloning: A Practical Approach, Vols. I and II (D. N. Glover, ed., 1985), IRL Press, Oxford, whole of text; Oligonucleotide Synthesis: A Practical Approach (M. J. Gait, ed, 1984) IRL Press, Oxford, whole of text, and particularly the papers therein by Gait, ppi -22; Atkinson et al, pp35-81 ; Sproat et al, pp 83- 115; and Wu et al, pp 135-151; 4. Nucleic Acid Hybridization: A Practical Approach (B. D. Hames & S. J. Higgins, eds., 1985) IRL Press, Oxford, whole of text; Immobilized Cells and Enzymes: A Practical Approach (1986) IRL Press, Oxford, whole of text; Perbal, B., A Practical Guide to Molecular Cloning (1984); Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, hie.), whole of series; J. F. Ramalho Ortigao, “The Chemistry of Peptide Synthesis” In: Knowledge database of Access to Virtual Laboratory website (hiteractiva, Germany); Sakakibara, D., Teichman, J., Lien, E. Land Fenichel, R. L. (1976). Biochem. Biophys. Res. Commun. 73 336-342; Merrifield, R. B. (1963). J. Am. Chem. Soc. 85, 2149-2154; Barany, G. and Merrifield, R. B. (1979) in The Peptides (Gross, E. and Meienhofer, 3. eds.), vol. 2, pp. 1-284, Academic Press, New York. 12. Wiinsch, E., ed. (1974) Synthese von Peptiden in Houben-Weyls Metoden der Organischen Chemie (Muler, E., ed.), vol. 15, 4th edn., Parts 1 and 2, Thieme, Stuttgart; Bodanszky, M. (1984) Principles of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. & Bodanszky, A. (1984) The Practice of Peptide Synthesis, Springer-Verlag, Heidelberg; Bodanszky, M. (1985) Int. J. Peptide Protein Res. 25, 449-474; Handbook of Experimental Immunology, Vols. I-IV (D. M. Weir and C. C. Blackwell, eds., 1986, Blackwell Scientific Publications); and Animal Cell Culture: Practical Approach, Third Edition (John R. W. Masters, ed., 2000); each of these references are incorporated herein by reference in their entireties.
[0221] Although the disclosure of the invention has been described in detail for purposes of clarity and understanding, it will be obvious to those with skill in the art that certain modifications can be practiced within the scope of the appended claims. All publications and patent documents cited herein are hereby incorporated by reference in their entirety for all purposes to the same extent as if each were so individually denoted.
[0222] Throughout this specification, unless the context requires otherwise, the word “comprise,” or variations such as “comprises” or “comprising,” will be understood to imply the inclusion of a stated step or element or integer or group of steps or elements or integers but not the exclusion of any other step or element or integer or group of elements or integers. [0223] All patent applications, patents, and printed publications referred to herein are incorporated by reference in their entirety to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference in its entirety. And, all patent applications, patents, and printed publications cited herein are incorporated herein by reference in the entireties, except for any definitions, subject matter disclaimers, or disavowals, and except to the extent that the incorporated material is inconsistent with the express disclosure herein, in which case the language in this disclosure controls.
[0224] ANTIMICROBIAL PEPTIDES (AMPs)
[0225] Biological antimicrobial agents, e.g., antimicrobial agents based on, or derived from, natural sources (such as an organism or product therefrom), may confer crop protection by suppressing disease incidence, and/or reducing the number of pathogenic microbes or the severity of symptoms caused by the same. Thus, biological antimicrobial agents represent a desirable replacement of traditional agrochemicals, and can be used to avoid or remediate the adverse effects thereof.
[0226] The present disclosure provides antimicrobial combinations comprising a peptide of the present disclosure, or an agriculturally acceptable salt thereof, and a chelating agent; agricultural compositions thereof, further comprising an excipient; and methods of making and using the same.
[0227] “Antimicrobial peptide” or “AMP” or “peptide of the present disclosure” refers to any of the peptides described herein that exert an antimicrobial effect against one or more pathogenic microbes.
[0228] In some embodiments, an AMP can be a peptide having: (i) a size of about 10 kDa or less; (ii) a cationic charge, often ranging from +2 to +7 at pH 7; and (iii) amphipathic stereogeometry, conferring relatively polarized hydrophilic and hydrophobic facets.
[0229] In some embodiments, an AMP can be an NCR peptide or a defensin. For example, in some embodiments, an AMP of the present disclosure can be a wild-type antimicrobial peptide, e.g., a wild-type NCR peptide or defensin. Exemplary wild-type antimicrobial peptides are provide SEQ ID NOs: 1-19628, or 19634.
[0230] In some embodiments, an AMP can be a plant defensin.
[0231] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif.
[0232] In some embodiments, an AMP can be a plant defensin having one or more disulfide bonds. In some embodiments, an AMP can be a peptide having a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C- terminus of a linear amino acid sequence). In some embodiments, an AMP can be a peptide having 3 or 4 disulfide bonds, hi some embodiments, an AMP can be a peptide having a disulfide bond connectivity pattern wherein the disulfide bonds are formed between cysteine residues at the following positions: 1-8, 2-5, 3-6, 4-7.
[0233] In some embodiments, an AMP can have a “gamma core” motif. As used herein, the term “gamma core” refers to a conserved GXC-C or GXC motif having two antiparallel P-sheets, with an interposed short turn region, and the following characteristics: (1) net cationic charge (+0.5 to +7) with basic residues typically polarized along its axis; (2) periodic charge and hydrophobicity yielding amphipathic stereogeometry; and (3) participation in one to four disulfide bonds. In some embodiments, this motif may constitute the entire peptide, or it may link to adjacent structural domains.
[0234] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); and 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7.
[0235] In some embodiments, an AMP can be a plant defensin having a cysteine- stabilized (CS) αβ motif; a disulfide bond between the first cysteine in the amino acid sequence (cysteine closest to the N-terminus in a linear amino acid sequence) and the last cysteine in the amino acid sequence (cysteine closest to the C-terminus of a linear amino acid sequence); 4 disulfide bonds with the following connectivity between the following cysteine residues: 1-8, 2-5, 3-6, 4-7; and a “gamma core” motif.
[0236] In some embodiments, an antimicrobial peptide of the present disclosure can be a mutant or variant of a wild-type antimicrobial peptide. For example, in some embodiments, an AMP comprises a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, that has an alteration, variation, or modification (for example, in the nucleotide sequence or the amino acid sequence), relative to a wild-type or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived. Accordingly, in some embodiments, an AMP comprises an alteration, variation, or modification that can be one or more nucleotide and/or amino acid substitutions or modifications (e.g., deletion or addition), in a DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein, relative to the wildtype or originating DNA sequence, polynucleotide, amino acid sequence, peptide, polypeptide, or protein from which the AMP was derived.
[0237] In some embodiments, an AMP can be a mutant peptide having an amino acid sequence as set forth in any one of SEQ ID NOs: 19629-19633.
[0238] In some embodiments, the AMP can be an isolated peptide, e.g., any of the peptides of the present disclosure.
[0239] In some embodiments, an antimicrobial peptide can refer to the fermentation beer, i.e., the spent fermentation medium or fermentation medium supernatant after removal of organisms, wherein said fermentation medium has been inoculated with and consumed by a transformed host cell, e.g., a recombinant cell operable to express an AMP of the present disclosure.
[0240] In some embodiments, fermentation beer refers to the solution that is recovered following the fermentation of the transformed host cell. The term “fermentation” refers broadly to the enzymatic and anaerobic or aerobic breakdown of organic substances (e.g., a carbon substrate) nutrient substances by microorganisms under controlled conditions (e.g., temperature, oxygen, pH, nutrients, and the like) to produce fermentation products (e.g., one or more peptides of the present disclosure). While fermentation typically describes processes that occur under anaerobic conditions, as used herein it is not intended that the term be solely limited to strict anaerobic conditions, as the term “fermentation” used herein may also occur processes that occur in the presence of oxygen.
[0241] Accordingly, in some embodiments, an antimicrobial combination comprises:
(1) the fermentation beer of a recombinant cell operable to express an AMP of the present disclosure; and (2) a chelating agent.
[0242] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express PvDl (SEQ ID NO: 19629); and
(2) a chelating agent.
[0243] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express PvD1a (SEQ ID NO: 19630), and (2) a chelating agent.
[0244] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express Dm-AMP1a (SEQ ID NO: 19631), and (2) a chelating agent.
[0245] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express Rs-AFP2a (SEQ ID NO: 19632), and (2) a chelating agent.
[0246] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express SPE10a (SEQ ID NO: 19633), and (2) a chelating agent.
[0247] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express So-D2 (SEQ ID NO: 19634), and (2) a chelating agent. [0248] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express a wild-type NCR peptide, and (2) a chelating agent.
[0249] In some embodiments, an antimicrobial combination comprises: (1) the fermentation beer of a recombinant cell operable to express a wild-type defensin, and (2) a chelating agent.
[0250] In some embodiments, the antimicrobial peptide of the present disclosure can be a wild-type NCR peptide, a wild-type defensin.
[0251] Wild-type NCR peptides: overview
[0252] Legume plants employ a symbiotic relationship with symbiotic nitrogen-fixing bacteria, commonly termed rhizobia, which allows these plants to take up biologically usable nitrogen, which is fixed by the bacteria in exchange for nutrients and carbon resources. Endosymbiotic rhizobia induce changes in the host plant, which results in the formation of a specialized root organ called a nodule. See Roy et al., Symbiotic Outcome Modified by the Diversification from 7 to over 700 Nodule-Specific Cysteine-Rich Peptides. GENES
(BASEL). 2020 Apr; 11(4): 348. Within nodules, the rhizobia undergo distinct morphological and metabolic changes, and differentiate into nitrogen-fixing bacteroids. Id. Bacteroid differentiation and activity is regulated by a group of peptides called nodule- specific cysteine-rich (NCR) peptides. See Mergaert et al., Gene Expression in Nitrogen-Fixing Symbiotic Nodule Cells in Medicago truncatula and Other Nodulating Plants. PLANT CELL. 2020 Jan; 32(1): 42-68; Kereszt et al., Impact of Plant Peptides on Symbiotic Nodule Development and Functioning. FRONT PLANT SCI. 2018; 9: 1026.
[0253] Members of the NCR peptide gene family have been identified in legumes including, but not limited to, Viciafaba, Medicago sativa, Trifolium repens, Galega orientalis, Pisum sativum, Astragalus sinicus, Cicer arietinum and Glycyrrhiza lepidota.
[0254] NCR peptides have a structure that resembles antimicrobial defensin peptides, which are effectors of innate immunity in plants and animals, including humans. See Kereszt et al., Impact of Plant Peptides on Symbiotic Nodule Development and Functioning. FRONT PLANT SCI. 2018; 9: 1026. And, NCRs have been shown to exhibit antimicrobial activity, e.g., against gram-negative and gram-positive bacteria as well as unicellular and filamentous fungi. See Maroti and Kondorosi, Nitrogen-fixing Rhizobium-/egwme symbiosis: are polyploidy and host peptide-govemed symbiont differentiation general principles of endo symbiosis? FRONT MICROBIOL. 2014; 5: 326; Maroti et al., Natural roles of antimicrobial peptides in microbes, plants and animals. RES MICROBIOL. 2011 May;162(4):363-74.
[0255] Wild-type Defensins: overview
[0256] Defensins are a large family of small, cationic, cysteine- and arginine-rich antimicrobial peptides, found in both vertebrates, invertebrates, and plants. Defensins are divided into five groups according to the spacing pattern of cysteines: plant, invertebrate, a-, P-, and 0-defensins. The latter three are mostly found in mammals, a-defensins are proteins found in neutrophils and intestinal epithelia. P-defensins are the most widely distributed and are secreted by leukocytes and epithelial cells of many kinds. 0-defensins have been rarely found so far e.g. in leukocytes of rhesus macaques. Defensins are active against bacteria, fungi and many enveloped and nonenveloped viruses.
[0257] In some embodiments, a defensin can be identified by comparing a candidate amino acid sequence with the hidden markov model profiles (HMM profiles) of the PF AM database by using the freely available HMMER software package. The PFAM defensin families include Defensin_l or "Mammalian defensin" (PFAM accession no. PF00323), Defensin_2 or “Arthropod defensin” (PFAM accession no. PF01097), Defensin_beta or “Beta Defensin” (PFAM accession no. PF0071 1 ), Defensin_propep or “Defensin propeptide” (PFAM accession no. PF00879), Gamma-thionin or “Gamma-thionins family” or plant defensins (PFAM accession no. PF00304).
[0258] In some embodiments, a defensin of the present disclosure can be a defensing belonging to the alpha-defensin class, the beta-defensin class, the theta-defensin class, the insect or arthropod defensin classes, or the plant defensin class.
[0259] In some embodiments, the amino acid sequence of a defensin according to the invention comprises 4, 6 or 8 cysteine residues, preferably 4 or 6 cysteine residues, more preferably 6 cysteine residues.
[0260] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a defensin isolated from Medicago truncatula.
[0261] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be an MtDef5 defensin
[0262] Exemplary defensins include, but not limited to, a-defensins (e.g., neutrophil defensin 1, defensin alpha 1, neutrophil defensin 3, neutrophil defensin 4, defensin 5, defensin 6), P-defensins (e.g., beta-defensin 1, beta-defensin 2, beta-defensin 103, beta- defensin 107, beta-defensin 110, beta-defensin 136), and 0-defensins. In other embodiments, the anti-microbial polypeptide comprises or consists of a cathelicidin (e.g., hCAP18). Examples of plant defensins include, but are not limited to, MsDefl , MtDef2, MtDef4, NaDl, Rs-AFPl, Rs-AFP2, KP4, and KP6.
[0263] An exemplary description of defensins is provided in U.S. Patent No. 6,605,698, the disclosure of which is incorporated herein by reference in its entirety.
[0264] In addition, exemplary defensins are provided herein, having an amino acid sequence consisting of SEQ ID NOs: 838-19634.
[0265] Illustrative wild-type antimicrobial peptides
[0266] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type NCR peptide.
[0267] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type defensin peptide.
[0268] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Viciafaba, Medicago sativa, Trifolium repens, Galega orientalis, Pisum sativum, Astragalus sinicus, Cicer arietinum or Glycyrrhiza lepidota
[0269] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Medicago truncatula.
[0270] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Cicer arietinum.
[0271] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR isolated from Medicago truncatula.
[0272] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a defensin.
[0273] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide is a wild-type peptide having an amino acid sequence consisting of a sequence as set forth in any one of SEQ ID NOs: 1- 19628.
[0274] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type NCR peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1-837.
[0275] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type defensin peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-19628.
[0276] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the antimicrobial peptide is a wild-type plant defensin peptide having an amino acid sequence consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-4109.
[0277] Wild-type antimicrobial peptides can be isolated or derived from organisms using a variety of methods well known to those having ordinary skill in the art. For example, in some embodiments, a wild-type NCR peptide of the present disclosure can be isolated from a wild-type organism, e.g., Cicer arietinum (Chickpea) (Garbanzo) or Medicago plants such as Medicago sativa, and M. truncatula. using methods well known in the art. An exemplary description of wild-type NCR peptides is provided in Montiel et al., Terminal Bacteroid Differentiation Is Associated With Variable Morphological Changes in Legume Species Belonging to the Inverted Repeat-Lacking Clade. Mol Plant Microbe Interact. 2016 Mar;29(3):210-9, the disclosure of which is incorporated herein by reference in its entirety. [0278] In other embodiments, a wild-type antimicrobial peptide of the present disclosure can be recombinantly expressed, or chemically synthesized, likewise using methods well known in the art and/or described herein.
[0279] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-837. [0280] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least
89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least
93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least
97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least
99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-19628.
[0281] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type plant defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type plant defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-4109.
[0282] In some embodiments, a wild-type NCR peptide of the present disclosure comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in Table 1.
[0283] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type NCR peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 1-837.
[0284] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19628. [0285] In some embodiments, a wild-type antimicrobial peptide of the present disclosure can be a wild-type plant defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-4109.
[0286] In some embodiments, a wild-type NCR peptide of the present disclosure can consist of an amino acid sequence as provided in Table 1.
[0287] Table 1. Prepropeptide wild-type NCR peptides of the present disclosure.
The table below shows wild-type NCR peptides of the present disclosure, in their prepropeptide form (Full length), comprising a putative secretory signal sequence and mature protein (highlighted in bold).
Figure imgf000046_0001
[0288] In some embodiments, a wild-type antimicrobial peptide of the present disclosure comprises a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in Table 2.
[0289] In some embodiments, a wild-type NCR peptide of the present disclosure can consist of an amino acid sequence as provided in Table 2.
[0290] Table 2. Mature wild-type NCR peptides of the present disclosure. The table below shows the mature wild-type NCR peptides of the present disclosure without the putative secretory signal sequence.
Figure imgf000047_0001
[0291] In some embodiments, an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type NCR peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.
[0292] In some embodiments, an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the wild-type NCR peptide has an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
[0293] In some embodiments, an antimicrobial combination comprises a wild-type nodule-specific cysteine-rich (NCR) peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the wild-type NCR peptide is a wild-type NCR13 peptide.
[0294] An exemplary full length, wild-type NCR13 prepropeptide is provided herein, having the amino acid sequence:
“MAKTLKVVYTVILLVSLFLLLIAATKPCQSDKDCKKFACRKPKVPKCINGFCKC VR” (SEQ ID NO: 14); here, the full length peptide comprises a putative secretory signal sequence and mature protein (highlighted in bold).
[0295] In some embodiments, an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR13 peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14.
[0296] In some embodiments, an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of: “TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR” (SEQ ID NO: 1). [0297] In some embodiments, an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial peptide is a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
“MAKTLKVVYTVILLVSLFLLLIAATKPCQSDKDCKKFACRKPKVPKCINGFCKC VR” (SEQ ID NO: 14).
[0298] In some embodiments, an antimicrobial combination comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
[0299] In some embodiments, an antimicrobial combination comprises a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of: TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1).
[0300] In some embodiments, an antimicrobial combination comprises a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide has an amino acid sequence consisting of: TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1).
[0301] In some embodiments, the wild-type antimicrobial peptide sequences of the present disclosure do not comprise any: mutations, amino acid substitutions, and/or amino acid additions outside of the full-length wild-type amino acid sequences as described herein. For example, the wild-type antimicrobial peptide sequences of the present disclosure do not comprise a substitution and/or addition of any one or more amino acids to the N-terminus of any of the wild-type antimicrobial peptide sequences described herein, e.g., any one of SEQ
ID NO: 1-19628.
[0302] Accordingly, any of the wild-type antimicrobial peptide sequences described herein, having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type amino acid sequences set forth in any one of SEQ ID NO: 1-19628, do not comprise any mutations, amino acid substitutions, and/or amino acid additions falling outside of the wild-type amino acid sequences as set forth in any one of SEQ ID NO: 1-19628 (e.g., an N-terminus or C-terminus addition of one or more amino acids). [0303] Thus, in some embodiments, a wild-type antimicrobial peptide of the present disclosure comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type antimicrobial peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628; wherein the foregoing percent identity is calculated based on the degree of sequence relatedness within the full-length of the polypeptide sequences being compared, and not outside of them.
[0304] Any of the aforementioned wild-type antimicrobial peptides, e.g., a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least
94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least
98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition of the present disclosure, comprising a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and one or more excipients.
[0305] Other AMPs of the present disclosure
[0306] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0307] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0308] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
[0309] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
[0310] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
[0311] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633). [0312] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
[0313] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0314] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0315] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0316] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC”
(SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0317] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0318] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0319] As used herein, the term “conservative amino acid substitutions” refers to amino acid substitutions to a molecule that do not affect the functional and/or chemical characteristics of the molecule (i.e., the AMP). Accordingly, conservative amino acid substitutions are generally therefore based on the relative similarity of the amino acid sidechain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary conservative amino acid substitutions are well known to those having ordinary skill in the art. For example, in some embodiments, conservative amino acid substitutions are those in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include: amino acids with basic side chains (e.g., lysine, arginine, histidine); acidic side chains (e.g., aspartic acid, glutamic acid); polar, negatively charged residues and their amides (e.g., aspartic acid, asparagine, glutamic, acid, glutamine; uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine); small aliphatic, nonpolar or slightly polar residues (e.g., alanine, serine, threonine, proline, glycine); nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan); large aliphatic, nonpolar residues (e.g., methionine, leucine, isoleucine, valine, cystine); beta-branched side chains (e.g., threonine, valine, isoleucine); aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine); and large aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan).
[0320] Polynucleotides
[0321] In other embodiments, a wild-type antimicrobial peptide of the present disclosure can be recombinantly expressed, or chemically synthesized, likewise using methods well known in the art and/or described herein.
[0322] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-837.
[0323] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-19628.
[0324] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type plant defensin peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type plant defensin peptide amino acid sequence as set forth in any one of SEQ ID NOs: 838-4109.
[0325] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide of the present disclosure comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least
92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least
96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least
99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in Table 1. [0326] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 1-837.
[0327] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-19628.
[0328] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type plant defensin peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 838-4109.
[0329] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide consisting of an amino acid sequence as provided in Table 1.
[0330] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.
[0331] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide having an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
[0332] In some embodiments, a polynucleotide of the present disclosure is operable to encode a wild-type NCR peptide that is a wild-type NCR13 peptide.
[0333] In some embodiments, a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type NCR13 peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14.
[0334] In some embodiments, a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
“TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR” (SEQ ID NO: 1).
[0335] In some embodiments, a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of:
“MAKTLKVVYTVILLVSLFLLLIAATKPCQSDKDCKKFACRKPKVPKCINGFCKC VR” (SEQ ID NO: 14).
[0336] In some embodiments, a polynucleotide of the present disclosure is operable to encode a WT-NCR13 peptide having an amino acid sequence consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
[0337] In some embodiments, the polynucleotides of the present disclosure that are operable to encode any of the wild-type antimicrobial peptide amino acid sequences described herein, do not encode a wild-type antimicrobial peptide having any: mutations, amino acid substitutions, and/or amino acid additions outside of the full-length wild-type amino acid sequences as described herein. For example, the wild-type antimicrobial peptide sequences of the present disclosure do not comprise a substitution and/or addition of any one or more amino acids to the N-terminus of any of the wild-type antimicrobial peptide sequences described herein, e.g., any one of SEQ ID NO: 1-19628.
[0338] Accordingly, any of the polynucleotides encoding the wild-type antimicrobial peptide sequences described herein, having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type amino acid sequences set forth in any one of SEQ ID NO: 1-19628, do not comprise any mutations, amino acid substitutions, and/or amino acid additions falling outside of the wild-type amino acid sequences as set forth in any one of SEQ ID NO: 1-19628 (e.g., an N-terminus or C-terminus addition of one or more amino acids).
[0339] Thus, in some embodiments, a polynucleotide encoding a wild-type antimicrobial peptide of the present disclosure, encodes a peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of a wild-type antimicrobial peptide amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628; wherein the foregoing percent identity is calculated based on the degree of sequence relatedness within the full-length of the polypeptide sequences being compared, and not outside of them.
[0340] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0341] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0342] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID
NO: 19630). [0343] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
[0344] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
[0345] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
[0346] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
[0347] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0348] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0349] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0350] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0351] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0352] In some embodiments, a polynucleotide of the present disclosure is operable to encode an AMP having an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0353] Any of the aforementioned polynucleotides encoding the wild-type antimicrobial peptides of the present disclosure, e.g., a polynucleotide encoding a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition of the present disclosure, comprising a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and one or more excipients.
[0354] Likewise, any of the aforementioned polynucleotides encoding an antimicrobial peptide of the present disclosure, e.g., a polynucleotide encoding a PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634) can be used to make an antimicrobial combination of the present disclosure comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition of the present disclosure, comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and one or more excipients. [0355] METHODS OF MAKING ANTIMICROBIAL PEPTIDES
[0356] The wild-type antimicrobial peptide of the present disclosure can be obtained via any method well known in the art.
[0357] Isolating wild-type antimicrobial peptides
[0358] The wild-type antimicrobial peptides of the present disclosure can be obtained directly from the source, e.g., isolating an antimicrobial peptide (such as an NCR13 peptide) from a legume.
[0359] In some embodiments, the wild-type antimicrobial peptide of the present disclosure can be isolated a plant or animal. For example, and without limitation, a WT-NCR peptide can be isolated from Cicer arietinum nodules. For example, in some embodiments, seeds from Cicer arietinum, can be surface sterilized with HgCh. Surface-sterilized seeds can then be germinated at room temperature and the seedlings be planted. The seedlings can then be inoculated with their respective rhizobial species: Mesorhizobium ciceri (HAMBI2949). When the nodules are fully developed and pink, they can be harvested to isolate the peptides. [0360] An exemplary description of isolating wild-type NCR peptides is provided in U.S. Patent No. 8,592,367, entitled “Nodule specific medicago peptides having antimicrobial activity and pharmaceutical compositions containing the same,” the disclosure of which is incorporated herein by reference in its entirety.
[0361] An exemplary description of isolating wild-type defensin peptides is provided in U.S. Patent Application No. US20050106701A1, entitled “Methods for the purification of defensins,” the disclosure of which is incorporated herein by reference in its entirety.
[0362] Additional exemplary methods of isolating wild-type antimicrobial peptides are provided in U.S. Patent Nos. 9,848,603; 6,121,436; 5,482,928; and International Patent Application No. W02000068405A2; the disclosures of which are incorporated herein by reference in their entireties.
[0363] Recombinant antimicrobial peptides
[0364] In some embodiments, the antimicrobial peptides of the present disclosure can be produced using recombinant methods.
[0365] In some embodiments, an antimicrobial peptide of the present disclosure can be created using any known method for producing a protein. For example, in some embodiments, and without limitation, an antimicrobial peptide of the present disclosure can be created using a recombinant expression system, such as yeast expression system or a bacterial expression system. However, those having ordinary skill in the art will recognize that other methods of protein production are available. [0366] In some embodiments, an antimicrobial peptide of the present disclosure can be produced using a recombinant expression system.
[0367] The recombinant expression of an antimicrobial peptide of the present disclosure is practicable in a wide variety of host cells. In some embodiments, the host cell can be any host cell that satisfies the requirements of the end-user. For example, in some embodiments, a user may desire to use one specific type of host cell (e.g., a yeast cell or a bacteria cell) as opposed to another; the preference of a given host cell can range from desired codon usage, availability and cost, among other considerations.
[0368] In some embodiments, a polynucleotide operable to encode a wild-type antimicrobial peptide (mature or full length) of the present disclosure can be cloned into a vector using a variety of cloning strategies, and commercial cloning kits and materials readily available to those having ordinary skill in the art. In various embodiments, the mRNA, cDNA or other nucleotide coding formats of the wild-type antimicrobial peptide sequence desired to be recombinantly produced, are available in various molecular biology databases, for example, NCBI, EMBL, GenBank, DDBJ, EnsemblPlants, Pfam, Swiss Prot, or UniProt, and can be searched using established nucleotide and/or protein databases and bioinformatics depositories, such as, BLASTn and TBLASTn, and PubMed databases. Genomic sequences of the full length and mature forms of NCR peptides are also published in various scientific reports known to those of skill in the art, for example, as provided in www.plantphysiol.org. [0369] For example, the polynucleotide can be cloned into a vector using such strategies as the SnapFast; Gateway; TOPO; Gibson; LIC; InFusionHD; or Electra strategies. There are numerous commercially available vectors that can be used to produce an antimicrobial peptide of the present disclosure. See Janke et al., A versatile toolbox for PCR- based tagging of yeast genes: new fluorescent proteins, more markers and promoter substitution cassettes. Yeast. 2004 Aug; 21(11):947-62; see also, Adams et al. Methods in Yeast Genetics. Cold Spring Harbor, NY, 1997, the disclosures of which are incorporated herein by reference in its entireties.
[0370] In some embodiments, a polynucleotide encoding wild-type antimicrobial peptide of the present disclosure can be cloned into a vector such as a plasmid, cosmid, virus (bacteriophage, animal viruses, and plant viruses), and/or artificial chromosome (e.g., YACs). [0371] In some embodiments, a polynucleotide encoding an antimicrobial peptide of the present disclosure can be inserted into other commercially available plasmids and/or vectors that are readily available to those having skill in the art, e.g., plasmids are available from Addgene (a non-profit plasmid repository); GenScript®; Takara®; Qiagen®; and Promega™.
[0372] Additional exemplary methods of producing recombinant peptides are provided in PCT Application Nos. PCT/US2013/030042, PCT/US2017/055596, PCT/US2019/051093, PCT/US2021/028254, PCT/US2021/030277, the disclosures of which is incorporated herein by reference in their entireties.
[0373] Chemically synthesizing polynucleotides
[0374] In some embodiments, the polynucleotide sequence encoding an antimicrobial peptide of the present disclosure can be chemically synthesized using commercially available polynucleotide synthesis services, such as those offered by GENEWIZ® (e.g., TurboGENE™; PriorityGENE; and FragmentGENE), or SIGMA-ALDRICH® (e.g., Custom DNA and RNA Oligos Design and Order Custom DNA Oligos). Exemplary method for generating DNA and or custom chemically synthesized polynucleotides are well known in the art, and are illustratively provided in U.S. Patent No. 5,736,135, Serial No. 08/389,615, filed on Feb. 13, 1995, the disclosure of which is incorporated herein by reference in its entirety. See also Agarwal, et al., Chemical synthesis of polynucleotides. Angew Chem Int Ed Engl. 1972 Jun; 11(6):451-9; Ohtsuka et al., Recent developments in the chemical synthesis of polynucleotides. Nucleic Acids Res. 1982 Nov 11; 10(21): 6553-6570; Sondek & Shortle. A general strategy for random insertion and substitution mutagenesis: substoichiometric coupling of trinucleotide phosphoramidites. Proc Natl Acad Sci U S A. 1992 Apr 15; 89(8): 3581-3585; Beaucage S. L., et al., Advances in the Synthesis of Oligonucleotides by the Phosphoramidite Approach. Tetrahedron, Elsevier Science Pubfishers, Amsterdam, NL, vol. 48, No. 12, 1992, pp. 2223-2311; Agrawal (1993) Protocols for Oligonucleotides and Analogs: Synthesis and Properties; Methods in Molecular Biology Vol. 20, the disclosures of which are incorporated herein by reference in their entirety.
[0375] Chemically synthesizing polynucleotides allows for a DNA sequence to be generated that is tailored to produce a desired peptide based on the arrangement of nucleotides within said sequence (i.e., the arrangement of cytosine [C], guanine [G], adenine [A] or thymine [T] molecules); the mRNA sequence that is transcribed from the chemically synthesized DNA polynucleotide can be translated to a sequence of amino acids, each amino acid corresponding to a codon in the mRNA sequence.
[0376] Obtaining an antimicrobial peptide of the present disclosure from a chemically synthesized DNA polynucleotide sequence and/or a DNA polynucleotide sequence can be achieved by cloning the DNA sequence into an appropriate vector. There are a variety of expression vectors available, host organisms, and cloning strategies known to those having ordinary skill in the art. For example, the vector can be a plasmid, which can introduce a heterologous gene and/or expression cassette into yeast cells to be transcribed and translated. The term “vector” is used to refer to a carrier nucleic acid molecule into which a nucleic acid sequence can be inserted for introduction into a cell where it can be replicated. A vector may contain “vector elements” such as an origin of replication (ORI); a gene that confers antibiotic resistance to allow for selection; multiple cloning sites; a promoter region; a selection marker for non-bacterial transfection; and a primer binding site. A nucleic acid sequence can be “exogenous,” which means that it is foreign to the cell into which the vector is being introduced or that the sequence is homologous to a sequence in the cell but in a position within the host cell nucleic acid in which the sequence is ordinarily not found.
Vectors include plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs). One of skill in the art would be well equipped to construct a vector through standard recombinant techniques, which are described in Sambrook et al., 1989 and Ausubel et al., 1996, both incorporated herein by reference. In addition to encoding a polynucleotide operable to encode an antimicrobial peptide of the present disclosure, a vector may encode a targeting molecule. A targeting molecule is one that directs the desired nucleic acid to a particular tissue, cell, or other location.
[0377] Chemically synthesizing peptides
[0378] Peptide synthesis or the chemical synthesis of peptides and/or polypeptides can be used to generate wild-type antimicrobial peptides of the present disclosure. These methods can be performed by those having ordinary skill in the art, and/or through the use of commercial vendors (e.g., GenScript®; Piscataway, New Jersey). For example, in some embodiments, chemical peptide synthesis can be achieved using Liquid phase peptide synthesis (LPPS), or solid phase peptide synthesis (SPPS).
[0379] In some embodiments, peptide synthesis can generally be achieved by using a strategy wherein the coupling the carboxyl group of a subsequent amino acid to the N- terminus of a preceding amino acid generates the nascent polypeptide chain — a process that is opposite to the type of polypeptide synthesis that occurs in nature.
[0380] Peptide deprotection is an important first step in the chemical synthesis of polypeptides. Peptide deprotection is the process in which the reactive groups of amino acids are blocked through the use of chemicals in order to prevent said amino acid’ s functional group from taking part in an unwanted or non-specific reaction or side reaction; in other words, the amino acids are “protected” from taking part in these undesirable reactions. [0381] Prior to synthesizing the peptide chain, the amino acids must be “deprotected” to allow the chain to form (i.e., amino acids to bind). Chemicals used to protect the N-termini include 9-fluorenyhnethoxycarbonyl (Fmoc), and tert-butoxycarbonyl (Boc), each of which can be removed via the use of a mild base (e.g., piperidine) and a moderately strong acid (e.g., trifluoracetic acid (TFA)), respectively.
[0382] The C-terminus protectant required is dependent on the type of chemical peptide synthesis strategy used: e.g., LPPS requires protection of the C-terminal amino acid, whereas SPPS does not owing to the solid support which acts as the protecting group. Side chain amino acids require the use of several different protecting groups that vary based on the individual peptide sequence and N-terminal protection strategy; typically, however, the protecting group used for side chain amino acids are based on the tert-butyl (tBu) or benzyl (Bzl) protecting groups.
[0383] Amino acid coupling is the next step in a peptide synthesis procedure. To effectuate amino acid coupling, the incoming amino acid’ s C-terminal carboxylic acid must be activated: this can be accomplished using carbodiimides such as diisopropylcarbodiimide (DIC), or dicyclohexylcarbodiimide (DCC), which react with the incoming amino acid’s carboxyl group to form an O-acylisourea intermediate. The O-acylisourea intermediate is subsequently displaced via nucleophilic attack via the primary amino group on the N- terminus of the growing peptide chain. The reactive intermediate generated by carbodiimides can result in the racemization of amino acids. To avoid racemization of the amino acids, reagents such as 1 -hydroxybenzotriazole (HOBt) are added in order to react with the O- acylisourea intermediate. Other couple agents that may be used include 2-(1H-benzotriazol-1- yl)-l,l,3,3-tetramethyluronium hexafluorophosphate (HBTU), and benzotriazol- 1-yl-oxy- tris(dimethylamino)phosphonium hexafluorophosphate (BOP), with the additional activating bases. Finally, amino acid deprotection and coupling.
[0384] At the end of the synthesis process, removal of the protecting groups from the polypeptide must occur — a process that usually occurs through acidolysis. Determining which reagent is required for peptide cleavage is a function of the protection scheme used and overall synthesis method. For example, in some embodiments, hydrogen bromide (HBr); hydrogen fluoride (HF); or trifluoromethane sulfonic acid (TFMSA) can be used to cleave Bzl and Boc groups. Alternatively, in other embodiments, a less strong acid such as TFA can effectuate acidolysis of tBut and Fmoc groups. Finally, peptides can be purified based on the peptide’ s physiochemical characteristics (e.g., charge, size, hydrophobicity, etc.). Techniques that can be used to purify peptides include Purification techniques include Reverse-phase chromatography (RPC); Size-exclusion chromatography; Partition chromatography; High- performance liquid chromatography (HPLC); and Ion exchange chromatography (IEC). [0385] Exemplary methods of peptide synthesis can be found in Anderson G. W. and McGregor A. C. (1957) T-butyloxycarbonylamino acids and their use in peptide synthesis. Journal of the American Chemical Society. 79, 6180-3; Carpino L. A. (1957) Oxidative reactions of hydrazines. Iv. Elimination of nitrogen from 1, l-disubstituted-2- arenesulfonhydrazidesl-4. Journal of the American Chemical Society. 79, 4427-31; McKay F. C. and Albertson N. F. (1957) New amine-masking groups for peptide synthesis. Journal of the American Chemical Society. 79, 4686-90; Merrifield R. B. (1963) Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. Journal of the American Chemical Society. 85, 2149-54; Carpino L. A. and Han G. Y. (1972) 9-fhiorenyhnethoxycarbonyl amino-protecting group. The Journal of Organic Chemistry. 37, 3404-9; and A Lloyd- Williams P. et al. (1997) Chemical approaches to the synthesis of peptides and proteins. Boca Raton: CRC Press. 278; U.S. Patent Nos: 3,714,140 (filed Mar. 16, 1971); 4,411,994 (filed June 8, 1978); 7,785,832 (filed Jan. 20, 2006); 8,314,208 (filed Feb. 10, 2006); and 10,442,834 (filed Oct., 2, 2015); and United States Patent Application 2005/0165215 (filed Dec. 23, 2004), the disclosures of which are incorporated herein by reference in their entireties.
[0386] Any of the methods described herein can be used to generate the wild-type antimicrobial peptides described herein, e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs 1-19628.
[0387] Likewise, any of the methods described herein can be used to generate any of the antimicrobial peptides described herein, e.g., an antimicrobial peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs 19629-19633.
[0388] CHELATING AGENTS
[0389] The present disclosure provides combinations comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and agricultural compositions thereof, further comprising an excipient; and methods of making and using the same.
[0390] The terms “Chelating agent” or “chelator” refer to any agent that binds to a mono-, di-, tri-, tetra-, penta-, or hexa- valent cation — thereby forming a metal complex known as a “chelate”. Thus, as used herein, the term “chelate” includes a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa-valent cation, hi some embodiments, the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p-block metal. [0391] In some embodiments, chelating agents are compounds that form complexes with certain metal ions, thereby inactivating the ions so that they cannot react with other elements, and becoming a binding agent that suppresses chemical activity by forming chelates.
[0392] Chelation describes the process of forming two or more separate bonds between a ligand and a single central atom. The ligand may be any organic compound, a silicate, or a phosphate. The chelate effect describes the enhanced affinity of chelating ligands for a metal ion compared to the affinity of a collection of similar nonchelating ligands for the same metal.
[0393] In some embodiments, a chelate can be a complex of a chelating agent with a mono-, di-, tri-, tetra-, penta-, or hexa- valent cation, wherein the cation may be a metal, for example, but not limited to, a lanthanide or transition metal cation, alkali earth metal or p- block metal.
[0394] In some embodiments, the chelate may be a simple complex with the cation, involving only non-ionic-bond, non-covalent attractions; in yet other embodiments, the chelate may be a complex involving ionic bonds and/or other non-covalent attractions. In the latter case, the chelating agent may become ionized by reaction with the cation and/or with a solvent, e.g., water. For example, an oxo-acid-type group of the (neutral) chelating agent, e.g., a phosphonate group or phosphonate ester group, may lose a hydrogen from a hydroxyl thereof, and the resulting oxide moiety might then participate in ionic bonding with the metal ion.
[0395] In some embodiments, the chelating agent is capable of removing a metal ion from a system by forming a complex (i.e., a chelate) so that the metal ion cannot readily participate in and/or catalyze chemical reactions.
[0396] In some embodiments, the chelating agent is capable interfering with, or elimination of, a metalloenzyme's functionality.
[0397] In some embodiments, a chelating agent can be a ligand. In some embodiments, a chelating agent can be an atom, hi some embodiments, a chelating agent can be an ion. In some embodiments, a composition may contain a chelating agent. Thus, in some embodiments, a chelating agent can be any organic or inorganic compound that will bind to a metal ion, e.g., a metal ion having a valence greater than one.
[0398] In some embodiments, chelating agents are capable of forming more than one bond. Ethylene diamine, for example, is bidentate (two links), tripyridyl is tridentate (three) and ethylene diamine tetra acetic acid (EDTA) is hexadentate (six) which makes it particularly effective as a chelating agent.
[0399] In some embodiments, a chelating agent is operable to bind to a metal ion.
[0400] In some embodiments, a chelating agent is operable to bind to a metal ion, e.g., without limitation: Al3+; Ag+; As3+; Au+; Au3+; Ba2+; Be2+; Ca2+; Cd2+; Co2+; Co3+; Cr2+; Cr3+; Cs+; Cu+; Cu2+; Fe2+; Fe3+; Ga3+; Hg2+; Hg2 2+; In3+; K+; Li+; Mg2+; Mn2+; Na+; Ni2+; Pb2+; Pb++; Sn2+; Sn++; Sr2+; or Zn2+.
[0401] In some embodiments, a chelating agent is operable to bind Zn2+, Ca2+, Hg2+, Cd2+, Pb2+, Na+, Mg2+, Mn2+, Fe2+, Co2+, Ni2+, and Cu2+.
[0402] In some embodiments, a chelating agent is operable to bind Mg2+, Mn2+, Zn2+, Co2+, or Fe2+, or Cu2+.
[0403] In some embodiments, a chelating agent is operable to bind Zn2+, Ca2+, Mg2+, Hg2+, Cd2+, or Pb2+.
[0404] In some embodiments, a chelating agent is operable to bind Ca2+; Co2+; Cu2+, Mg2+; Fe3+, or Pb2+.
[0405] In some embodiments, a chelating agent is operable to bind Ca2+, Mg2+, Fe2+ or Pb2+.
[0406] In some embodiments, a chelating agent is operable to bind Na+, K+, Li+, Mg2+, or Ca2+.
[0407] In some embodiments, the metal ion is Ca2+ or Mg2+.
[0408] As used herein, a chelating agent that is operable to bind to a metal ion and form a chelate therewith is described herein as “[metal-ion] chelating agent.” Thus, an Al3+ chelating agent is operable to bind an Al3+ metal ion; an Ag+ chelating agent is operable to bind an Ag+ metal ion; an As3+ chelating agent is operable to bind an As3+ metal ion; an Au+ chelating agent is operable to bind an Au+ metal ion; an Au3+ chelating agent is operable to bind an Au3+ metal ion; a Ba2+ chelating agent is operable to bind a Ba2+ metal ion; a Be2+ chelating agent is operable to bind a Be2+ metal ion; a Ca2+ chelating agent is operable to bind a Ca2+ metal ion; a Cd2+ chelating agent is operable to bind a Cd2+ metal ion; a Co2+ chelating agent is operable to bind a Co2+ metal ion; a Co3+ chelating agent is operable to bind a Co3+ metal ion; a Cr2+ chelating agent is operable to bind a Cr2+ metal ion; a Cr3+ chelating agent is operable to bind ; a Cr3+ metal ion; a Cs+ chelating agent is operable to bind a Cs+ metal ion; a Cu+ chelating agent is operable to bind a Cu+ metal ion; a Cu2+ chelating agent is operable to bind a Cu2+ metal ion; a Fe2+ chelating agent is operable to bind a Fe2+ metal ion; a Fe3+ chelating agent is operable to bind a Fe3+ metal ion; a Ga3+ chelating agent is operable to bind a Ga3+ metal ion; a Hg2+ chelating agent is operable to bind a Hg2+ metal ion; a Hg22+ chelating agent is operable to bind a Hg22+ metal ion; a In3+ chelating agent is operable to bind a hi3+ metal ion; a K+ chelating agent is operable to bind a K+ metal ion; a Li+ chelating agent is operable to bind a Li+ metal ion; a Mg2+ chelating agent is operable to bind a Mg2+ metal ion; a Mn2+ chelating agent is operable to bind a Mn2+metal ion; an Na+ chelating agent is operable to bind an Na+ metal ion; an Ni2+ chelating agent is operable to bind an Ni2+ metal ion; a Pb2+ chelating agent is operable to bind a Pb2+ metal ion; a Pb++ is operable to bind a Pb++ metal ion; a Sn2+ chelating agent is operable to bind a Sn2+ metal ion; a Sn++ chelating agent is operable to bind a Sn++ metal ion; a Sr2+ chelating agent is operable to bind a Sr2+ metal ion; and a Zn2+ chelating agent is operable to bind a Zn2+ metal ion.
[0409] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Sn++ chelating agent; a Sr2+ chelating agent.
[0410] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Zn2+ chelating agent.
[0411] In some embodiments, the chelating agent may contain an amino group and may be, for example, an amino-polycarboxylate or a phosphonate. The amino-containing chelating agent may be a monomeric molecule comprising one, two or three amino groups (typically secondary or tertiary amino groups), and it may contain two, three, four or five carboxyl groups or even more carboxyl groups.
[0412] In some embodiments, the chelating agents may be phosphorus containing, hi other embodiments, the chelating agents do not contain phosphorous.
[0413] In some embodiments, the chelating agents may be carboxylates or be based on carboxylate groups.
[0414] In some embodiments, the chelating agents may be chelating agents which originate from plant material, such as starch-containing materials
[0415] In some embodiments, the chelating agent can be a metal-ion chelating agent.
[0416] In some embodiments, the chelating agent can be a metal-ion chelating agent such as: an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0417] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Al3+ chelating agent.
[0418] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Ag+ chelating agent.
[0419] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an As3+ chelating agent.
[0420] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Au+ chelating agent.
[0421] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Au3+ chelating agent.
[0422] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ba2+ chelating agent.
[0423] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Be2+ chelating agent. [0424] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ca2+ chelating agent.
[0425] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cd2+ chelating agent.
[0426] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Co2+ chelating agent.
[0427] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Co3+ chelating agent.
[0428] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cr2+ chelating agent.
[0429] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cr3+ chelating agent.
[0430] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cs+ chelating agent.
[0431] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cu+ chelating agent.
[0432] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Cu2+ chelating agent.
[0433] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Fe2+ chelating agent.
[0434] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Fe3+ chelating agent.
[0435] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Ga3+ chelating agent.
[0436] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Hg2+ chelating agent.
[0437] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Hg22+ chelating agent.
[0438] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a hi3+ chelating agent.
[0439] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a K+ chelating agent.
[0440] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Li+ chelating agent. [0441] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Mg2"1" chelating agent.
[0442] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Mn2+ chelating agent.
[0443] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Na+ chelating agent.
[0444] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is an Ni2+ chelating agent.
[0445] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Pb2+ chelating agent.
[0446] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Pb++ chelating agent.
[0447] In some embodiments, an antimicrobial combination of the present disclosure comprises an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; or an antimicrobial composition further comprising an excipient, wherein the chelating agent is a Sn2+ chelating agent.
[0448] In some embodiments, the chelating agent can be: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0449] In some embodiments, an antimicrobial combination of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is EDTA, or an s EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof. [0450] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
[0451] COMBINATIONS AND MIXTURES
[0452] The present disclosure contemplates mixtures, combinations, compositions, products, and transgenic organisms that contain — or, in the case of transgenic organisms, express or otherwise produce — any of the AMPs as described herein in combination with a chelating agent.
[0453] In some embodiments, a combination can be a “mixture.” For example, in some embodiments, a mixture refers to a combination of a first component, and one or more additional components, wherein the first component and the one or more additional components are present together in a single entity (e.g., a single unit). Thus, in some embodiments, a mixture can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components are present in admixture for simultaneous administration. Accordingly, in some embodiments, a combination can refer to the association of an AMP and a chelating agent; wherein the AMP and the chelating agent are present in a single entity (e.g., an admixture for simultaneous administration).
[0454] In some embodiments, a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components, are present separately (e.g., more than one unit). For example, in some embodiments, a combination can comprise a first component, and one or more additional components, wherein the first component and the one or more additional components may be administered separately, sequentially, simultaneously, concurrently or chronologically staggered.
[0455] Accordingly, in some embodiments, a combination can refer to the association of an AMP and a chelating agent; and wherein the AMP and the chelating agent are present separately (e.g., different units for separate, sequential, simultaneous, concurrent or chronologically- staggered administration) .
[0456] In some embodiments, a combination can refer to the separate, sequential, simultaneous, concurrent or chronologically-staggered application of two or more separate components (e.g., an AMP and a chelating agent).
[0457] For example, in some embodiments, a “combination” refers to the result of a simultaneous application of both an AMP and a chelating agent.
[0458] In another embodiment, a “combination” refers to the result of a separate application of an AMP and a chelating agent.
[0459] In a further embodiments, a “combination” refers to the result of a sequential application of two or more separate components, e.g., a first application an AMP, followed by a second application of a chelating agent, or vice versa. Where the application is sequential or separate, the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0460] Wild-type antimicrobial peptides and chelating agents
[0461] Any of the wild-type antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent. For example, in some embodiments, a wild-type antimicrobial peptide of the present disclosure having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least
91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least
95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
[0462] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
[0463] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
[0464] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type defensin peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
[0465] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
[0466] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture. [0467] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide is a is a wild-type NCR 1 peptide (NCR01), a wild-type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wildtype NCR 4 peptide (NCR04), a wild-type NCR 5 peptide (NCR05), a wild-type NCR 6 peptide (NCR06), a wild-type NCR 7 peptide (NCR07), a wild-type NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide (NCR11), a wild-type NCR 12 peptide (NCR12), a wild-type NCR 13 peptide (NCR13), a wild-type NCR 14 peptide (NCR14), or a wild-type NCR 15 peptide (NCR15), or a wild-type agriculturally acceptable salt thereof.
[0468] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628 [0469] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously. [0470] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0471] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0472] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0473] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0474] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
[0475] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0476] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0477] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0478] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0479] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0480] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild- type NCR 13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1.
[0481] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0482] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0483] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0484] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination. [0485] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination. [0486] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NOs: 1 or 14.
[0487] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type antimicrobial peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1-19628 [0488] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0489] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0490] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0491] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination. [0492] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type antimicrobial peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination. [0493] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1-32.
[0494] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0495] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0496] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0497] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0498] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR peptide consisting of an amino acid sequence of any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0499] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture; and wherein the wild-type NCR peptide consists of an amino acid sequence set forth in SEQ ID NOs: 1.
[0500] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0501] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0502] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0503] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0504] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a wild-type NCR13 peptide consisting of an amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0505] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the WT-NCR13 peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
[0506] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
[0507] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an AU3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; anNa+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0508] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0509] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0510] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least
94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least
98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a hi3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0511] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least
94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least
98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA;
N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3 -(4-ethoxyphenyl)propyl)]-N- [2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1, 4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0512] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0513] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2 "-nitrilotriacetate (NTA); citrate; 2-hydroxypropan-1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTPA); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl- DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2-[bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N, N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0514] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14, or an agriculturally acceptable salt thereof; and a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2 "-nitrilotriacetate (NTA); citrate; 2-hydroxypropan-1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTPA); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl- DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2-[bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0515] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type NCR13 peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequences set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)- 1,4,7,10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine- 1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane- 1,4,7,10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N"', N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)- 1,4, 8, 11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1, 4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0516] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMPA); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N , N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0517] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide consisting of the amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA. [0518] Any of the wild- type antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent. For example, in some embodiments, a wild-type antimicrobial peptide of the present disclosure having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1-19628, can be used to make an antimicrobial combination of the present disclosure, comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
[0519] Other antimicrobial combinations
[0520] Any of the mutant antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent. For example, in some embodiments, an antimicrobial peptide selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a chelating agent.
[0521] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0522] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0523] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
[0524] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
[0525] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
[0526] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
[0527] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
[0528] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0529] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0530] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0531] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0532] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0533] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0534] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; wherein the combination is a mixture.
[0535] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0536] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0537] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0538] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0539] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0540] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent. [0541] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent.
[0542] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0543] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA- BMA); N-[2-[bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N"', N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1, 4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0544] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0545] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0546] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0547] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
[0548] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
[0549] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
[0550] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
[0551] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
[0552] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0553] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0554] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0555] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0556] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0557] In some embodiments, an antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0558] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and a chelating agent; wherein the combination is a mixture.
[0559] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied simultaneously.
[0560] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied separately.
[0561] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein (1) and (2) are applied sequentially.
[0562] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0563] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0564] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
[0565] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent.
[0566] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and a chelating agent, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0567] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3 -(4-ethoxyphenyl)propyl)]-N- [2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)- 1,4,7,10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane- 1,4,7,10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N"', N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1, 4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof.
[0568] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0569] RATIOS
[0570] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, wherein the ratio of (1):(2) ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000: 1 , about 1 :5 to about 5000: 1 , about 6: 10 to about 5000: 1 , about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:l, or from about 1 :10 to about 1000:1, or from about 1:10 to about 500:1, or from about 1 :10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1:10 to about 1 :9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1 :10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1 :5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1 :10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1 :10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1 :2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, and all integers and values therebetween.
[0571] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, wherein the ratio of (1):(2) ranges from about 1:10 to about 5000:1, or ranges from about 1:10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:l, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1 :10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1 :10 to about 19:1, about 1 :10 to about 20:1, about 1:10 to about 21:1, about 1:10 to about 22:l, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1:10 to about 25:1, about 1 :10 to about 26:1, about 1:10 to about 27:1, about 1:10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1:10 to about 32:1, about 1 :10 to about 33:1, about 1:10 to about 34:1, about 1:10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1:10 to about 39:1, about 1 :10 to about 40:1, about 1:10 to about 41:1, about 1:10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1:10 to about 46:1, about 1 :10 to about 47:1, about 1:10 to about 48:1, about 1:10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51:1, about 1:10 to about 52:1, about 1:10 to about 53:1, about 1 :10 to about 54:1, about 1:10 to about 55:1, about 1:10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1:10 to about 60:1, about 1 :10 to about 61 :1, about 1:10 to about 62:1, about 1:10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1:10 to about 67:1, about 1 :10 to about 68:1, about 1:10 to about 69:1, about 1:10 to about 70:1, about 1:10 to about 71:1, about 1:10 to about 72:1, about 1:10 to about 73:1, about 1:10 to about 74:1, about 1 :10 to about 75:1, about 1:10 to about 76:1, about 1:10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1:10 to about 81:1, about 1 :10 to about 82:1, about 1:10 to about 83:1, about 1:10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1:10 to about 88:1, about 1 :10 to about 89:1, about 1:10 to about 90:1, about 1:10 to about 91 :1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1:10 to about 95:1, about 1 :10 to about 96:1, about 1:10 to about 97:1, about 1:10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111 :1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141:1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181 :1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211:1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to
Il l about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251 :1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281:1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321 :1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1:10 to about 330:1, and all integers and values therebetween. [0572] In the preceding examples of ratios of (1) to (2), the AMP can be any antimicrobial peptide described herein, for example, an AMP having an amino acid sequence of any one of SEQ ID NOs: 1-19634 , or an agriculturally acceptable salt thereof.
[0573] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 5000:1.
[0574] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 5000:1, about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1.
[0575] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 3000:1. [0576] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 1000:1.
[0577] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 500:1. [0578] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) ranges from about 1 :10 to about 400:1. [0579] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 300:1. [0580] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 5000:1. [0581] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 3000:1. [0582] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 1000:1. [0583] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 500:1. [0584] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 400:1. [0585] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) ranges from about 1 :1 to about 300:1. [0586] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1 :10 to about 1:8.75, from about 1 :10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1 :7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1 :5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1.
[0587] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1 :8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1 :10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1 :10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1 :1.5, from about 1:10 to about 1:1.25, or from about 1 : 10 to about 1 :1.
[0588] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1:10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1 :10 to about 17:1, about 1:10 to about 18:1, about 1:10 to about 19:1, about 1:10 to about 20:1, about 1:10 to about 21:1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1 :10 to about 24:1, about 1:10 to about 25:1, about 1:10 to about 26:1, about 1:10 to about 27:1, about 1:10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1 :10 to about 31 :1, about 1:10 to about 32:1, about 1:10 to about 33:1, about 1:10 to about 34:1, about 1:10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1 :10 to about 38:1, about 1:10 to about 39:1, about 1:10 to about 40:1, about 1:10 to about 41:1, about 1:10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1 :10 to about 45:1, about 1:10 to about 46:1, about 1:10 to about 47:1, about 1:10 to about 48:1, about 1:10 to about 49:1, about 1:10 to about 50:l, about 1:10 to about 51:l, about 1 :10 to about 52:1, about 1:10 to about 53:1, about 1:10 to about 54:1, about 1:10 to about 55:1, about 1:10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1 :10 to about 59:1, about 1:10 to about 60:1, about 1:10 to about 61 :1, about 1:10 to about 62:1, about 1:10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1 :10 to about 66:1, about 1:10 to about 67:1, about 1:10 to about 68:1, about 1:10 to about 69:1, about 1:10 to about 70:1, about 1:10 to about 71:l, about 1:10 to about 72:1, about 1 :10 to about 73:1, about 1:10 to about 74:1, about 1:10 to about 75:1, about 1:10 to about 76:1, about 1:10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1 :10 to about 80:1, about 1:10 to about 81:1, about 1:10 to about 82:1, about 1:10 to about 83:1, about 1:10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1 :10 to about 87:1, about 1:10 to about 88:1, about 1:10 to about 89:1, about 1:10 to about 90:1, about 1:10 to about 91:1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1 :10 to about 94:1, about 1:10 to about 95:1, about 1:10 to about 96:1, about 1:10 to about 97:1, about 1:10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111:1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141:1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151 :1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181:1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211:1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221 :1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251:1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281:1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291 :1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321:1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1 :10 to about 330:1. [0589] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2)
[0590] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 319.6030164.
[0591] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 317.1530072.
[0592] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 252.4672893.
[0593] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 145.4905117.
[0594] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 129.4347391.
[0595] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 124.2900619. [0596] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 87.94027452. [0597] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 86.24648324. [0598] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 77.5140482. [0599] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.897205. [0600] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.44210553. [0601] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 72.98700605. [0602] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 53.38351062.
[0603] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 50.94513553.
[0604] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 49.98224086.
[0605] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 40.88162007.
[0606] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 37.17101954.
[0607] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 34.35145587.
[0608] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.97249146. [0609] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.69789197.
[0610] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 32.90403423.
[0611] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.89973577.
[0612] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.85696326.
[0613] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 26.92272685.
[0614] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.34350224.
[0615] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 22.07788497. [0616] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.02784114. [0617] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 20.15554593. [0618] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.31431086. [0619] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.17059524. [0620] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.81691793. [0621] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.3653315. [0622] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 15.94308131.
[0623] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 15.84806932.
[0624] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 12.25073038.
[0625] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 11.87450341.
[0626] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.72015899.
[0627] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.61784715.
[0628] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.0903766. [0629] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 9.56792468.
[0630] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.89924782.
[0631] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.77691845.
[0632] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.563483639.
[0633] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 7.655822524.
[0634] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 5.84571854.
[0635] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 4.758355866. [0636] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 4.155776786. [0637] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.778146876. [0638] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.014708952. [0639] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.620072693. [0640] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.582603977. [0641] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.212878425. [0642] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 1.886062254.
[0643] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.860604057.
[0644] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.826172189.
[0645] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.355945504.
[0646] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.11798779.
[0647] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.055796564.
[0648] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.977591312. [0649] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.770646517.
[0650] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.750571954.
[0651] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.730349113.
[0652] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.599431023.
[0653] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.536093495.
[0654] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.40062441.
[0655] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 0.356748372. [0656] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.327975307. [0657] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.254984024. [0658] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.22877018. [0659] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.139327165.
[0660] COMPOSITIONS AND FORMULATIONS
[0661] In some embodiments, an antimicrobial combination of the present disclosure can further comprise one or more excipients.
[0662] In some embodiments, an antimicrobial combination of the present disclosure is formulated in separate compositions.
[0663] In some embodiments, an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated as powders, dusts, pellets, granules, sprays, emulsions, colloids, solutions, or combinations thereof.
[0664] In some embodiments, an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated using the same excipients or different excipients. [0665] In some embodiments, an antimicrobial combination of the present disclosure is formulated is formulated in a single composition.
[0666] In some embodiments, an antimicrobial combination of the present disclosure is formulated is formulated in a single composition, wherein the single composition is formulated as a powder, a dust, a pellet, a granule, a spray, an emulsion, a colloid, a solution, or combinations thereof.
[0667] In some embodiments, an antimicrobial combination of the present disclosure is formulated in separate compositions, wherein the separate compositions are formulated using the same excipients or different excipients.
[0668] Excipients: generally
[0669] In some embodiments, an antimicrobial combination of the present disclosure comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; can further comprise one or more excipients.
[0670] For example, in some embodiments, the excipient can be any agriculturally acceptable additive, carrier, surfactant, emulsifier, thickener, preservative, solvent, disintegrant, glidant, lubricant, diluent, filler, bulking agent, binder, emollient, stiffening agent, stabilizer, solubilizing agents, dispersing agent, suspending agent, antioxidant, antiseptic, wetting agent, humectant, fragrant, suspending agents, pigments, colorants, isotonic agents, viscosity enhancing agents, mucoadhesive agents, and/or any combination thereof.
[0671] The use of excipients for the formulation of agricultural compositions is known to those having ordinary skill in the art.
[0672] In some embodiments, the excipient can be added to an antimicrobial composition, preparation, and/or formulation of the present disclosure, which may aid in achieving a desired modification to the characteristics of the antimicrobial composition, preparation, and/or formulation. Such modifications include, but are not limited to, physical stability, chemical stability, therapeutic efficacy, and/or any combination thereof.
[0673] In some embodiments, excipients can be formulated alongside a combination of a an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, when preparing an antimicrobial composition, e.g., for the purpose of bulking up compositions (thus often referred to as bulking agents, fillers or diluents).
[0674] In yet other embodiments, an excipient can be used to provide stability, or prevent contamination. In other embodiments, an excipient can be used to confer a physical property to a composition (e.g., a composition that is a dry granular, or dry flowable powder physical form). Reference to an excipient includes both one and more than one such excipients. Suitable excipients are described in Remington's Pharmaceutical Sciences, by E.W. Martin, the disclosure of which is incorporated herein by reference in its entirety. [0675] In some embodiments, e.g., the excipient can be independently selected from thickeners, viscosity enhancing agents, bulking agents, penetration enhancers, buffers, preservatives, diluents, binders, lubricants, glidants, disintegrants, fillers, solubilizing agents, pH modifying agents, preservatives, stabilizing agents, anti-oxidants, wetting or emulsifying agents, suspending agents, pigments, colorants, isotonic agents, emulsifiers, and diagnostic agents.
[0002] In some embodiments, an antimicrobial composition of the present disclosure comprising an excipient may contain an amount of excipient ranging from about 0.005 wt% to about 99 wt%.
[0676] Formulations: generally
[0677] Any of the antimicrobial compositions of the present disclosure can be formulated according to the methods described herein, and used to inhibit microbe growth and/or proliferation, and/or kill the microbes, and/or control the damage caused by their actions, especially their damage to plants.
[0678] Antimicrobial compositions of the present disclosure can be formulated for use as agrochemical compositions. For example, in some embodiments, agrochemical compositions can include, but is not limited to, aerosols and/or aerosolized products (e.g., sprays, fumigants, powders, dusts, and/or gases); granules, dusts, powders, or seed dressings. [0679] In some embodiments, the antimicrobial compositions may be formulated as a powder, dust, pellet, granule, spray, emulsion, colloid, solution, or such like, and may be prepared by such conventional means as desiccation, lyophilization, homogenization, extraction, filtration, centrifugation, or sedimentation, hi all such compositions, the antimicrobial peptide may be present in a concentration of from about 1 % to about 99% by weight.
[0680] The compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline and/or other buffer. In some embodiments, the formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application. Suitable carriers can be solid or liquid and are well known in the art. hi some embodiments, the compositions may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional compositions techniques. Suitable compositions and application methods are described in U.S. Pat. No. 6,468,523, the disclosure of which is incorporated by reference herein in its entirety.
[0681] In some embodiments, the active ingredients of the present disclosure can be applied in the form of compositions and can be applied to the crop area or plant to be treated, simultaneously or in succession, with other non-active compounds. These compounds can be fertilizers, weed killers, cryoprotectants, surfactants, detergents, soaps, dormant oils, polymers, and/or time-release or biodegradable carriers that permit long-term dosing of a target area following a single application of the composition. One or more of these non-active compounds can be prepared, if desired, together with further agriculturally acceptable carriers, surfactants or application-promoting adjuvants customarily employed in the art of composition. Suitable carriers and adjuvants can be solid or liquid and correspond to the substances ordinarily employed in composition technology, e.g. natural or regenerated mineral substances, solvents, dispersants, wetting agents, tackifiers, binders or fertilizers.
[0682] Methods of applying an active ingredients of the present disclosure or an agrochemical composition of the present disclosure that has an antimicrobial peptide and a chelating agent, as produced by the methods described herein of the present disclosure, include leaf application, seed coating and soil application. In some embodiments, the number of applications and the rate of application depend on the intensity of infestation by the corresponding pest.
[0683] In some embodiments, antimicrobial compositions of the present disclosure may be prophylactically applied to an environmental area to prevent infection by a pathogenic microbe, which may be killed or reduced in numbers in a given area by the methods of the present disclosure, hi some embodiments, the microbe comes into contact with, an antimicrobially-effective amount of the antimicrobial compositions of the present disclosure as described herein.
[0684] In some embodiments, the antimicrobial compositions of the present disclosure may be made by formulating the peptide and chelating agent with the desired agriculturally-acceptable carrier. The combinations and/or compositions may be formulated prior to administration in an appropriate means such as lyophilized, freeze-dried, desiccated, or in an aqueous carrier, medium or suitable diluent, such as saline and/or other buffer. In some embodiments, the formulated compositions may be in the form of a dust or granular material, or a suspension in oil (vegetable or mineral), or water or oil/water emulsions, or as a wettable powder, or in combination with any other carrier material suitable for agricultural application. Suitable agricultural carriers can be solid or liquid and are well known in the art. In some embodiments, the composition may be mixed with one or more solid or liquid adjuvants and prepared by various means, e.g., by homogeneously mixing, blending and/or grinding the pesticidal composition with suitable adjuvants using conventional composition techniques. Suitable composition and application methods are described in U.S. Pat. No. 6,468,523, herein incorporated by reference in its entirety.
[0685] In some embodiments an antimicrobial composition of the present disclosure can be formulated at a pH ranging from about 5 to about 11 ; from about 5.5 to about 11 ; from about 6 to about 11 ; from about 6.5 to about 11; from about 7 to about 11 ; from about 7.5 to about 11 ; from about 8 to about 11 ; from about 8.5 to about 11 ; from about 9 to about 11 ; from about 9.5 to about 11; from about 10 to about 11; or from about 10.5 to about 11.
[0686] In some embodiments an antimicrobial composition of the present disclosure can be formulated at a pH ranging from about 5 to about 11; from about 5 to about 10.5; from about 5 to about 10; from about 5 to about 9.5; from about 5 to about 9; from about 5 to about 8.5; from about 5 to about 8; from about 5 to about7.5; from about 5 to about7; from about 5 to about 6.5; from about 5 to about 6; or from about 5 to about 5.5.
[0687] In some embodiments an antimicrobial composition of the present disclosure can be formulated into a granule form (granular formulation). Methods of generating a granular formulation are well known in the art, and include: crystallization, precipitation, pan-coating, fluid bed coating, agglomeration (e.g., fluid bed agglomeration), rotary atomization, extrusion, prilling, spheronization, size reduction methods, drum granulation, and/or high shear granulation, and the like.
[0688] In some embodiments, the granular formulation can be generated via agglomeration, e.g., spray-drying agglomeration; rewet agglomeration; fluid bed agglomeration; and the like.
[0689] In some embodiments, the type of agglomeration can be fluid bed agglomeration. Exemplary methods of fluid bed agglomeration are provided in U.S. Patent No. 7,582,147 ; the disclosure of which is incorporated herein by reference in its entirety. [0690] In some embodiments, the granular formulation can be generated via fluid bed agglomeration.
[0691] In some embodiments, the granular formulation can be generated by spraying the active and inert ingredients onto a blank carrier in a fluid bed. [0692] In some embodiments, the granular formulation can be generated by spraying the active and inert ingredients (excipients) onto a blank carrier and granulated in pan granulator.
[0693] In some embodiments, the granular formulation can be generated by mixing the active and inert powders (i.e., one or more excipients described herein) and water, and subsequently granulated by passing the ingredients through an extruder.
[0694] In some embodiments, the granular formulation can be generated by mixing the active and inert powders (i.e., one or more excipients described herein) with water, and granulated by roll compaction.
[0695] Antimicrobial compositions comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, can include, but are not limited to, aerosols and/or aerosolized products, e.g., sprays, fumigants, powders, dusts, and/or gases; and/or seed dressings.
[0696] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient.
[0697] Wild-type compositions
[0698] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide or a wild-type defensin.
[0699] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-837.
[0700] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
[0701] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type defensin peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least
94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least
98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type defensin peptide amino acid sequences set forth in any one of SEQ ID NOs: 838-19628.
[0702] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type plant defensin peptide comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type plant defensin peptide amino acid sequences set forth in any one of SEQ ID NOs: 838-4109.
[0703] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild- type NCR 13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild- type NCR 13 peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14.
[0704] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the WT-NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least
92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least
96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least
99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1. [0705] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent. [0706] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; anNa+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent. [0707] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2,3,-dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0708] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
[0709] Any of the following types of compositions or formulations can be made using any of the wild-type antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA, or a EDTA derived salt thereof), and any of the excipients described herein. For example, in some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a wildtype antimicrobial peptide consisting of an amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, or an EDTA derived salt thereof. [0710] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; anNa+ chelating agent; anNi2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0711] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N,N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0712] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0713] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32, or an agriculturally acceptable salt thereof; and wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane
N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0714] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14, or an agriculturally acceptable salt thereof; and wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0715] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wildtype NCR13 peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequences set forth in SEQ ID NO: 1 ; and wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N,N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0716] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient.
[0717] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide or a wild-type defensin.
[0718] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1- 837.
[0719] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type NCR peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 1-32. [0720] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type defensin peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-19628.
[0721] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is a wild-type plant defensin peptide consisting of an amino acid sequence set forth in any one of SEQ ID NOs: 838-4109.
[0722] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild- type NCR 13 peptide consists of an amino acid sequence set forth in any one of SEQ ID NOs: 1 or 14.
[0723] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the WT-NCR13 peptide consists of an amino acid sequence as set forth in SEQ ID NO: 1 .
[0724] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent. [0725] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; anNa+ chelating agent; anNi2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[0726] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N, N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0727] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA.
[0728] Any of the compositions or formulations described herein can be made using any of the wild-type antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA, or a EDTA derived salt thereof), and any of the excipients described herein. For example, and without limitation, in some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a wild-type antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, or an EDTA derived salt thereof.
[0729] Mutant and other peptide compositions
[0730] Any of the mutant antimicrobial peptides and chelating agents described herein can be used to create an antimicrobial composition comprising an antimicrobial combination of the present disclosure, i.e., an antimicrobial composition comprising: an AMP, or an agriculturally acceptable salt thereof, a chelating agent; and an excipient. For example, in some embodiments, antimicrobial composition comprises: an antimicrobial peptide selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient (e.g., any excipient as described herein).
[0731] In some embodiments, an antimicrobial composition comprises an antimicrobial combination of: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[0732] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; and an excipient; wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0733] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630).
[0734] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631).
[0735] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632).
[0736] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633).
[0737] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634).
[0738] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0739] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0740] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0741] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0742] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions. [0743] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof and (2) a chelating agent; wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions.
[0744] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein (1) and (2) are applied sequentially; and wherein the first and second excipient is the same or different.
[0745] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0746] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0747] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent.
[0748] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) a peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and one or more excipients; wherein the chelating agent is a metal- ion chelating agent.
[0749] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an AS3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a hi3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; anNi2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2"1" chelating agent; or a Zn2+ chelating agent. [0750] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; (2) a chelating agent; and an excipient; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2"- nitrilotriacetate (NT A); citrate; 2-hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0751] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; and further comprising an excipient; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0752] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP is selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and an excipient.
[0753] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629).
[0754] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630); and an excipient.
[0755] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); and an excipient.
[0756] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); and an excipient.
[0757] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); and an excipient.
[0758] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); and an excipient.
[0759] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“KTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19629); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
[0760] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of:
“GKTCENLADTYKGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTKNC” (SEQ ID NO: 19630) wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient. [0761] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHHCFCYFNC” (SEQ ID NO: 19631); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
[0762] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GQKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC” (SEQ ID NO: 19632); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
[0763] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GKTCENLADTFRGPCFTDGSCDDHCKNKEHLIKGRCRDDFRCWCTRNC” (SEQ ID NO: 19633); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
[0764] In some embodiments, an antimicrobial composition comprises: (1) fermentation beer from a recombinant cell operable to express an AMP; and (2) a chelating agent, wherein the AMP has an amino acid sequence as set forth of: “GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC” (SEQ ID NO: 19634); wherein the AMP further comprises 1, 2, 3, 4, or 5 conservative amino acid substitutions; and an excipient.
[0765] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: fermentation beer from a recombinant cell operable to express peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); a chelating agent; and an excipient; wherein the combination is a mixture.
[0766] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and further comprises an excipient; wherein (1) and (2) are applied simultaneously.
[0767] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and further comprising an excipient; wherein (1) and (2) are applied separately.
[0768] In some embodiments, an antimicrobial combination of the present disclosure comprises, consists essentially of, or consists of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and an excipient; wherein (1) and (2) are applied sequentially.
[0769] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination comprising: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; and an excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0770] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination comprising: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), and (2) a chelating agent; and further comprising an excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0771] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein (1) and (2) are applied sequentially; and wherein the first and second excipient is the same or different.
[0772] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (1), followed by a second application of (2); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0773] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, an antimicrobial combination of: (1) fermentation beer from a recombinant cell operable to express an AMP selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a first excipient; and (2) a chelating agent and a second excipient; wherein there is a first application of (2), followed by a second application of (1); and wherein the delay in applying the second component should not be such as to lose the beneficial effect of the combination.
[0774] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of, a mutant antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
[0775] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is a metal-ion chelating agent. [0776] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a hi3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; anNi2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent. [0777] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is selected from: ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2, 2', 2 "-nitrilotriacetate (NTA); citrate; 2-hydroxypropan-1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTPA); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl- DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2-[bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)- 1,4,7,10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane- 1,4,7,10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8, 11- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11 -tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N"', N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1, 4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,1 -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [0778] In some embodiments, an antimicrobial composition of the present disclosure comprises, consists essentially of, or consists of: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) fermentation beer from a recombinant cell operable to express an AMP selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634); and (2) a chelating agent; wherein the chelating agent is EDTA, or a salt derivative of EDTA, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, or a salt thereof.
[0779] Spravable compositions
[0780] Examples of spray products of the present disclosure can include field sprayable compositions for agricultural usage and indoor sprays for use in interior spaces in a residential or commercial space, hi some embodiments, residual sprays or space sprays having an antimicrobial peptide, a chelating agent, and an excipient can be used to reduce or eliminate microbes in an interior space.
[0781] Surface spraying indoors (SSI) is the technique of applying a variable volume sprayable volume of a composition onto indoor surfaces where vectors rest, such as on walls, windows, floors and ceilings. The primary goal of variable volume sprayable volume is to reduce the fifespan of the microbe and thereby reduce or interrupt disease transmission. As its name implies, SSI involves applying the composition onto the walls and other surfaces of a house with a residual antimicrobial (e.g., an antimicrobial peptide).
[0782] In one embodiment, the composition having an antimicrobial peptide, a chelating agent, and an excipient will inhibit growth and/or proliferation of microbes that come in contact with these surfaces.
[0783] In contrast to SSI, which requires that the active antimicrobial peptide be bound to surfaces of dwellings, such as walls or ceilings, as with a paint, for example, space spray products of the disclosure rely on the production of a large number of small droplets intended to be distributed through a volume of air over a given period of time. When these droplets impact on a target microbe, they deliver an effective dose of the antimicrobial peptide effective to inhibit or kill the microbe. The traditional methods for generating a space-spray include thermal fogging (whereby a dense cloud of a composition having an antimicrobial peptide and a chelating agent is produced giving the appearance of a thick fog) and Ultra Low Volume (ULV), whereby droplets are produced by a cold, mechanical aerosolgenerating machine. Ready-to-use aerosols such as aerosol cans may also be used.
[0784] In some embodiments, a sprayable composition may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
[0785] In some embodiments, a sprayable composition may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0786] Foams
[0787] The antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient may be made available in a spray product as an aerosol-based application, including aerosolized foam applications. Pressurized cans are the typical vehicle for the formation of aerosols. An aerosol propellant that is compatible with the composition having an antimicrobial peptide, a chelating agent, and an excipient are used. Preferably, a liquefied-gas type propellant is used.
[0788] Suitable propellants include compressed air, carbon dioxide, butane and nitrogen. The concentration of the propellant in the active compound composition is from about 5 percent to about 40 percent by weight of the pyridine composition, preferably from about 15 percent to about 30 percent by weight of the composition having an antimicrobial peptide, a chelating agent, and an excipient.
[0789] In one embodiment, antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient can also include one or more foaming agents. Foaming agents that can be used include sodium laureth sulfate, cocamide DEA, and cocamidopropyl betaine. Preferably, the sodium laureth sulfate, cocamide DEA and cocamidopropyl are used in combination. The concentration of the foaming agent(s) in the active compound composition is from about 10 percent to about 25 percent by weight, more preferably 15 percent to 20 percent by weight of the composition. [0790] When such compositions are used in an aerosol application not containing foaming agents, the active compositions of the present disclosure can be used without the need for mixing directly prior to use. However, aerosol compositions containing the foaming agents do require mixing (i.e., shaking) immediately prior to use. hi addition, if the compositions containing foaming agents are used for an extended time, they may require additional mixing at periodic intervals during use. [0791] In some embodiments, a foam may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
[0792] In some embodiments, a foam may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0793] Fabric treatments
[0794] In some embodiments, fabrics and garments may be made that contain an antimicrobially-effective composition of an antimicrobial peptide, a chelating agent, and an excipient. In some embodiments, the concentration of the wild-type antimicrobial peptide in the polymeric material, fiber, yarn, weave, net, or substrate described herein, can be varied within a relatively wide concentration range from, for example, 0.05 to 15 percent by weight, preferably 0.2 to 10 percent by weight, more preferably 0.4 to 8 percent by weight, especially 0.5 to 5, such as 1 to 3, percent by weight.
[0795] Similarly, the concentration of the antimicrobial composition of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient (whether for treating surfaces or for coating a fiber, yam, net, weave) can be varied within a relatively wide concentration range from, for example 0.1 to 70 percent by weight, such as 0.5 to 50 percent by weight, preferably 1 to 40 percent by weight, more preferably 5 to 30 percent by weight, especially 10 to 20 percent by weight.
[0796] The concentration of the wild-type antimicrobial peptide may be chosen according to the field of application such that the requirements concerning inhibitory or lethal efficacy, durability and toxicity are met. Adapting the properties of the material can also be accomplished and so custom-tailored textile fabrics are obtainable in this way.
[0797] Accordingly, an effective amount of an antimicrobial peptide can depend on the specific use pattern, the microbe against which control is most desired and the environment in which the wild-type antimicrobial peptide will be used. Therefore, an effective amount of an antimicrobial peptide is sufficient that inhibition or killing is achieved. [0798] In some embodiments, a fabric treatment may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
[0799] In some embodiments, a fabric treatment may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0800] Surface-treatment compositions
[0801] In some embodiments, the present disclosure provides compositions having an antimicrobial peptide, a chelating agent, and an excipient, for coating walls, floors and ceilings inside of buildings, and for coating a substrate or non-living material. The inventive compositions having an antimicrobial peptide, a chelating agent, and an excipient, can be prepared using known techniques for the purpose in mind. Preparations of antimicrobial compositions of the present disclosure comprising an antimicrobial peptide, a chelating agent, and an excipient could be so formulated to also contain a binder to facilitate the binding of the compound to the surface or other substrate. Agents useful for binding are known in the art and tend to be polymeric in form. The type of binder suitable for a compositions to be applied to a wall surface having particular porosities and/or binding characteristics would be different compared to a fiber, yarn, weave or net — thus, a skilled person, based on known teachings, would select a suitable binder based on the desired surface and/or substrate.
[0802] Typical binders include but are not limited to poly vinyl alcohol, modified starch, poly vinyl acrylate, polyacrylic, polyvinyl acetate co polymer, polyurethane, and modified vegetable oils. Suitable binders can include latex dispersions derived from a wide variety of polymers and co-polymers and combinations thereof. Suitable latexes for use as binders in the inventive compositions comprise polymers and copolymers of styrene, alkyl styrenes, isoprene, butadiene, acrylonitrile lower alkyl acrylates, vinyl chloride, vinylidene chloride, vinyl esters of lower carboxylic acids and alpha, beta-ethylenically unsaturated carboxylic acids, including polymers containing three or more different monomer species copolymerized therein, as well as post-dispersed suspensions of silicones or polyurethanes. Also suitable may be a polytetrafluoroethylene (PTFE) polymer for binding the active ingredient to other surfaces.
[0803] In some embodiments, a surface-treatment composition may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%. [0804] In some embodiments, a surface-treatment composition may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0805] Dispersants
[0806] In some exemplary embodiments, an antimicrobial composition of the present disclosure comprises an antimicrobial peptide, a chelating agent, and an excipient, wherein the excipient can be a diluent or carrier (e.g., such as water), a polymeric binder, and/or additional components such as a dispersing agent, a polymerizing agent, an emulsifying agent, a thickener, an alcohol, a fragrance, or any other inert excipients used in the preparation of sprayable actives known in the art.
[0807] In some embodiments, a dispersant may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%. [0808] In some embodiments, a dispersant may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0809] Suspensions
[0810] In some embodiments, an antimicrobial composition comprising an antimicrobial peptide, a chelating agent, and an excipient, can be prepared in a number of different forms or formulation types, such as suspensions or capsules suspensions. And a person skilled in the art can prepare the relevant composition based on the properties of the wild-type antimicrobial peptide, its uses, and also its application type.
[0811] For example, in some embodiments, the wild-type antimicrobial peptide used in the methods, embodiments, and other aspects of the present disclosure, may be encapsulated in a suspension or capsule suspension formulation. An encapsulated wild-type antimicrobial peptide protein can provide improved wash- fastness, and also a longer period of activity. The formulation can be organic based or aqueous based, preferably aqueous based.
[0812] In some embodiments, a suspension may contain an amount of an antimicrobial peptide ranging from about 0.00001 wt% to about 99 wt%.
[0813] In some embodiments, a suspension may contain an amount of a chelating agent ranging from about 0.00002 wt% to about 99 wt%.
[0814] Microencapsulation
[0815] Microencapsulated wild-type antimicrobial peptides suitable for use in the compositions and methods according to the present disclosure may be prepared with any suitable technique known in the art. For example, various processes for microencapsulating material have been previously developed. These processes can be divided into three categories: physical methods, phase separation, and interfacial reaction.
[0816] In the physical methods category, microcapsule wall material and core particles are physically brought together and the wall material flows around the core particle to form the microcapsule. In the phase separation category, microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase in which the wall material is dissolved and caused to physically separate from the continuous phase, such as by coacervation, and deposit around the core particles. In the interfacial reaction category, microcapsules are formed by emulsifying or dispersing the core material in an immiscible continuous phase and then an interfacial polymerization reaction is caused to take place at the surface of the core particles. The concentration of the wild-type antimicrobial peptide and/or chelating agent present in the microcapsules can vary from 0.1 to 99% by weight of the microcapsule.
[0817] In some embodiments, a microencapsulation may contain an amount of an antimicrobial peptide ranging from about 0.005 wt% to about 99 wt%.
[0818] In some embodiments, a microencapsulation may contain an amount of a chelating agent ranging from about 0.005 wt% to about 99 wt%.
[0819] Any of the compositions or formulations described herein can be made using any of the wild-type antimicrobial peptides described herein (e.g., an antimicrobial peptide having an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least
91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least
95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least
99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA), and any of the excipients described herein.
[0820] Any of the compositions or formulations described herein can additionally contain other known biologically active agents, such as, for example, a fungicide, herbicide, or insecticide.
[0821] Kits, compositions, dispersants, and the ingredients thereof
[0822] The combinations used in the antimicrobial compositions of the present disclosure comprising an antimicrobial peptide; a chelating agent; and an excipient, methods, embodiments and other aspects according to the present disclosure, may be formed by mixing all ingredients together with water, and optionally using suitable mixing and/or dispersing aggregates, hi general, such a combination is formed at a temperature of from 10 to 70°C, preferably 15 to 50°C, more preferably 20 to 40°C.
[0823] Generally, an antimicrobial composition of the present disclosure comprising one or more of (Al and A2), (B), (C), and/or (D) is possible, wherein it is possible to use: an antimicrobial peptide (Al) and a chelating agent (A2); solid polymer (B); optional additional additives (D); and to disperse them in the aqueous component (C). If a binder is present in a composition of the present disclosure, it is preferred to use dispersions of the polymeric binder (B) in water as well as aqueous compositions of the wild-type antimicrobial peptide (Al) and chelating agent (A2) in water which have been separately prepared before. Such separate compositions may contain additional additives for stabilizing (Al and A2) and/or (B) in the respective compositions and are commercially available. In a second process step, such raw compositions and optionally additional water (component (C)) are added. Also, combinations of the abovementioned ingredients based on the foregoing scheme are likewise possible, e.g., using a pre-formed dispersion of (Al and A2) and/or (B) and mixing it with solid (Al and A2) and/or (B). A dispersion of the polymeric binder (B) may be a premanufactured dispersion already made by a chemicals manufacturer.
[0824] Moreover, it is also within the scope of the present disclosure to use “handmade” dispersions, i.e., dispersions made in small-scale by an end-user. Such dispersions may be made by providing a mixture of about 20 percent of the binder (B) in water, heating the mixture to temperature of 90°C to 100°C and intensively stirring the mixture for several hours. It is possible to manufacture the composition as a final product so that it can be readily used by the end-user for the process according to the present disclosure. And, it is of course similarly possible to manufacture a concentrate, which may be diluted by the end-user with additional water (C) to the desired concentration for use.
[0825] In an embodiment, a composition (having an antimicrobial peptide, a chelating agent, and an excipient) suitable for SSI application or a coating formulation (having an antimicrobial peptide, a chelating agent, and an excipient), contains the active ingredient and a carrier, such as water, and may also one or more co-formulants selected from a dispersant, a wetter, an anti-freeze, a thickener, a preservative, an emulsifier and a binder or sticker.
[0826] In some embodiments, an exemplary solid combination of an antimicrobial peptide and a chelating agent, is generally milled to a desired particle size, such as the particle size distribution d(0.5) is generally from 3 to 20, preferably 5 to 15, especially 7 to 12, pm.
[0827] Furthermore, it may be possible to ship an antimicrobial combination or an antimicrobial composition to the end-user as a kit, e.g., comprising at least a first component of an antimicrobial peptide (Al) and a chelating agent (A2) (either separately or as a mixture); and a second component comprising at least one polymeric binder (B). Further additives (D) may be a third separate component of the kit, or may be already mixed with components (Al and A2) and/or (B). The end-user may prepare the antimicrobial combination for use by mixing (Al) and (A2) and mixing. Alternatively, the end-user may prepare the antimicrobial composition for use by just adding water (C) to the components of the kit and mixing. The components of the kit may also be compositions in water. Of course it is possible to combine an aqueous composition of one of the components with a dry composition of the other component(s). As an example, the kit can consist of one composition of an antimicrobial peptide (Al) and a chelating agent (A2) and optionally water
(C); and a second, separate composition of at least one polymeric binder (B), water as component (C) and optionally one or more components (D).
[0828] The concentrations of the components (Al and A2), (B), (C) and optionally
(D) will be selected by the skilled artisan depending of the technique to be used for coating/treating. In some embodiments, the amount of an antimicrobial peptide and a chelating agent thereof can be up to 50, preferably 1 to 50, such as 10 to 40, especially 15 to 30, percent by weight, based on weight of the composition. The amount of polymeric binder (B) may be in the range of 0.01 to 30, preferably 0.5 to 15, more preferably 1 to 10, especially 1 to 5, percent by weight, based on weight of the composition. If present, in general the amount of additional components (D) is from 0.1 to 20, preferably 0.5 to 15, percent by weight, based on weight of the composition. If present, suitable amounts of pigments and/or dyestuffs and/or fragrances are in general 0.01 to 5, preferably 0.1 to 3, more preferably 0.2 to 2, percent by weight, based on weight of the composition. In some embodiments, a composition ready for use comprises 0.1 to 40, preferably 1 to 30, percent of components (Al and A2), (B), and optionally (D), the residual amount being water (C). hi some embodiments, a concentration of a concentrate to be diluted by the end-user may comprise 5 to 70, preferably 10 to 60, percent of components (Al and A2), (B), and optionally (D), the residual amount being water (C).
[0829] RANGES AND DESCRIPTIONS OF COMBINATION COMPONENTS [0830] % v/v; % w/w; and % w/v
[0831] As used herein, “v/v” or “% v/v” or “volume per volume” refers to the volume concentration of a solution (“v/v” stands for volume per volume). Here, v/v can be used when both components of a solution are liquids. For example, when 50 mL of ingredient X is diluted with 50 mL of water, there will be 50 mL of ingredient X in a total volume of 100 mL; therefore, this can be expressed as “ingredient X 50% v/v.” Percent volume per volume (% v/v) is calculated as follows: (volume of solute (mL)/ volume of solution (100 mL)); e.g., % v/v = mL of solute/ 100 mL of solution.
[0832] As used herein, “w/w” or “% w/w” or “weight per weight” or “wt/wt” or “% wt/wt” refers to the weight concentration of a composition or solution, i.e., percent weight in weight (“w/w” stands for weight per weight). Here, w/w expresses the number of grams (g) of a constituent in 100 g of solution or mixture. For example, a mixture consisting of 30 g of ingredient X, and 70 g of water would be expressed as “ingredient X 30% w/w.” Percent weight per weight (% w/w) is calculated as follows: (weight of solute (g)/ weight of solution (g)) x 100; or (mass of solute (g)/ mass of solution (g)) x 100.
[0833] As used herein, “w/v” or “% w/v” or “weight per volume” refers to the mass concentration of a solution, i.e., percent weight in volume (“w/v” stands for weight per volume). Here, w/v expresses the number of grams (g) of a constituent in 100 mL of solution. For example, if 1 g of ingredient X is used to make up a total volume of 100 mL, then a “1 % w/v solution of ingredient X” has been made. Percent weight per volume (% w/v) is calculated as follows: (Mass of solute (g)/ Volume of solution (mL)) x 100.
[0834] Concentrations of Antimicrobial Peptide(s) (AMP) and Chelating Agent in Combination
[0835] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and at least one excipient; wherein the antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, the chelating agent is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, and the at least one excipient is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition.
[0836] In related embodiments, the antimicrobial composition shall include (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; (2) a chelating agent; and at least one excipient; wherein the (1) antimicrobial peptide (AMP) is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, (2) the chelating agent is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, and the at least one excipient is in an amount ranging from about 0.000001 % w/w to about 99.99999% w/w of the total composition, and wherein the ratio of (1) the antimicrobial peptide (AMP) to the (2) chelating agent, in the composition, ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1 :5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1 :10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1 :10 to about 500:1, or from about 1:10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1 :10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1 :8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1 :6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1 :10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, or from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1 :5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1 :5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1 :1 to about 5000:1, or from about 1:10 to about 3000:1, or from about 1 : 10 to about 1000:1, or from about 1 :10 to about 500:1, or from about 1:10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1:10 to about 1 :9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1 :10 to about 1:5.75, from about 1 :10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1 :10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1 :4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1 :2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1 :10 to about 1:1, ranges from about 1 : 10 to about 5000: 1 , or ranges from about 1 : 10 to about 2:1, about 1 : 10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11 :1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1:10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1 :10 to about 18:1, about 1:10 to about 19:1, about 1:10 to about 20:1, about 1:10 to about 21:1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1 :10 to about 25:1, about 1:10 to about 26:1, about 1:10 to about 27:1, about 1:10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1 :10 to about 32:1, about 1:10 to about 33:1, about 1:10 to about 34:1, about 1:10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1 :10 to about 39:1, about 1:10 to about 40:1, about 1:10 to about 41 :1, about 1:10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1 :10 to about 46:1, about 1:10 to about 47:1, about 1:10 to about 48:1, about 1:10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51:1, about 1:10 to about 52:1, about 1 :10 to about 53:1, about 1:10 to about 54:1, about 1:10 to about 55:1, about 1:10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1 :10 to about 60:1, about 1:10 to about 61:1, about 1:10 to about 62:1, about 1:10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1 :10 to about 67:1, about 1:10 to about 68:1, about 1:10 to about 69:1, about 1:10 to about 70:1, about 1:10 to about 71:l, about 1:10 to about 72:1, about 1:10 to about 73:1, about 1 :10 to about 74:1, about 1:10 to about 75:1, about 1:10 to about 76:1, about 1:10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1 :10 to about 81 :1, about 1:10 to about 82:1, about 1:10 to about 83:1, about 1:10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1 :10 to about 88:1, about 1:10 to about 89:1, about 1:10 to about 90:1, about 1:10 to about 91:1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1 :10 to about 95:1, about 1:10 to about 96:1, about 1:10 to about 97:1, about 1:10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1 :10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111:1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131 :1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141:1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181:1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201 :1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211:1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251:1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271 :1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281:1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321:1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1 :10 to about 330:1, and all integers and values therebetween.
[0837] In some embodiments, an antimicrobial combination comprises: (1) an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof; and (2) a chelating agent, for example, EDTA, and at least one excipient, wherein the ratio of (1 ):(2) from about 1 : 10 to about 5000: 1 , or from 1 : 10 to about 5000: 1 , about 1 :5 to about 5000: 1 , about 3 : 10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1 :10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1:10 to about 500:1, or from about 1:10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1 :8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1 :10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1 :5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1 :3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, ranges from about 1:10 to about 5000:1, or ranges from about 1:10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1 :10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1 :10 to about 13:1, about 1:10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1:10 to about 19:1, about 1 :10 to about 20:1, about 1:10 to about 21:1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1:10 to about 25:1, about 1:10 to about 26:1, about 1 :10 to about 27:1, about 1:10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1:10 to about 32:1, about 1:10 to about 33:1, about 1 :10 to about 34:1, about 1:10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1:10 to about 39:1, about 1:10 to about 40:1, about 1 :10 to about 41 :1, about 1:10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1:10 to about 46:1, about 1:10 to about 47:1, about 1 :10 to about 48:1, about 1:10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51:1, about 1:10 to about 52:1, about 1:10 to about 53:1, about 1:10 to about 54:1, about 1 :10 to about 55:1, about 1:10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1:10 to about 60:1, about 1:10 to about 61:1, about 1 :10 to about 62:1, about 1:10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1:10 to about 67:1, about 1:10 to about 68:1, about 1 :10 to about 69:1, about 1:10 to about 70:1, about 1:10 to about 71 :l, about 1:10 to about 72:l, about 1:10 to about 73:1, about 1:10 to about 74:1, about 1:10 to about 75:1, about 1 :10 to about 76:1, about 1:10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1:10 to about 81:1, about 1:10 to about 82:1, about 1 :10 to about 83:1, about 1:10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1:10 to about 88:1, about 1:10 to about 89:1, about 1 :10 to about 90:1, about 1:10 to about 91:1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1:10 to about 95:1, about 1:10 to about 96:1, about 1 :10 to about 97:1, about 1:10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111:1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141:1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161 :1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181:1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211:1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231 :1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251:1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281:1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301 :1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321:1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328: 1 , about 1 : 10 to about 329 : 1 , or about 1 : 10 to about 330: 1 , and all integers and values therebetween.
[0838] In some embodiments, an antimicrobial composition comprises (1) an antimicrobial peptide or an agriculturally acceptable salt thereof, (2) a chelating agent, and at least one excipient, wherein the (1) antimicrobial peptide, comprises, or consists of an amino acid sequence of any one of SEQ ID NOs: 1-19634, and wherein (1) the antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about
96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about
93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about
90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47 % to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42% ; from about 59 % to about 41%; from about 60% to about 40% ; from about 61 % to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71 % to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77 % to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition, and wherein the ratio of (1 ):(2) ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1 :5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1 :5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1 : 10 to about 500 : 1 , or from about 1 : 10 to about 400 : 1 , or from about 1 : 10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1 :10 to about 1:9.5, from about 1 :10 to about 1:9.25, from about 1:10 to about 1:9, from about 1 :10 to about 1:8.75, from about 1 :10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1 :7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1 :5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, or from about 1:10 to about 5000:1, or ranges from about 1:10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1 :10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1 :10 to about 14:1, about 1 :10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1:10 to about 19:1, about 1:10 to about 20:1, about 1 :10 to about 21 :1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1:10 to about 25:1, about 1:10 to about 26:1, about 1:10 to about 27:1, about 1 :10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1:10 to about 32:1, about 1:10 to about 33:1, about 1:10 to about 34:1, about 1 :10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1:10 to about 39:1, about 1:10 to about 40:1, about 1:10 to about 41:1, about 1 :10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1:10 to about 46:1, about 1:10 to about 47:1, about 1:10 to about 48:1, about 1 :10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51 :1, about 1:10 to about 52:1, about 1:10 to about 53:1, about 1:10 to about 54:1, about 1:10 to about 55:1, about 1 :10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1:10 to about 60:1, about 1:10 to about 61:1, about 1:10 to about 62:1, about 1 :10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1:10 to about 67:1, about 1:10 to about 68:1, about 1:10 to about 69:1, about 1 :10 to about 70:1, about 1:10 to about 71:1, about 1:10 to about 72:1, about 1:10 to about 73:1, about 1:10 to about 74:1, about 1:10 to about 75:1, about 1:10 to about 76:1, about 1 :10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1:10 to about 81:1, about 1:10 to about 82:1, about 1:10 to about 83:1, about 1 :10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1:10 to about 88:1, about 1:10 to about 89:1, about 1:10 to about 90:1, about 1 :10 to about 91 :1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1:10 to about 95:1, about 1:10 to about 96:1, about 1:10 to about 97:1, about 1 :10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111:1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141 :1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181:1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211 :1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251:1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281 :1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321:1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1:10 to about 330:1, and all integers and values therebetween.
[0839] Wild-type antimicrobial peptide composition formulations
[0840] In some embodiments, an antimicrobial composition of the present disclosure comprises: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof;
(2) a chelating agent; and at least one excipient; wherein the (1) wild- type antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 9%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about6%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about3%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about0%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about7%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about4%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about1%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about8%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about5%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about2%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about9%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about6%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about3%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about0%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about7%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about4%; from about 47 % to about 53%; from about 48% to about 52%; from about 49% to about1%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about8%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about5%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about2% ; from about 59 % to about 41%; from about 60% to about 40% ; from about 61 % to about9%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about6%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about3%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about0%; from about 71 % to about 29%; from about 72% to about 28%; from about 73% to about7%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about4%; from about 77 % to about 23%; from about 78% to about 22%; from about 79% to about1%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about8%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about5%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about2%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition, and wherein the ratio of (1 ):(2) ranges from about 1:10 to about 5000:1, or from 1:10 to about 5000:1, about 1 :5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1 :5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1 : 10 to about 500 : 1 , or from about 1 : 10 to about 400 : 1 , or from about 1 : 10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1 :10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1 :10 to about 1:8.75, from about 1 :10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1 :7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1 :5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, or from about 1:10 to about 5000:1, or ranges from about 1:10 to about 2:1, about 1:10 to about 3:1, about 1:10 to about 4:1, about 1 :10 to about 5:1, about 1:10 to about 6:1, about 1:10 to about 7:1, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1 :10 to about 14:1, about 1 :10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1:10 to about 19:1, about 1:10 to about 20:1, about 1 :10 to about 21 :1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1:10 to about 25:1, about 1:10 to about 26:1, about 1:10 to about 27:1, about 1 :10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1:10 to about 32:1, about 1:10 to about 33:1, about 1:10 to about 34:1, about 1 :10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1:10 to about 39:1, about 1:10 to about 40:1, about 1:10 to about 41:1, about 1 :10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1:10 to about 46:1, about 1:10 to about 47:1, about 1:10 to about 48:1, about 1 :10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51 :1, about 1:10 to about 52:1, about 1:10 to about 53:1, about 1:10 to about 54:1, about 1:10 to about 55:1, about 1 :10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1:10 to about 60:1, about 1:10 to about 61:1, about 1:10 to about 62:1, about 1 :10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1:10 to about 67:1, about 1:10 to about 68:1, about 1:10 to about 69:1, about 1 :10 to about 70:1, about 1:10 to about 71:1, about 1:10 to about 72:1, about 1:10 to about 73:1, about 1:10 to about 74:1, about 1:10 to about 75:1, about 1:10 to about 76:1, about 1 :10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1:10 to about 81:1, about 1:10 to about 82:1, about 1:10 to about 83:1, about 1 :10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1:10 to about 88:1, about 1:10 to about 89:1, about 1:10 to about 90:1, about 1 :10 to about 91 :1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1:10 to about 95:1, about 1:10 to about 96:1, about 1:10 to about 97:1, about 1 :10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111:1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141 :1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181:1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211 :1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251:1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281 :1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321:1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1:10 to about 330:1, and all integers and values therebetween..
[0841] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47 % to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42% ; from about 59 % to about 41%; from about 60% to about 40% ; from about 61 % to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71 % to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77 % to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0842] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide or agriculturally acceptable salt thereof in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0843] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87 %; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81 %; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77 %; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71 %; from about 30% to about 70%; from about 31 % to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61%; from about 40% to about 60%; from about 41% to about 59%; from about 42% to about 58%; from about 43% to about 57 %; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47% to about 53%; from about 48% to about 52%; from about 49% to about 51 %; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47 %; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42%; from about 59% to about 41 %; from about 60% to about 40%; from about 61% to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71% to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77% to about 23%; from about 78% to about 22%; from about 79% to about 21 %; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0844] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61%; from about 40% to about 60%; from about 41% to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47% to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42%; from about 59% to about 41%; from about 60% to about 40%; from about 61% to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71% to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77% to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0845] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the chelating agent is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0846] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21 % to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31 % to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61%; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47% to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51 % to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42%; from about 59% to about 41%; from about 60% to about 40%; from about 61% to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71% to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77% to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0847] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount ranging from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61%; from about 40% to about 60%; from about 41% to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47% to about 53%; from about 48% to about 52%; from about 49% to about 51 %; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42%; from about 59% to about 41%; from about 60% to about 40%; from about 61% to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71% to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77% to about 23%; from about 78% to about 22%; from about 79% to about 21 %; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0848] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the excipient is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0849] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10000 to 10000:0.0001.
[0850] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
[0851] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
[0852] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1): (2) is a ratio ranging from 1:1 to 10,000:1; or 1:1 to 1000:1; or 1:1 to 100:1; or 1:1 to 90:1; or 1:1 to 80:1 ; or 1:1 to 70:1 ; or 1:1 to 60:1; or 1:1 to 50:1 ; or 1:1 to 40:1; or 1:1 to 30:1; or 1:1 to 20:1; or 1 :1 to 10:1; or 1:1 to 9:1; or 1 :1 to 8:1; or 1:1 to 7:1; or 1:1 to 6:1; or 1 :1 to 5:1; or 1:1 to 4:1; or 1:1 to 3:1; or 1:1 to 2:1; or 2:1 to 1:1; or 3:1 to 1:1; or 4:1 to 1:1; or 5:1 to 1:1; or 6:1 to 1:1; or 7:1 to 1 :1; or 8:1 to 1:1; or 9:1 to 1:1; or 10:1 to 1:1; or 20:1 to 1:1; or 30:1 to 1:1 ; or 40:1 to 1:1; or 50:1 to 1:1; or 60:1 to 1:1; or 70:1 to 1 :1 or 80:1 to 1:1; or 90:1 to 1:1; or 100:1 to 1:1; or 1000:1 to 1:1 or 10,000:1 to 1:1.
[0853] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 10,000:0.0001, or 0.0001:10,000 to 1000:0.0001, or 0.0001:10,000 to 100:0.0001, or 0.0001 :10,000 to 100:0.0001; or 0.0001:10,000 to 95:0.0001; or 0.0001:10,000 to 90:0.0001; or 0.0001:10,000 to 85:0.0001; or 0.0001:10,000 to 80:0.0001; or 0.0001:10,000 to 75:0.0001; or 0.0001:10,000 to 70:0.0001; or 0.0001 :10,000 to 65:0.0001; or 0.0001:10,000 to 60:0.0001; or 0.0001 :10,000 to 55:0.0001 ; or 0.0001:10,000 to 50:0.0001; or 0.0001 :10,000 to 45:0.0001 ; or 0.0001 :10,000 to 40:0.0001; or 0.0001:10,000 to 35:0.0001; or 0.0001:10,000 to 30:0.0001; or 0.0001:10,000 to 25:0.0001; or 0.0001:10,000 to 20:0.0001; or 0.0001:10,000 to 15:0.0001; or 0.0001 :10,000 to 10:0.0001.
[0854] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 10:20, 10:25, 10:30, 10:35, 10:40, 10:45, 10:50, 10:55, 10:60, 10:65, 10:70, 10:75, 10:80, 10:85, 10:90, 10:95, 10:100, 20:25, 20:30, 20:35, 20:40, 20:45, 20:50, 20:55, 20:60, 20:65, 20:70, 20:75, 20:80, 20:85, 20:90, 20:95, 20:100, 30:35, 30:40, 30:45, 30:50, 30:55, 30:60, 30:65, 30:70, 30:75, 30:80, 30:85, 30:90, 30:95, 30:100, 40:45, 40:50, 40:55, 40:60, 40:65, 40:70, 40:75, 40:80, 40:85, 40:90, 40:95, 40:100, 50:55, 50:60, 50:65, 50:70, 50:75, 50:80, 50:85, 50:90, 50:95, 50:100, 60:65, 60:70, 60:75, 60:80, 60:85, 60:90, 60:95, 60:100, 70:75, 70:80, 70:85, 70:90, 70:95, 70:100, 80:85, 80:90, 80:95, 80:100, 90:95, 90:100, or 95:100.
[0855] In some embodiments, a combination of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 100:95, 100:90, 95:90, 100:80, 95:80, 90:80, 85:80, 100:70, 95:70, 90:70, 85:70, 80:70, 75:70, 100:60, 95:60, 90:60, 85:60, 80:60, 75:60, 70:60, 65:60, 100:50, 95:50, 90:50, 85:50, 80:50, 75:50, 70:50, 65:50, 60:50, 55:50, 100:40, 95:40, 90:40, 85:40, 80:40, 75:40, 70:40, 65:40, 60:40, 55:40, 50:40, 45:40, 100:30, 95:30, 90:30, 85:30, 80:30, 75:30, 70:30, 65:30, 60:30, 55:30, 50:30, 45:30, 40:30, 35:30, 100:20, 95:20, 90:20, 85:20, 80:20, 75:20, 70:20, 65:20, 60:20, 55:20, 50:20, 45:20, 40:20, 35:20, 30:20, 25:20, 100:10, 95:10, 90:10, 85:10, 80:10, 75:10, 70:10, 65:10, 60:10, 55:10, 50:10, 45:10, 40:10, 35:10, 30:10, 25:10, 20:10, or 15:10.
[0856] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10000 to 10000:0.0001.
[0857] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001:10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1. [0858] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 1:1; or 0.001: 10,000 to 1:1; or 0.01:10,000 to 1:1; or 0.1:10,000 to 1:1; or 1:10,000 to 1:1; or 0.0001 :1000 to 1 : 1 ; or 0.0001 : 100 to 1 : 1 ; or 0.0001 : 10 to 1 : 1 ; or 0.0001 : 1 to 1 : 1.
[0859] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1): (2) is a ratio ranging from 1:1 to 10,000:1; or 1:1 to 1000:1; or 1:1 to 100:1; or 1:1 to 90:1; or 1:1 to 80:1 ; or 1:1 to 70:1 ; or 1:1 to 60:1; or 1:1 to 50:1 ; or 1:1 to 40:1; or 1:1 to 30:1; or 1:1 to 20:1; or 1 :1 to 10:1; or 1:1 to 9:1; or 1 :1 to 8:1; or 1:1 to 7:1; or 1:1 to 6:1; or 1 :1 to 5:1; or 1:1 to 4:1; or 1:1 to 3:1; or 1:1 to 2:1; or 2:1 to 1:1; or 3:1 to 1:1; or 4:1 to 1:1; or 5:1 to 1:1; or 6:1 to 1:1; or 7:1 to 1 :1; or 8:1 to 1:1; or 9:1 to 1:1; or 10:1 to 1:1; or 20:1 to 1:1; or 30:1 to 1:1 ; or 40:1 to 1:1; or 50:1 to 1:1; or 60:1 to 1:1; or 70:1 to 1 :1 or 80:1 to 1:1; or 90:1 to 1:1; or 100:1 to 1:1; or 1000:1 to 1:1 or 10,000:1 to 1:1.
[0860] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio ranging from 0.0001:10,000 to 10,000:0.0001, or 0.0001:10,000 to 1000:0.0001, or 0.0001:10,000 to 100:0.0001, or 0.0001 :10,000 to 100:0.0001; or 0.0001:10,000 to 95:0.0001; or 0.0001:10,000 to 90:0.0001; or 0.0001:10,000 to 85:0.0001; or 0.0001:10,000 to 80:0.0001; or 0.0001:10,000 to 75:0.0001; or 0.0001:10,000 to 70:0.0001; or 0.0001 :10,000 to 65:0.0001; or 0.0001:10,000 to 60:0.0001; or 0.0001 :10,000 to 55:0.0001 ; or 0.0001:10,000 to 50:0.0001; or 0.0001 :10,000 to 45:0.0001 ; or 0.0001 :10,000 to 40:0.0001; or 0.0001:10,000 to 35:0.0001; or 0.0001:10,000 to 30:0.0001; or 0.0001:10,000 to 25:0.0001; or 0.0001:10,000 to 20:0.0001; or 0.0001:10,000 to 15:0.0001; or 0.0001 :10,000 to 10:0.0001.
[0861] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 10:20, 10:25, 10:30, 10:35, 10:40, 10:45, 10:50, 10:55, 10:60, 10:65, 10:70, 10:75, 10:80, 10:85, 10:90, 10:95, 10:100, 20:25, 20:30, 20:35, 20:40, 20:45, 20:50, 20:55, 20:60, 20:65, 20:70, 20:75, 20:80, 20:85, 20:90, 20:95, 20:100, 30:35, 30:40, 30:45, 30:50, 30:55, 30:60, 30:65, 30:70, 30:75, 30:80, 30:85, 30:90, 30:95, 30:100, 40:45, 40:50, 40:55, 40:60, 40:65, 40:70, 40:75, 40:80, 40:85, 40:90, 40:95, 40:100, 50:55, 50:60, 50:65, 50:70, 50:75, 50:80, 50:85, 50:90, 50:95, 50:100, 60:65, 60:70, 60:75, 60:80, 60:85, 60:90, 60:95, 60:100, 70:75, 70:80, 70:85, 70:90, 70:95, 70:100, 80:85, 80:90, 80:95, 80:100, 90:95, 90:100, or 95:100.
[0862] In some embodiments, a composition of the present disclosure can comprise: (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) is a ratio of about 100:95, 100:90, 95:90, 100:80, 95:80, 90:80, 85:80, 100:70, 95:70, 90:70, 85:70, 80:70, 75:70, 100:60, 95:60, 90:60, 85:60, 80:60, 75:60, 70:60, 65:60, 100:50, 95:50, 90:50, 85:50, 80:50, 75:50, 70:50, 65:50, 60:50, 55:50, 100:40, 95:40, 90:40, 85:40, 80:40, 75:40, 70:40, 65:40, 60:40, 55:40, 50:40, 45:40, 100:30, 95:30, 90:30, 85:30, 80:30, 75:30, 70:30, 65:30, 60:30, 55:30, 50:30, 45:30, 40:30, 35:30, 100:20, 95:20, 90:20, 85:20, 80:20, 75:20, 70:20, 65:20, 60:20, 55:20, 50:20, 45:20, 40:20, 35:20, 30:20, 25:20, 100:10, 95:10, 90:10, 85:10, 80:10, 75:10, 70:10, 65:10, 60:10, 55:10, 50:10, 45:10, 40:10, 35:10, 30:10, 25:10, 20:10, or 15:10.
[0863] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is present in the composition in an amount ranging from about 0.000001% w/w to about 0.01% w/w of the total weight of the composition, or from about 0.000010% w/w to about 0.00500% w/w, of the total weight of the composition.
[0864] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, of the total weight of the composition.
[0865] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000017% w/w of the total weight of the composition.
[0866] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00004% w/w of the total weight of the composition.
[0867] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000024% w/w of the total weight of the composition.
[0868] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.000056% w/w of the total weight of the composition.
[0869] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00077% w/w of the total weight of the composition.
[0870] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is in an amount that is about 0.00399% w/w of the total weight of the composition.
[0871] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000070% w/w to about 0.000400% w/w, of the total weight of the composition. [0872] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition. [0873] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000088% w/w of the total weight of the composition.
[0874] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000146% w/w of the total weight of the composition.
[0875] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000205% w/w of the total weight of the composition. [0876] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000292% w/w of the total weight of the composition.
[0877] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the concentration of the wild-type antimicrobial peptide ranges from about 0.000001% to about 99.9% w/w of the total composition, for example, in some embodiments the concentration is about 0.00001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% by weight of the total combination or composition.
[0878] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide consisting of an amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628, or an agriculturally acceptable salt thereof;
EDTA; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition. [0879] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is present in the composition in an amount ranging from about 0.000001% w/w to about 0.01% w/w of the total weight of the composition, or from about 0.000010% w/w to about 0.00500% w/w, of the total weight of the composition.
[0880] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, of the total weight of the composition.
[0881] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.000017% w/w of the total weight of the composition.
[0882] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.00004% w/w of the total weight of the composition.
[0883] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.000024% w/w of the total weight of the composition.
[0884] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.000056% w/w of the total weight of the composition.
[0885] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.00077% w/w of the total weight of the composition.
[0886] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type NCR13 peptide is in an amount that is about 0.00399% w/w of the total weight of the composition.
[0887] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000070% w/w to about 0.000400% w/w, of the total weight of the composition. [0888] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition. [0889] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000088% w/w of the total weight of the composition.
[0890] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000146% w/w of the total weight of the composition.
[0891] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000205% w/w of the total weight of the composition.
[0892] In some embodiments, an antimicrobial composition of the present disclosure can comprise: a wild- type NCR 13 peptide, or an agriculturally acceptable salt thereof; a chelating agent that is EDTA; and an excipient; wherein the EDTA is in an amount that is about 0.000292% w/w of the total weight of the composition.
[0893] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type NCR13 peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the concentration of the wild-type NCR13 peptide ranges from about 0.000001% to about 99.9% w/w of the total composition, for example, in some embodiments the concentration is about 0.00001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% by weight of the total combination or composition.
[0894] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type NCR13 peptide consisting of an amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
[0895] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type nodule- specific cysteine-rich 13 peptide (NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
[0896] Mutant and other AMP composition formulations
[0897] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.00001% to about 0.00999%; from about 0.00002% to about 0.00998%; from about 0.00003% to about 0.00997%; from about 0.00004% to about 0.00996%; from about 0.00005% to about 0.00995%; from about 0.00006% to about 0.00994%; from about 0.00007% to about 0.00993%; from about 0.00008% to about 0.00992%; from about 0.00009% to about 0.00991%; from about 0.0001% to about 0.0099%; from about 0.00011% to about 0.00989%; from about 0.00012% to about 0.00988%; from about 0.00013% to about 0.00987%; from about 0.00014% to about 0.00986%; from about 0.00015% to about 0.00985%; from about 0.00016% to about 0.00984%; from about 0.00017% to about 0.00983%; from about 0.00018% to about 0.00982%; from about 0.00019% to about 0.00981%; from about 0.0002% to about 0.0098%; from about 0.00021% to about 0.00979%; from about 0.00022% to about 0.00978%; from about 0.00023% to about 0.00977%; from about 0.00024% to about 0.00976%; from about 0.00025% to about 0.00975%; from about 0.00026% to about 0.00974%; from about 0.00027% to about 0.00973%; from about 0.00028% to about 0.00972%; from about 0.00029% to about
0.00971%; from about 0.0003% to about 0.0097%; from about 0.00031% to about 0.00969%; from about 0.00032% to about 0.00968%; from about 0.00033% to about 0.00967%; from about 0.00034% to about 0.00966%; from about 0.00035% to about 0.00965%; from about 0.00036% to about 0.00964%; from about 0.00037% to about 0.00963%; from about 0.00038% to about 0.00962%; from about 0.00039% to about 0.00961%; from about 0.0004% to about 0.0096%; from about 0.00041% to about 0.00959%; from about 0.00042% to about 0.00958%; from about 0.00043% to about 0.00957%; from about 0.00044% to about 0.00956%; from about 0.00045% to about 0.00955%; from about 0.00046% to about 0.00954%; from about 0.00047% to about 0.00953%; from about 0.00048% to about
0.00952%; from about 0.00049% to about 0.00951%; from about 0.0005% to about 0.0095%; from about 0.00051% to about 0.00949%; from about 0.00052% to about 0.00948%; from about 0.00053% to about 0.00947%; from about 0.00054% to about 0.00946%; from about 0.00055% to about 0.00945%; from about 0.00056% to about 0.00944%; from about 0.00057% to about 0.00943%; from about 0.00058% to about 0.00942%; from about 0.00059% to about 0.00941%; from about 0.0006% to about 0.0094%; from about 0.00061% to about 0.00939%; from about 0.00062% to about 0.00938%; from about 0.00063% to about 0.00937%; from about 0.00064% to about 0.00936%; from about 0.00065% to about 0.00935%; from about 0.00066% to about 0.00934%; from about 0.00067% to about 0.00933%; from about 0.00068% to about 0.00932%; from about 0.00069% to about
0.00931%; from about 0.0007% to about 0.0093%; from about 0.00071% to about 0.00929%; from about 0.00072% to about 0.00928%; from about 0.00073% to about 0.00927%; from about 0.00074% to about 0.00926%; from about 0.00075% to about 0.00925%; from about 0.00076% to about 0.00924%; from about 0.00077% to about 0.00923%; from about 0.00078% to about 0.00922%; from about 0.00079% to about 0.00921%; from about 0.0008% to about 0.0092%; from about 0.00081% to about 0.00919%; from about 0.00082% to about 0.00918%; from about 0.00083% to about 0.00917%; from about 0.00084% to about 0.00916%; from about 0.00085% to about 0.00915%; from about 0.00086% to about 0.00914%; from about 0.00087% to about 0.00913%; from about 0.00088% to about 0.00912%; from about 0.00089% to about 0.00911%; from about 0.0009% to about 0.0091%; from about 0.00091% to about 0.00909%; from about 0.00092% to about 0.00908%; from about 0.00093% to about 0.00907%; from about 0.00094% to about 0.00906%; from about 0.00095% to about 0.00905%; from about 0.00096% to about 0.00904%; from about 0.00097% to about 0.00903%; from about 0.00098% to about 0.00902%; from about
0.00099% to about 0.00901%; from about 0.001% to about 0.009%; from about 0.00101% to about 0.00899%; from about 0.00102% to about 0.00898%; from about 0.00103% to about 0.00897%; from about 0.00104% to about 0.00896%; from about 0.00105% to about 0.00895%; from about 0.00106% to about 0.00894%; from about 0.00107% to about 0.00893%; from about 0.00108% to about 0.00892%; from about 0.00109% to about 0.00891%; from about 0.0011% to about 0.0089%; from about 0.00111% to about 0.00889%; from about 0.00112% to about 0.00888%; from about 0.00113% to about 0.00887%; from about 0.00114% to about 0.00886%; from about 0.00115% to about 0.00885%; from about 0.00116% to about 0.00884%; from about 0.00117% to about 0.00883%; from about 0.00118% to about 0.00882%; from about 0.00119% to about 0.00881%; from about 0.0012% to about 0.0088%; from about 0.00121% to about 0.00879%; from about 0.00122% to about 0.00878%; from about 0.00123% to about 0.00877%; from about 0.00124% to about 0.00876%; from about 0.00125% to about 0.00875%; from about 0.00126% to about 0.00874%; from about 0.00127% to about 0.00873%; from about 0.00128% to about 0.00872%; from about 0.00129% to about 0.00871%; from about 0.0013% to about 0.0087%; from about 0.00131% to about 0.00869%; from about 0.00132% to about 0.00868%; from about 0.00133% to about 0.00867%; from about 0.00134% to about 0.00866%; from about 0.00135% to about 0.00865%; from about 0.00136% to about 0.00864%; from about 0.00137% to about 0.00863%; from about 0.00138% to about 0.00862%; from about 0.00139% to about 0.00861%; from about 0.0014% to about 0.0086%; from about 0.00141% to about 0.00859%; from about 0.00142% to about 0.00858%; from about 0.00143% to about 0.00857%; from about 0.00144% to about 0.00856%; from about 0.00145% to about 0.00855%; from about 0.00146% to about 0.00854%; from about 0.00147% to about 0.00853%; from about 0.00148% to about 0.00852%; from about 0.00149% to about
0.00851%; from about 0.0015% to about 0.0085%; from about 0.00151% to about 0.00849%; from about 0.00152% to about 0.00848%; from about 0.00153% to about 0.00847%; from about 0.00154% to about 0.00846%; from about 0.00155% to about 0.00845%; from about 0.00156% to about 0.00844%; from about 0.00157% to about 0.00843%; from about 0.00158% to about 0.00842%; from about 0.00159% to about 0.00841%; from about 0.0016% to about 0.0084%; from about 0.00161% to about 0.00839%; from about 0.00162% to about 0.00838%; from about 0.00163% to about 0.00837%; from about 0.00164% to about 0.00836%; from about 0.00165% to about 0.00835%; from about 0.00166% to about 0.00834%; from about 0.00167% to about 0.00833%; from about 0.00168% to about 0.00832%; from about 0.00169% to about 0.00831%; from about 0.0017% to about 0.0083%; from about 0.00171% to about 0.00829%; from about 0.00172% to about 0.00828%; from about 0.00173% to about 0.00827%; from about 0.00174% to about 0.00826%; from about 0.00175% to about 0.00825%; from about 0.00176% to about 0.00824%; from about 0.00177% to about 0.00823%; from about 0.00178% to about 0.00822%; from about 0.00179% to about 0.00821%; from about 0.0018% to about 0.0082%; from about 0.00181% to about 0.00819%; from about 0.00182% to about 0.00818%; from about 0.00183% to about 0.00817%; from about 0.00184% to about 0.00816%; from about 0.00185% to about 0.00815%; from about 0.00186% to about 0.00814%; from about 0.00187% to about 0.00813%; from about 0.00188% to about 0.00812%; from about 0.00189% to about 0.00811%; from about 0.0019% to about 0.0081%; from about 0.00191% to about 0.00809%; from about 0.00192% to about 0.00808%; from about 0.00193% to about 0.00807%; from about 0.00194% to about 0.00806%; from about 0.00195% to about 0.00805%; from about 0.00196% to about 0.00804%; from about 0.00197% to about 0.00803%; from about 0.00198% to about 0.00802%; from about 0.00199% to about 0.00801%; from about 0.002% to about 0.008%; from about 0.00201% to about 0.00799%; from about 0.00202% to about 0.00798%; from about 0.00203% to about 0.00797%; from about 0.00204% to about 0.00796%; from about 0.00205% to about 0.00795%; from about 0.00206% to about 0.00794%; from about 0.00207% to about 0.00793%; from about 0.00208% to about 0.00792%; from about 0.00209% to about 0.00791%; from about 0.0021% to about 0.0079%; from about 0.00211% to about 0.00789%; from about 0.00212% to about 0.00788%; from about 0.00213% to about 0.00787%; from about 0.00214% to about 0.00786%; from about 0.00215% to about 0.00785%; from about 0.00216% to about 0.00784%; from about 0.00217% to about 0.00783%; from about 0.00218% to about 0.00782%; from about 0.00219% to about 0.00781%; from about 0.0022% to about 0.0078%; from about 0.00221% to about 0.00779%; from about 0.00222% to about 0.00778%; from about 0.00223% to about 0.00777%; from about 0.00224% to about 0.00776%; from about 0.00225% to about 0.00775%; from about 0.00226% to about 0.00774%; from about 0.00227% to about 0.00773%; from about 0.00228% to about 0.00772%; from about 0.00229% to about 0.00771%; from about 0.0023% to about 0.0077%; from about 0.00231% to about 0.00769%; from about 0.00232% to about 0.00768%; from about 0.00233% to about 0.00767%; from about 0.00234% to about 0.00766%; from about 0.00235% to about 0.00765%; from about 0.00236% to about 0.00764%; from about 0.00237% to about 0.00763%; from about 0.00238% to about 0.00762%; from about 0.00239% to about 0.00761%; from about 0.0024% to about 0.0076%; from about 0.00241% to about 0.00759%; from about 0.00242% to about 0.00758%; from about 0.00243% to about 0.00757%; from about 0.00244% to about 0.00756%; from about 0.00245% to about 0.00755%; from about 0.00246% to about 0.00754%; from about 0.00247% to about 0.00753%; from about 0.00248% to about 0.00752%; from about 0.00249% to about 0.00751%; from about 0.0025% to about 0.0075%; from about 0.00251% to about 0.00749%; from about 0.00252% to about 0.00748%; from about 0.00253% to about 0.00747%; from about 0.00254% to about 0.00746%; from about 0.00255% to about 0.00745%; from about 0.00256% to about 0.00744%; from about 0.00257% to about 0.00743%; from about 0.00258% to about 0.00742%; from about 0.00259% to about 0.00741%; from about 0.0026% to about 0.0074%; from about 0.00261% to about 0.00739%; from about 0.00262% to about 0.00738%; from about 0.00263% to about 0.00737%; from about 0.00264% to about 0.00736%; from about 0.00265% to about 0.00735%; from about 0.00266% to about 0.00734%; from about 0.00267% to about 0.00733%; from about 0.00268% to about 0.00732%; from about 0.00269% to about
0.00731%; from about 0.0027% to about 0.0073%; from about 0.00271% to about 0.00729%; from about 0.00272% to about 0.00728%; from about 0.00273% to about 0.00727%; from about 0.00274% to about 0.00726%; from about 0.00275% to about 0.00725%; from about 0.00276% to about 0.00724%; from about 0.00277% to about 0.00723%; from about 0.00278% to about 0.00722%; from about 0.00279% to about 0.00721%; from about 0.0028% to about 0.0072%; from about 0.00281% to about 0.00719%; from about 0.00282% to about 0.00718%; from about 0.00283% to about 0.00717%; from about 0.00284% to about 0.00716%; from about 0.00285% to about 0.00715%; from about 0.00286% to about 0.00714%; from about 0.00287% to about 0.00713%; from about 0.00288% to about
0.00712%; from about 0.00289% to about 0.00711%; from about 0.0029% to about 0.0071%; from about 0.00291% to about 0.00709%; from about 0.00292% to about 0.00708%; from about 0.00293% to about 0.00707%; from about 0.00294% to about 0.00706%; from about 0.00295% to about 0.00705%; from about 0.00296% to about 0.00704%; from about 0.00297% to about 0.00703%; from about 0.00298% to about 0.00702%; from about 0.00299% to about 0.00701%; from about 0.003% to about 0.007%; from about 0.00301% to about 0.00699%; from about 0.00302% to about 0.00698%; from about 0.00303% to about 0.00697%; from about 0.00304% to about 0.00696%; from about 0.00305% to about 0.00695%; from about 0.00306% to about 0.00694%; from about 0.00307% to about 0.00693%; from about 0.00308% to about 0.00692%; from about 0.00309% to about
0.00691%; from about 0.0031% to about 0.0069%; from about 0.00311% to about 0.00689%; from about 0.00312% to about 0.00688%; from about 0.00313% to about 0.00687%; from about 0.00314% to about 0.00686%; from about 0.00315% to about 0.00685%; from about 0.00316% to about 0.00684%; from about 0.00317% to about 0.00683%; from about 0.00318% to about 0.00682%; from about 0.00319% to about 0.00681%; from about 0.0032% to about 0.0068%; from about 0.00321% to about 0.00679%; from about 0.00322% to about 0.00678%; from about 0.00323% to about 0.00677%; from about 0.00324% to about 0.00676%; from about 0.00325% to about 0.00675%; from about 0.00326% to about 0.00674%; from about 0.00327% to about 0.00673%; from about 0.00328% to about 0.00672%; from about 0.00329% to about 0.00671%; from about 0.0033% to about 0.0067%; from about 0.00331% to about 0.00669%; from about 0.00332% to about 0.00668%; from about 0.00333% to about 0.00667%; from about 0.00334% to about 0.00666%; from about 0.00335% to about 0.00665%; from about 0.00336% to about 0.00664%; from about 0.00337% to about 0.00663%; from about 0.00338% to about 0.00662%; from about 0.00339% to about 0.00661%; from about 0.0034% to about 0.0066%; from about 0.00341% to about 0.00659%; from about 0.00342% to about 0.00658%; from about 0.00343% to about 0.00657%; from about 0.00344% to about 0.00656%; from about 0.00345% to about 0.00655%; from about 0.00346% to about 0.00654%; from about 0.00347% to about 0.00653%; from about 0.00348% to about 0.00652%; from about 0.00349% to about
0.00651%; from about 0.0035% to about 0.0065%; from about 0.00351% to about 0.00649%; from about 0.00352% to about 0.00648%; from about 0.00353% to about 0.00647%; from about 0.00354% to about 0.00646%; from about 0.00355% to about 0.00645%; from about 0.00356% to about 0.00644%; from about 0.00357% to about 0.00643%; from about 0.00358% to about 0.00642%; from about 0.00359% to about 0.00641%; from about 0.0036% to about 0.0064%; from about 0.00361% to about 0.00639%; from about 0.00362% to about 0.00638%; from about 0.00363% to about 0.00637%; from about 0.00364% to about 0.00636%; from about 0.00365% to about 0.00635%; from about 0.00366% to about 0.00634%; from about 0.00367% to about 0.00633%; from about 0.00368% to about 0.00632%; from about 0.00369% to about 0.00631%; from about 0.0037% to about 0.0063%; from about 0.00371% to about 0.00629%; from about 0.00372% to about 0.00628%; from about 0.00373% to about 0.00627%; from about 0.00374% to about 0.00626%; from about 0.00375% to about 0.00625%; from about 0.00376% to about 0.00624%; from about 0.00377% to about 0.00623%; from about 0.00378% to about 0.00622%; from about 0.00379% to about 0.00621%; from about 0.0038% to about 0.0062%; from about 0.00381% to about 0.00619%; from about 0.00382% to about 0.00618%; from about 0.00383% to about 0.00617%; from about 0.00384% to about 0.00616%; from about 0.00385% to about 0.00615%; from about 0.00386% to about 0.00614%; from about 0.00387% to about 0.00613%; from about 0.00388% to about 0.00612%; from about 0.00389% to about
0.00611%; from about 0.0039% to about 0.0061%; from about 0.00391% to about 0.00609%; from about 0.00392% to about 0.00608%; from about 0.00393% to about 0.00607%; from about 0.00394% to about 0.00606%; from about 0.00395% to about 0.00605%; from about 0.00396% to about 0.00604%; from about 0.00397% to about 0.00603%; from about 0.00398% to about 0.00602%; from about 0.00399% to about 0.00601%; from about 0.004% to about 0.006%; from about 0.00401% to about 0.00599%; from about 0.00402% to about 0.00598%; from about 0.00403% to about 0.00597%; from about 0.00404% to about 0.00596%; from about 0.00405% to about 0.00595%; from about 0.00406% to about 0.00594%; from about 0.00407% to about 0.00593%; from about 0.00408% to about 0.00592%; from about 0.00409% to about 0.00591%; from about 0.0041% to about 0.0059%; from about 0.00411% to about 0.00589%; from about 0.00412% to about 0.00588%; from about 0.00413% to about 0.00587%; from about 0.00414% to about 0.00586%; from about 0.00415% to about 0.00585%; from about 0.00416% to about 0.00584%; from about 0.00417% to about 0.00583%; from about 0.00418% to about 0.00582%; from about
0.00419% to about 0.00581%; from about 0.0042% to about 0.0058%; from about 0.00421% to about 0.00579%; from about 0.00422% to about 0.00578%; from about 0.00423% to about 0.00577%; from about 0.00424% to about 0.00576%; from about 0.00425% to about 0.00575%; from about 0.00426% to about 0.00574%; from about 0.00427% to about 0.00573%; from about 0.00428% to about 0.00572%; from about 0.00429% to about 0.00571%; from about 0.0043% to about 0.0057%; from about 0.00431% to about 0.00569%; from about 0.00432% to about 0.00568%; from about 0.00433% to about 0.00567%; from about 0.00434% to about 0.00566%; from about 0.00435% to about 0.00565%; from about 0.00436% to about 0.00564%; from about 0.00437% to about 0.00563%; from about 0.00438% to about 0.00562%; from about 0.00439% to about 0.00561%; from about 0.0044% to about 0.0056%; from about 0.00441% to about 0.00559%; from about 0.00442% to about 0.00558%; from about 0.00443% to about 0.00557%; from about 0.00444% to about 0.00556%; from about 0.00445% to about 0.00555%; from about 0.00446% to about 0.00554%; from about 0.00447% to about 0.00553%; from about 0.00448% to about
0.00552%; from about 0.00449% to about 0.00551%; from about 0.0045% to about 0.0055%; from about 0.00451% to about 0.00549%; from about 0.00452% to about 0.00548%; from about 0.00453% to about 0.00547%; from about 0.00454% to about 0.00546%; from about 0.00455% to about 0.00545%; from about 0.00456% to about 0.00544%; from about 0.00457% to about 0.00543%; from about 0.00458% to about 0.00542%; from about 0.00459% to about 0.00541%; from about 0.0046% to about 0.0054%; from about 0.00461% to about 0.00539%; from about 0.00462% to about 0.00538%; from about 0.00463% to about 0.00537%; from about 0.00464% to about 0.00536%; from about 0.00465% to about 0.00535%; from about 0.00466% to about 0.00534%; from about 0.00467% to about 0.00533%; from about 0.00468% to about 0.00532%; from about 0.00469% to about 0.00531%; from about 0.0047% to about 0.0053%; from about 0.00471% to about 0.00529%; from about 0.00472% to about 0.00528%; from about 0.00473% to about 0.00527%; from about 0.00474% to about 0.00526%; from about 0.00475% to about 0.00525%; from about 0.00476% to about 0.00524%; from about 0.00477% to about 0.00523%; from about 0.00478% to about 0.00522%; from about 0.00479% to about 0.00521%; from about 0.0048% to about 0.0052%; from about 0.00481% to about 0.00519%; from about 0.00482% to about 0.00518%; from about 0.00483% to about 0.00517%; from about 0.00484% to about 0.00516%; from about 0.00485% to about 0.00515%; from about 0.00486% to about 0.00514%; from about 0.00487% to about 0.00513%; from about 0.00488% to about
0.00512%; from about 0.00489% to about 0.00511%; from about 0.0049% to about 0.0051%; from about 0.00491% to about 0.00509%; from about 0.00492% to about 0.00508%; from about 0.00493% to about 0.00507%; from about 0.00494% to about 0.00506%; from about 0.00495% to about 0.00505%; from about 0.00496% to about 0.00504%; from about 0.00497% to about 0.00503%; from about 0.00498% to about 0.00502%; from about 0.00499% to about 0.00501%; from about 0.005% to about 0.005%; from about 0.00501% to about 0.00499%; from about 0.00502% to about 0.00498%; from about 0.00503% to about 0.00497%; from about 0.00504% to about 0.00496%; from about 0.00505% to about 0.00495%; from about 0.00506% to about 0.00494%; from about 0.00507% to about
0.00493%; from about 0.00508% to about 0.00492%; from about 0.00509% to about 0.00491%; from about 0.0051% to about 0.0049%; from about 0.00511% to about 0.00489%; from about 0.00512% to about 0.00488%; from about 0.00513% to about 0.00487%; from about 0.00514% to about 0.00486%; from about 0.00515% to about 0.00485%; from about 0.00516% to about 0.00484%; from about 0.00517% to about 0.00483%; from about 0.00518% to about 0.00482%; from about 0.00519% to about 0.00481%; from about 0.0052% to about 0.0048%; from about 0.00521% to about 0.00479%; from about 0.00522% to about 0.00478%; from about 0.00523% to about 0.00477%; from about 0.00524% to about 0.00476%; from about 0.00525% to about 0.00475%; from about 0.00526% to about
0.00474%; from about 0.00527% to about 0.00473%; from about 0.00528% to about 0.00472%; from about 0.00529% to about 0.00471%; from about 0.0053% to about 0.0047%; from about 0.00531% to about 0.00469%; from about 0.00532% to about 0.00468%; from about 0.00533% to about 0.00467%; from about 0.00534% to about 0.00466%; from about 0.00535% to about 0.00465%; from about 0.00536% to about 0.00464%; from about 0.00537% to about 0.00463%; from about 0.00538% to about 0.00462%; from about 0.00539% to about 0.00461%; from about 0.0054% to about 0.0046%; from about 0.00541% to about 0.00459%; from about 0.00542% to about 0.00458%; from about 0.00543% to about 0.00457%; from about 0.00544% to about 0.00456%; from about 0.00545% to about 0.00455%; from about 0.00546% to about 0.00454%; from about 0.00547% to about 0.00453%; from about 0.00548% to about 0.00452%; from about 0.00549% to about 0.00451%; from about 0.0055% to about 0.0045%; from about 0.00551% to about 0.00449%; from about 0.00552% to about 0.00448%; from about 0.00553% to about 0.00447%; from about 0.00554% to about 0.00446%; from about 0.00555% to about 0.00445%; from about 0.00556% to about 0.00444%; from about 0.00557% to about 0.00443%; from about 0.00558% to about 0.00442%; from about 0.00559% to about 0.00441%; from about
0.0056% to about 0.0044%; from about 0.00561% to about 0.00439%; from about 0.00562% to about 0.00438%; from about 0.00563% to about 0.00437%; from about 0.00564% to about 0.00436%; from about 0.00565% to about 0.00435%; from about 0.00566% to about 0.00434%; from about 0.00567% to about 0.00433%; from about 0.00568% to about 0.00432%; from about 0.00569% to about 0.00431%; from about 0.0057% to about 0.0043%; from about 0.00571% to about 0.00429%; from about 0.00572% to about 0.00428%; from about 0.00573% to about 0.00427%; from about 0.00574% to about 0.00426%; from about 0.00575% to about 0.00425%; from about 0.00576% to about 0.00424%; from about 0.00577% to about 0.00423%; from about 0.00578% to about 0.00422%; from about 0.00579% to about 0.00421%; from about 0.0058% to about 0.0042%; from about 0.00581% to about 0.00419%; from about 0.00582% to about 0.00418%; from about 0.00583% to about 0.00417%; from about 0.00584% to about 0.00416%; from about 0.00585% to about 0.00415%; from about 0.00586% to about 0.00414%; from about 0.00587% to about 0.00413%; from about 0.00588% to about 0.00412%; from about 0.00589% to about
0.00411%; from about 0.0059% to about 0.0041%; from about 0.00591% to about 0.00409%; from about 0.00592% to about 0.00408%; from about 0.00593% to about 0.00407%; from about 0.00594% to about 0.00406%; from about 0.00595% to about 0.00405%; from about 0.00596% to about 0.00404%; from about 0.00597% to about 0.00403%; from about 0.00598% to about 0.00402%; from about 0.00599% to about 0.00401%; from about 0.006% to about 0.004%; from about 0.00601% to about 0.00399%; from about 0.00602% to about 0.00398%; from about 0.00603% to about 0.00397%; from about 0.00604% to about 0.00396%; from about 0.00605% to about 0.00395%; from about 0.00606% to about 0.00394%; from about 0.00607% to about 0.00393%; from about 0.00608% to about 0.00392%; from about 0.00609% to about 0.00391%; from about 0.0061% to about 0.0039%; from about 0.00611% to about 0.00389%; from about 0.00612% to about 0.00388%; from about 0.00613% to about 0.00387%; from about 0.00614% to about 0.00386%; from about 0.00615% to about 0.00385%; from about 0.00616% to about 0.00384%; from about 0.00617% to about 0.00383%; from about 0.00618% to about 0.00382%; from about 0.00619% to about 0.00381%; from about 0.0062% to about 0.0038%; from about 0.00621% to about 0.00379%; from about 0.00622% to about 0.00378%; from about 0.00623% to about 0.00377%; from about 0.00624% to about 0.00376%; from about 0.00625% to about 0.00375%; from about 0.00626% to about 0.00374%; from about 0.00627% to about 0.00373%; from about 0.00628% to about 0.00372%; from about 0.00629% to about 0.00371%; from about 0.0063% to about 0.0037%; from about 0.00631% to about 0.00369%; from about 0.00632% to about 0.00368%; from about 0.00633% to about 0.00367%; from about 0.00634% to about 0.00366%; from about 0.00635% to about 0.00365%; from about 0.00636% to about 0.00364%; from about 0.00637% to about 0.00363%; from about 0.00638% to about 0.00362%; from about 0.00639% to about 0.00361%; from about 0.0064% to about 0.0036%; from about 0.00641% to about 0.00359%; from about 0.00642% to about 0.00358%; from about 0.00643% to about 0.00357%; from about 0.00644% to about 0.00356%; from about 0.00645% to about 0.00355%; from about 0.00646% to about 0.00354%; from about 0.00647% to about 0.00353%; from about 0.00648% to about
0.00352%; from about 0.00649% to about 0.00351%; from about 0.0065% to about 0.0035%; from about 0.00651% to about 0.00349%; from about 0.00652% to about 0.00348%; from about 0.00653% to about 0.00347%; from about 0.00654% to about 0.00346%; from about 0.00655% to about 0.00345%; from about 0.00656% to about 0.00344%; from about 0.00657% to about 0.00343%; from about 0.00658% to about 0.00342%; from about 0.00659% to about 0.00341%; from about 0.0066% to about 0.0034%; from about 0.00661% to about 0.00339%; from about 0.00662% to about 0.00338%; from about 0.00663% to about 0.00337%; from about 0.00664% to about 0.00336%; from about 0.00665% to about 0.00335%; from about 0.00666% to about 0.00334%; from about 0.00667% to about 0.00333%; from about 0.00668% to about 0.00332%; from about 0.00669% to about
0.00331%; from about 0.0067% to about 0.0033%; from about 0.00671% to about 0.00329%; from about 0.00672% to about 0.00328%; from about 0.00673% to about 0.00327%; from about 0.00674% to about 0.00326%; from about 0.00675% to about 0.00325%; from about 0.00676% to about 0.00324%; from about 0.00677% to about 0.00323%; from about 0.00678% to about 0.00322%; from about 0.00679% to about 0.00321%; from about 0.0068% to about 0.0032%; from about 0.00681% to about 0.00319%; from about 0.00682% to about 0.00318%; from about 0.00683% to about 0.00317%; from about 0.00684% to about 0.00316%; from about 0.00685% to about 0.00315%; from about 0.00686% to about 0.00314%; from about 0.00687% to about 0.00313%; from about 0.00688% to about 0.00312%; from about 0.00689% to about 0.00311%; from about 0.0069% to about 0.0031%; from about 0.00691% to about 0.00309%; from about 0.00692% to about 0.00308%; from about 0.00693% to about 0.00307%; from about 0.00694% to about 0.00306%; from about 0.00695% to about 0.00305%; from about 0.00696% to about 0.00304%; from about 0.00697% to about 0.00303%; from about 0.00698% to about 0.00302%; from about 0.00699% to about 0.00301%; from about 0.007% to about 0.003%; from about 0.00701% to about 0.00299%; from about 0.00702% to about 0.00298%; from about 0.00703% to about 0.00297%; from about 0.00704% to about 0.00296%; from about 0.00705% to about 0.00295%; from about 0.00706% to about 0.00294%; from about 0.00707% to about 0.00293%; from about 0.00708% to about 0.00292%; from about 0.00709% to about
0.00291%; from about 0.0071% to about 0.0029%; from about 0.00711% to about 0.00289%; from about 0.00712% to about 0.00288%; from about 0.00713% to about 0.00287%; from about 0.00714% to about 0.00286%; from about 0.00715% to about 0.00285%; from about 0.00716% to about 0.00284%; from about 0.00717% to about 0.00283%; from about 0.00718% to about 0.00282%; from about 0.00719% to about 0.00281%; from about 0.0072% to about 0.0028%; from about 0.00721% to about 0.00279%; from about 0.00722% to about 0.00278%; from about 0.00723% to about 0.00277%; from about 0.00724% to about 0.00276%; from about 0.00725% to about 0.00275%; from about 0.00726% to about 0.00274%; from about 0.00727% to about 0.00273%; from about 0.00728% to about 0.00272%; from about 0.00729% to about 0.00271%; from about 0.0073% to about 0.0027%; from about 0.00731% to about 0.00269%; from about 0.00732% to about 0.00268%; from about 0.00733% to about 0.00267%; from about 0.00734% to about 0.00266%; from about 0.00735% to about 0.00265%; from about 0.00736% to about 0.00264%; from about 0.00737% to about 0.00263%; from about 0.00738% to about 0.00262%; from about 0.00739% to about 0.00261%; from about 0.0074% to about 0.0026%; from about 0.00741% to about 0.00259%; from about 0.00742% to about 0.00258%; from about 0.00743% to about 0.00257%; from about 0.00744% to about 0.00256%; from about 0.00745% to about 0.00255%; from about 0.00746% to about 0.00254%; from about 0.00747% to about 0.00253%; from about 0.00748% to about 0.00252%; from about 0.00749% to about
0.00251%; from about 0.0075% to about 0.0025%; from about 0.00751% to about 0.00249%; from about 0.00752% to about 0.00248%; from about 0.00753% to about 0.00247%; from about 0.00754% to about 0.00246%; from about 0.00755% to about 0.00245%; from about 0.00756% to about 0.00244%; from about 0.00757% to about 0.00243%; from about 0.00758% to about 0.00242%; from about 0.00759% to about 0.00241%; from about 0.0076% to about 0.0024%; from about 0.00761% to about 0.00239%; from about 0.00762% to about 0.00238%; from about 0.00763% to about 0.00237%; from about 0.00764% to about 0.00236%; from about 0.00765% to about 0.00235%; from about 0.00766% to about 0.00234%; from about 0.00767% to about 0.00233%; from about 0.00768% to about 0.00232%; from about 0.00769% to about 0.00231%; from about 0.0077% to about 0.0023%; from about 0.00771% to about 0.00229%; from about 0.00772% to about 0.00228%; from about 0.00773% to about 0.00227%; from about 0.00774% to about 0.00226%; from about 0.00775% to about 0.00225%; from about 0.00776% to about 0.00224%; from about 0.00777% to about 0.00223%; from about 0.00778% to about 0.00222%; from about 0.00779% to about 0.00221%; from about 0.0078% to about 0.0022%; from about 0.00781% to about 0.00219%; from about 0.00782% to about 0.00218%; from about 0.00783% to about 0.00217%; from about 0.00784% to about 0.00216%; from about 0.00785% to about 0.00215%; from about 0.00786% to about 0.00214%; from about 0.00787% to about 0.00213%; from about 0.00788% to about 0.00212%; from about 0.00789% to about
0.00211%; from about 0.0079% to about 0.0021%; from about 0.00791% to about 0.00209%; from about 0.00792% to about 0.00208%; from about 0.00793% to about 0.00207%; from about 0.00794% to about 0.00206%; from about 0.00795% to about 0.00205%; from about 0.00796% to about 0.00204%; from about 0.00797% to about 0.00203%; from about 0.00798% to about 0.00202%; from about 0.00799% to about 0.00201%; from about 0.008% to about 0.002%; from about 0.00801% to about 0.00199%; from about 0.00802% to about 0.00198%; from about 0.00803% to about 0.00197%; from about 0.00804% to about 0.00196%; from about 0.00805% to about 0.00195%; from about 0.00806% to about 0.00194%; from about 0.00807% to about 0.00193%; from about 0.00808% to about 0.00192%; from about 0.00809% to about 0.00191%; from about 0.0081% to about 0.0019%; from about 0.00811% to about 0.00189%; from about 0.00812% to about 0.00188%; from about 0.00813% to about 0.00187%; from about 0.00814% to about 0.00186%; from about 0.00815% to about 0.00185%; from about 0.00816% to about 0.00184%; from about 0.00817% to about 0.00183%; from about 0.00818% to about 0.00182%; from about 0.00819% to about 0.00181%; from about 0.0082% to about 0.0018%; from about 0.00821% to about 0.00179%; from about 0.00822% to about 0.00178%; from about 0.00823% to about 0.00177%; from about 0.00824% to about 0.00176%; from about 0.00825% to about 0.00175%; from about 0.00826% to about 0.00174%; from about 0.00827% to about 0.00173%; from about 0.00828% to about 0.00172%; from about 0.00829% to about 0.00171%; from about 0.0083% to about 0.0017%; from about 0.00831% to about 0.00169%; from about 0.00832% to about 0.00168%; from about 0.00833% to about 0.00167%; from about 0.00834% to about 0.00166%; from about 0.00835% to about 0.00165%; from about 0.00836% to about 0.00164%; from about 0.00837% to about 0.00163%; from about 0.00838% to about 0.00162%; from about 0.00839% to about 0.00161%; from about 0.0084% to about 0.0016%; from about 0.00841% to about 0.00159%; from about 0.00842% to about 0.00158%; from about 0.00843% to about 0.00157%; from about 0.00844% to about 0.00156%; from about 0.00845% to about 0.00155%; from about 0.00846% to about 0.00154%; from about 0.00847% to about 0.00153%; from about 0.00848% to about
0.00152%; from about 0.00849% to about 0.00151%; from about 0.0085% to about 0.0015%; from about 0.00851% to about 0.00149%; from about 0.00852% to about 0.00148%; from about 0.00853% to about 0.00147%; from about 0.00854% to about 0.00146%; from about 0.00855% to about 0.00145%; from about 0.00856% to about 0.00144%; from about 0.00857% to about 0.00143%; from about 0.00858% to about 0.00142%; from about 0.00859% to about 0.00141%; from about 0.0086% to about 0.0014%; from about 0.00861% to about 0.00139%; from about 0.00862% to about 0.00138%; from about 0.00863% to about 0.00137%; from about 0.00864% to about 0.00136%; from about 0.00865% to about 0.00135%; from about 0.00866% to about 0.00134%; from about 0.00867% to about 0.00133%; from about 0.00868% to about 0.00132%; from about 0.00869% to about
0.00131%; from about 0.0087% to about 0.0013%; from about 0.00871% to about 0.00129%; from about 0.00872% to about 0.00128%; from about 0.00873% to about 0.00127%; from about 0.00874% to about 0.00126%; from about 0.00875% to about 0.00125%; from about 0.00876% to about 0.00124%; from about 0.00877% to about 0.00123%; from about 0.00878% to about 0.00122%; from about 0.00879% to about 0.00121%; from about 0.0088% to about 0.0012%; from about 0.00881% to about 0.00119%; from about 0.00882% to about 0.00118%; from about 0.00883% to about 0.00117%; from about 0.00884% to about 0.00116%; from about 0.00885% to about 0.00115%; from about 0.00886% to about 0.00114%; from about 0.00887% to about 0.00113%; from about 0.00888% to about 0.00112%; from about 0.00889% to about 0.00111%; from about 0.0089% to about 0.0011%; from about 0.00891% to about 0.00109%; from about 0.00892% to about 0.00108%; from about 0.00893% to about 0.00107%; from about 0.00894% to about 0.00106%; from about 0.00895% to about 0.00105%; from about 0.00896% to about 0.00104%; from about 0.00897% to about 0.00103%; from about 0.00898% to about 0.00102%; from about 0.00899% to about 0.00101%; from about 0.009% to about 0.001%; from about 0.00901% to about 0.00099%; from about 0.00902% to about 0.00098%; from about 0.00903% to about 0.00097%; from about 0.00904% to about 0.00096%; from about 0.00905% to about 0.00095%; from about 0.00906% to about 0.00094%; from about 0.00907% to about 0.00093%; from about 0.00908% to about 0.00092%; from about 0.00909% to about 0.00091%; from about 0.0091% to about 0.0009%; from about 0.00911% to about 0.00089%; from about 0.00912% to about 0.00088%; from about 0.00913% to about 0.00087%; from about 0.00914% to about 0.00086%; from about 0.00915% to about 0.00085%; from about 0.00916% to about 0.00084%; from about 0.00917% to about 0.00083%; from about 0.00918% to about 0.00082%; from about 0.00919% to about 0.00081%; from about 0.0092% to about 0.0008%; from about 0.00921% to about 0.00079%; from about 0.00922% to about 0.00078%; from about 0.00923% to about 0.00077%; from about 0.00924% to about 0.00076%; from about 0.00925% to about 0.00075%; from about 0.00926% to about 0.00074%; from about 0.00927% to about 0.00073%; from about 0.00928% to about
0.00072%; from about 0.00929% to about 0.00071%; from about 0.0093% to about 0.0007%; from about 0.00931% to about 0.00069%; from about 0.00932% to about 0.00068%; from about 0.00933% to about 0.00067%; from about 0.00934% to about 0.00066%; from about 0.00935% to about 0.00065%; from about 0.00936% to about 0.00064%; from about 0.00937% to about 0.00063%; from about 0.00938% to about 0.00062%; from about 0.00939% to about 0.00061%; from about 0.0094% to about 0.0006%; from about 0.00941% to about 0.00059%; from about 0.00942% to about 0.00058%; from about 0.00943% to about 0.00057%; from about 0.00944% to about 0.00056%; from about 0.00945% to about 0.00055%; from about 0.00946% to about 0.00054%; from about 0.00947% to about 0.00053%; from about 0.00948% to about 0.00052%; from about 0.00949% to about
0.00051%; from about 0.0095% to about 0.0005%; from about 0.00951% to about 0.00049%; from about 0.00952% to about 0.00048%; from about 0.00953% to about 0.00047%; from about 0.00954% to about 0.00046%; from about 0.00955% to about 0.00045%; from about 0.00956% to about 0.00044%; from about 0.00957% to about 0.00043%; from about 0.00958% to about 0.00042%; from about 0.00959% to about 0.00041%; from about 0.0096% to about 0.0004%; from about 0.00961% to about 0.00039%; from about 0.00962% to about 0.00038%; from about 0.00963% to about 0.00037%; from about 0.00964% to about 0.00036%; from about 0.00965% to about 0.00035%; from about 0.00966% to about 0.00034%; from about 0.00967% to about 0.00033%; from about 0.00968% to about 0.00032%; from about 0.00969% to about 0.00031%; from about 0.0097% to about 0.0003%; from about 0.00971% to about 0.00029%; from about 0.00972% to about 0.00028%; from about 0.00973% to about 0.00027%; from about 0.00974% to about 0.00026%; from about 0.00975% to about 0.00025%; from about 0.00976% to about 0.00024%; from about 0.00977% to about 0.00023%; from about 0.00978% to about 0.00022%; from about 0.00979% to about 0.00021%; from about 0.0098% to about 0.0002%; from about 0.00981% to about 0.00019%; from about 0.00982% to about 0.00018%; from about 0.00983% to about 0.00017%; from about 0.00984% to about 0.00016%; from about 0.00985% to about 0.00015%; from about 0.00986% to about 0.00014%; from about 0.00987% to about 0.00013%; from about 0.00988% to about 0.00012%; from about 0.00989% to about 0.00011%; from about 0.0099% to about 0.0001%; from about 0.00991% to about 0.00009%; from about 0.00992% to about 0.00008%; from about 0.00993% to about 0.00007%; from about 0.00994% to about 0.00006%; from about 0.00995% to about 0.00005%; from about 0.00996% to about 0.00004%; from about 0.00997% to about 0.00003%; from about 0.00998% to about 0.00002%; from about 0.00999% to about 0.00001%; from about 0.00005% to about 0.01995%; from about 0.0001% to about 0.0199%; from about 0.00015% to about 0.01985%; from about 0.0002% to about 0.0198%; from about 0.00025% to about 0.01975%; from about 0.0003% to about 0.0197%; from about 0.00035% to about 0.01965%; from about 0.0004% to about 0.0196%; from about 0.00045% to about 0.01955%; from about 0.0005% to about 0.0195%; from about 0.00055% to about 0.01945%; from about 0.0006% to about 0.0194%; from about 0.00065% to about 0.01935%; from about 0.0007% to about 0.0193%; from about 0.00075% to about 0.01925%; from about 0.0008% to about 0.0192%; from about 0.00085% to about 0.01915%; from about 0.0009% to about 0.0191%; from about 0.00095% to about 0.01905%; from about 0.001 % to about 0.019%; from about 0.00105% to about 0.01895%; from about 0.0011% to about 0.0189%; from about 0.00115% to about 0.01885%; from about 0.0012% to about 0.0188%; from about 0.00125% to about 0.01875%; from about 0.0013% to about 0.0187%; from about 0.00135% to about 0.01865%; from about 0.0014% to about 0.0186%; from about 0.00145% to about 0.01855%; from about 0.0015% to about 0.0185%; from about 0.00155% to about 0.01845%; from about 0.0016% to about 0.0184%; from about 0.00165% to about 0.01835%; from about 0.0017% to about 0.0183%; from about 0.00175% to about 0.01825%; from about 0.0018% to about 0.0182%; from about 0.00185% to about 0.01815%; from about 0.0019% to about 0.0181%; from about 0.00195% to about 0.01805%; from about 0.002% to about 0.018%; from about 0.00205% to about 0.01795%; from about 0.0021% to about 0.0179%; from about 0.00215% to about 0.01785%; from about 0.0022% to about 0.0178%; from about 0.00225% to about 0.01775%; from about 0.0023% to about 0.0177%; from about 0.00235% to about 0.01765%; from about 0.0024% to about 0.0176%; from about 0.00245% to about 0.01755%; from about 0.0025% to about 0.0175%; from about 0.00255% to about 0.01745%; from about 0.0026% to about 0.0174%; from about 0.00265% to about 0.01735%; from about 0.0027% to about 0.0173%; from about 0.00275% to about 0.01725%; from about 0.0028% to about 0.0172%; from about 0.00285% to about 0.01715%; from about 0.0029% to about 0.0171%; from about 0.00295% to about 0.01705%; from about 0.003% to about 0.017%; from about 0.00305% to about 0.01695%; from about 0.0031% to about 0.0169%; from about 0.00315% to about 0.01685%; from about 0.0032% to about 0.0168%; from about 0.00325% to about 0.01675%; from about 0.0033% to about 0.0167%; from about 0.00335% to about 0.01665%; from about 0.0034% to about 0.0166%; from about 0.00345% to about 0.01655%; from about 0.0035% to about 0.0165%; from about 0.00355% to about 0.01645%; from about 0.0036% to about 0.0164%; from about 0.00365% to about 0.01635%; from about 0.0037% to about 0.0163%; from about 0.00375% to about 0.01625%; from about 0.0038% to about 0.0162%; from about 0.00385% to about 0.01615%; from about 0.0039% to about 0.0161%; from about 0.00395% to about 0.01605%; from about 0.004% to about 0.016%; from about 0.00405% to about 0.01595%; from about 0.0041% to about 0.0159%; from about 0.00415% to about 0.01585%; from about 0.0042% to about 0.0158%; from about 0.00425% to about 0.01575%; from about 0.0043% to about 0.0157%; from about 0.00435% to about 0.01565%; from about 0.0044% to about 0.0156%; from about 0.00445% to about 0.01555%; from about 0.0045% to about 0.0155%; from about 0.00455% to about 0.01545%; from about 0.0046% to about 0.0154%; from about 0.00465% to about 0.01535%; from about 0.0047% to about 0.0153%; from about 0.00475% to about 0.01525%; from about 0.0048% to about 0.0152%; from about 0.00485% to about 0.01515%; from about 0.0049% to about 0.0151%; from about 0.00495% to about 0.01505%; from about 0.005% to about 0.015%; from about 0.00505% to about 0.01495%; from about 0.0051% to about 0.0149%; from about 0.00515% to about 0.01485%; from about 0.0052% to about 0.0148%; from about 0.00525% to about 0.01475%; from about 0.0053% to about 0.0147%; from about 0.00535% to about 0.01465%; from about 0.0054% to about 0.0146%; from about 0.00545% to about 0.01455%; from about 0.0055% to about 0.0145%; from about 0.00555% to about 0.01445%; from about 0.0056% to about 0.0144%; from about 0.00565% to about 0.01435%; from about 0.0057% to about 0.0143%; from about 0.00575% to about 0.01425%; from about 0.0058% to about 0.0142%; from about 0.00585% to about 0.01415%; from about 0.0059% to about 0.0141%; from about 0.00595% to about 0.01405%; from about 0.006% to about 0.014%; from about 0.00605% to about 0.01395%; from about 0.0061% to about 0.0139%; from about 0.00615% to about 0.01385%; from about 0.0062% to about 0.0138%; from about 0.00625% to about 0.01375%; from about 0.0063% to about 0.0137%; from about 0.00635% to about 0.01365%; from about 0.0064% to about 0.0136%; from about 0.00645% to about 0.01355%; from about 0.0065% to about 0.0135%; from about 0.00655% to about 0.01345%; from about 0.0066% to about 0.0134%; from about 0.00665% to about 0.01335%; from about 0.0067% to about 0.0133%; from about 0.00675% to about 0.01325%; from about 0.0068% to about 0.0132%; from about 0.00685% to about 0.01315%; from about 0.0069% to about 0.0131%; from about 0.00695% to about 0.01305%; from about 0.007% to about 0.013%; from about 0.00705% to about 0.01295%; from about 0.0071% to about 0.0129%; from about 0.00715% to about 0.01285%; from about 0.0072% to about 0.0128%; from about 0.00725% to about 0.01275%; from about 0.0073% to about 0.0127%; from about 0.00735% to about 0.01265%; from about 0.0074% to about 0.0126%; from about 0.00745% to about 0.01255%; from about 0.0075% to about 0.0125%; from about 0.00755% to about 0.01245%; from about 0.0076% to about 0.0124%; from about 0.00765% to about 0.01235%; from about 0.0077% to about 0.0123%; from about 0.00775% to about 0.01225%; from about 0.0078% to about 0.0122%; from about 0.00785% to about 0.01215%; from about 0.0079% to about 0.0121%; from about 0.00795% to about 0.01205%; from about 0.008% to about 0.012%; from about 0.00805% to about 0.01195%; from about 0.0081% to about 0.0119%; from about 0.00815% to about 0.01185%; from about 0.0082% to about 0.0118%; from about 0.00825% to about 0.01175%; from about 0.0083% to about 0.0117%; from about 0.00835% to about 0.01165%; from about 0.0084% to about 0.0116%; from about 0.00845% to about 0.01155%; from about 0.0085% to about 0.0115%; from about 0.00855% to about 0.01145%; from about 0.0086% to about 0.0114%; from about 0.00865% to about 0.01135%; from about 0.0087% to about 0.0113%; from about 0.00875% to about 0.01125%; from about 0.0088% to about 0.0112%; from about 0.00885% to about 0.01115%; from about 0.0089% to about 0.0111%; from about 0.00895% to about 0.01105%; from about 0.009% to about 0.011%; from about 0.00905% to about 0.01095%; from about 0.0091% to about 0.0109%; from about 0.00915% to about 0.01085%; from about 0.0092% to about 0.0108%; from about 0.00925% to about 0.01075%; from about 0.0093% to about 0.0107%; from about 0.00935% to about 0.01065%; from about 0.0094% to about 0.0106%; from about 0.00945% to about 0.01055%; from about 0.0095% to about 0.0105%; from about 0.00955% to about 0.01045%; from about 0.0096% to about 0.0104%; from about 0.00965% to about 0.01035%; from about 0.0097% to about 0.0103%; from about 0.00975% to about 0.01025%; from about 0.0098% to about 0.0102%; from about 0.00985% to about 0.01015%; from about 0.0099% to about 0.0101%; from about 0.00995% to about 0.01005%; from about 0.01% to about 0.01%; from about 0.01005% to about 0.00995%; from about 0.0101% to about 0.0099%; from about 0.01015% to about 0.00985%; from about 0.0102% to about 0.0098%; from about 0.01025% to about 0.00975%; from about 0.0103% to about 0.0097%; from about 0.01035% to about 0.00965%; from about 0.0104% to about 0.0096%; from about 0.01045% to about 0.00955%; from about 0.0105% to about 0.0095%; from about 0.01055% to about 0.00945%; from about 0.0106% to about 0.0094%; from about 0.01065% to about 0.00935%; from about 0.0107% to about 0.0093%; from about 0.01075% to about 0.00925%; from about 0.0108% to about 0.0092%; from about 0.01085% to about 0.00915%; from about 0.0109% to about 0.0091%; from about 0.01095% to about 0.00905%; from about 0.011 % to about 0.009%; from about 0.01105% to about 0.00895%; from about 0.0111% to about 0.0089%; from about 0.01115% to about 0.00885%; from about 0.0112% to about 0.0088%; from about 0.01125% to about 0.00875%; from about 0.0113% to about 0.0087%; from about 0.01135% to about 0.00865%; from about 0.0114% to about 0.0086%; from about 0.01145% to about 0.00855%; from about 0.0115% to about 0.0085%; from about 0.01155% to about 0.00845%; from about 0.0116% to about 0.0084%; from about 0.01165% to about 0.00835%; from about 0.0117% to about 0.0083%; from about 0.01175% to about 0.00825%; from about 0.0118% to about 0.0082%; from about 0.01185% to about 0.00815%; from about O.0119% to about 0.0081%; from about 0.01195% to about 0.00805%; from about 0.012% to about 0.008%; from about 0.01205% to about 0.00795%; from about 0.0121% to about 0.0079%; from about 0.01215% to about 0.00785%; from about 0.0122% to about 0.0078%; from about 0.01225% to about 0.00775%; from about 0.0123% to about 0.0077%; from about 0.01235% to about 0.00765%; from about 0.0124% to about 0.0076%; from about 0.01245% to about 0.00755%; from about 0.0125% to about 0.0075%; from about 0.01255% to about 0.00745%; from about 0.0126% to about 0.0074%; from about 0.01265% to about 0.00735%; from about 0.0127% to about 0.0073%; from about 0.01275% to about 0.00725%; from about 0.0128% to about 0.0072%; from about 0.01285% to about 0.00715%; from about 0.0129% to about 0.0071%; from about 0.01295% to about 0.00705%; from about 0.013% to about 0.007%; from about 0.01305% to about 0.00695%; from about 0.0131% to about 0.0069%; from about 0.01315% to about 0.00685%; from about 0.0132% to about 0.0068%; from about 0.01325% to about 0.00675%; from about 0.0133% to about 0.0067%; from about 0.01335% to about 0.00665%; from about 0.0134% to about 0.0066%; from about 0.01345% to about 0.00655%; from about 0.0135% to about 0.0065%; from about 0.01355% to about 0.00645%; from about 0.0136% to about 0.0064%; from about 0.01365% to about 0.00635%; from about 0.0137% to about 0.0063%; from about 0.01375% to about 0.00625%; from about 0.0138% to about 0.0062%; from about 0.01385% to about 0.00615%; from about 0.0139% to about 0.0061%; from about 0.01395% to about 0.00605%; from about 0.014% to about 0.006%; from about 0.01405% to about 0.00595%; from about 0.0141% to about 0.0059%; from about 0.01415% to about 0.00585%; from about 0.0142% to about 0.0058%; from about 0.01425% to about 0.00575%; from about 0.0143% to about 0.0057%; from about 0.01435% to about 0.00565%; from about 0.0144% to about 0.0056%; from about 0.01445% to about 0.00555%; from about 0.0145% to about 0.0055%; from about 0.01455% to about 0.00545%; from about 0.0146% to about 0.0054%; from about 0.01465% to about 0.00535%; from about 0.0147% to about 0.0053%; from about 0.01475% to about 0.00525%; from about 0.0148% to about 0.0052%; from about 0.01485% to about 0.00515%; from about 0.0149% to about 0.0051%; from about 0.01495% to about 0.00505%; from about 0.015% to about 0.005%; from about 0.01505% to about 0.00495%; from about 0.0151% to about 0.0049%; from about 0.01515% to about 0.00485%; from about 0.0152% to about 0.0048%; from about 0.01525% to about 0.00475%; from about 0.0153% to about 0.0047%; from about 0.01535% to about 0.00465%; from about 0.0154% to about 0.0046%; from about 0.01545% to about 0.00455%; from about 0.0155% to about 0.0045%; from about 0.01555% to about 0.00445%; from about 0.0156% to about 0.0044%; from about 0.01565% to about 0.00435%; from about 0.0157% to about 0.0043%; from about 0.01575% to about 0.00425%; from about 0.0158% to about 0.0042%; from about 0.01585% to about 0.00415%; from about 0.0159% to about 0.0041%; from about 0.01595% to about 0.00405%; from about 0.016% to about 0.004%; from about 0.01605% to about 0.00395%; from about 0.0161% to about 0.0039%; from about 0.01615% to about 0.00385%; from about 0.0162% to about 0.0038%; from about 0.01625% to about 0.00375%; from about 0.0163% to about 0.0037%; from about 0.01635% to about 0.00365%; from about 0.0164% to about 0.0036%; from about 0.01645% to about 0.00355%; from about 0.0165% to about 0.0035%; from about 0.01655% to about 0.00345%; from about 0.0166% to about 0.0034%; from about 0.01665% to about 0.00335%; from about 0.0167% to about 0.0033%; from about 0.01675% to about 0.00325%; from about 0.0168% to about 0.0032%; from about 0.01685% to about 0.00315%; from about 0.0169% to about 0.0031%; from about 0.01695% to about 0.00305%; from about 0.017% to about 0.003%; from about 0.01705% to about 0.00295%; from about 0.0171% to about 0.0029%; from about 0.01715% to about 0.00285%; from about 0.0172% to about 0.0028%; from about 0.01725% to about 0.00275%; from about 0.0173% to about 0.0027%; from about 0.01735% to about 0.00265%; from about 0.0174% to about 0.0026%; from about 0.01745% to about 0.00255%; from about 0.0175% to about 0.0025%; from about 0.01755% to about 0.00245%; from about 0.0176% to about 0.0024%; from about 0.01765% to about 0.00235%; from about 0.0177% to about 0.0023%; from about 0.01775% to about 0.00225%; from about 0.0178% to about 0.0022%; from about 0.01785% to about 0.00215%; from about 0.0179% to about 0.0021%; from about 0.01795% to about 0.00205%; from about 0.018% to about 0.002%; from about 0.01805% to about 0.00195%; from about 0.0181% to about 0.0019%; from about 0.01815% to about 0.00185%; from about 0.0182% to about 0.0018%; from about 0.01825% to about 0.00175%; from about 0.0183% to about 0.0017%; from about 0.01835% to about 0.00165%; from about 0.0184% to about 0.0016%; from about 0.01845% to about 0.00155%; from about 0.0185% to about 0.0015%; from about 0.01855% to about 0.00145%; from about 0.0186% to about 0.0014%; from about 0.01865% to about 0.00135%; from about 0.0187% to about 0.0013%; from about 0.01875% to about 0.00125%; from about 0.0188% to about 0.0012%; from about 0.01885% to about 0.00115%; from about 0.0189% to about 0.0011%; from about 0.01895% to about 0.00105%; from about 0.019% to about 0.001%; from about 0.01905% to about 0.00095%; from about 0.0191% to about 0.0009%; from about 0.01915% to about 0.00085%; from about 0.0192% to about 0.0008%; from about 0.01925% to about 0.00075%; from about 0.0193% to about 0.0007%; from about 0.01935% to about 0.00065%; from about 0.0194% to about 0.0006%; from about 0.01945% to about 0.00055%; from about 0.0195% to about 0.0005%; from about 0.01955% to about 0.00045%; from about 0.0196% to about 0.0004%; from about 0.01965% to about 0.00035%; from about 0.0197% to about 0.0003%; from about 0.01975% to about 0.00025%; from about 0.0198% to about 0.0002%; from about 0.01985% to about 0.00015%; from about 0.0199% to about 0.0001%; from about 0.01995% to about 0.00005% w/w of the total composition.
[0898] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the antimicrobial peptide or agriculturally acceptable salt thereof in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0899] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount ranging from about 0.00001% to about 0.00199%; from about 0.00002% to about 0.00198%; from about 0.00003% to about 0.00197%; from about 0.00004% to about 0.00196%; from about 0.00005% to about 0.00195%; from about 0.00006% to about 0.00194%; from about 0.00007% to about 0.00193%; from about 0.00008% to about 0.00192%; from about 0.00009% to about 0.00191%; from about 0.0001% to about 0.0019%; from about 0.00011% to about 0.00189%; from about 0.00012% to about 0.00188%; from about 0.00013% to about 0.00187%; from about 0.00014% to about 0.00186%; from about 0.00015% to about 0.00185%; from about 0.00016% to about 0.00184%; from about 0.00017% to about 0.00183%; from about 0.00018% to about 0.00182%; from about 0.00019% to about 0.00181%; from about 0.0002% to about 0.0018%; from about 0.00021% to about 0.00179%; from about 0.00022% to about 0.00178%; from about 0.00023% to about 0.00177%; from about 0.00024% to about 0.00176%; from about 0.00025% to about 0.00175%; from about 0.00026% to about 0.00174%; from about 0.00027% to about 0.00173%; from about 0.00028% to about 0.00172%; from about 0.00029% to about 0.00171%; from about 0.0003% to about 0.0017%; from about 0.00031% to about 0.00169%; from about 0.00032% to about 0.00168%; from about 0.00033% to about 0.00167%; from about 0.00034% to about 0.00166%; from about 0.00035% to about 0.00165%; from about 0.00036% to about 0.00164%; from about 0.00037% to about 0.00163%; from about 0.00038% to about 0.00162%; from about 0.00039% to about 0.00161%; from about 0.0004% to about 0.0016%; from about 0.00041% to about 0.00159%; from about 0.00042% to about 0.00158%; from about 0.00043% to about 0.00157%; from about 0.00044% to about 0.00156%; from about 0.00045% to about 0.00155%; from about 0.00046% to about 0.00154%; from about 0.00047% to about 0.00153%; from about 0.00048% to about 0.00152%; from about 0.00049% to about 0.00151%; from about 0.0005% to about 0.0015%; from about 0.00051% to about 0.00149%; from about 0.00052% to about 0.00148%; from about 0.00053% to about 0.00147%; from about 0.00054% to about 0.00146%; from about 0.00055% to about 0.00145%; from about 0.00056% to about 0.00144%; from about 0.00057% to about 0.00143%; from about 0.00058% to about 0.00142%; from about 0.00059% to about 0.00141%; from about 0.0006% to about 0.0014%; from about 0.00061% to about 0.00139%; from about 0.00062% to about 0.00138%; from about 0.00063% to about 0.00137%; from about 0.00064% to about 0.00136%; from about 0.00065% to about 0.00135%; from about 0.00066% to about 0.00134%; from about 0.00067% to about 0.00133%; from about 0.00068% to about 0.00132%; from about 0.00069% to about
0.00131%; from about 0.0007% to about 0.0013%; from about 0.00071% to about 0.00129%; from about 0.00072% to about 0.00128%; from about 0.00073% to about 0.00127%; from about 0.00074% to about 0.00126%; from about 0.00075% to about 0.00125%; from about 0.00076% to about 0.00124%; from about 0.00077% to about 0.00123%; from about 0.00078% to about 0.00122%; from about 0.00079% to about 0.00121%; from about 0.0008% to about 0.0012%; from about 0.00081% to about 0.00119%; from about 0.00082% to about 0.00118%; from about 0.00083% to about 0.00117%; from about 0.00084% to about 0.00116%; from about 0.00085% to about 0.00115%; from about 0.00086% to about 0.00114%; from about 0.00087% to about 0.00113%; from about 0.00088% to about
0.00112%; from about 0.00089% to about 0.00111%; from about 0.0009% to about 0.0011%; from about 0.00091% to about 0.00109%; from about 0.00092% to about 0.00108%; from about 0.00093% to about 0.00107%; from about 0.00094% to about 0.00106%; from about 0.00095% to about 0.00105%; from about 0.00096% to about 0.00104%; from about 0.00097% to about 0.00103%; from about 0.00098% to about 0.00102%; from about 0.00099% to about 0.00101%; from about 0.001% to about 0.001%; from about 0.00101% to about 0.00099%; from about 0.00102% to about 0.00098%; from about 0.00103% to about 0.00097%; from about 0.00104% to about 0.00096%; from about 0.00105% to about 0.00095%; from about 0.00106% to about 0.00094%; from about 0.00107% to about
0.00093%; from about 0.00108% to about 0.00092%; from about 0.00109% to about 0.00091%; from about 0.0011% to about 0.0009%; from about 0.00111% to about 0.00089%; from about 0.00112% to about 0.00088%; from about 0.00113% to about 0.00087%; from about 0.00114% to about 0.00086%; from about 0.00115% to about 0.00085%; from about 0.00116% to about 0.00084%; from about 0.00117% to about 0.00083%; from about 0.00118% to about 0.00082%; from about 0.00119% to about 0.00081%; from about 0.0012% to about 0.0008%; from about 0.00121% to about 0.00079%; from about 0.00122% to about 0.00078%; from about 0.00123% to about 0.00077%; from about 0.00124% to about 0.00076%; from about 0.00125% to about 0.00075%; from about 0.00126% to about 0.00074%; from about 0.00127% to about 0.00073%; from about 0.00128% to about 0.00072%; from about 0.00129% to about 0.00071%; from about 0.0013% to about 0.0007%; from about 0.00131% to about 0.00069%; from about 0.00132% to about 0.00068%; from about 0.00133% to about 0.00067%; from about 0.00134% to about 0.00066%; from about 0.00135% to about 0.00065%; from about 0.00136% to about 0.00064%; from about 0.00137% to about 0.00063%; from about 0.00138% to about 0.00062%; from about 0.00139% to about 0.00061%; from about 0.0014% to about 0.0006%; from about 0.00141% to about 0.00059%; from about 0.00142% to about 0.00058%; from about 0.00143% to about 0.00057%; from about 0.00144% to about 0.00056%; from about 0.00145% to about 0.00055%; from about 0.00146% to about 0.00054%; from about 0.00147% to about 0.00053%; from about 0.00148% to about 0.00052%; from about 0.00149% to about
0.00051%; from about 0.0015% to about 0.0005%; from about 0.00151% to about 0.00049%; from about 0.00152% to about 0.00048%; from about 0.00153% to about 0.00047%; from about 0.00154% to about 0.00046%; from about 0.00155% to about 0.00045%; from about 0.00156% to about 0.00044%; from about 0.00157% to about 0.00043%; from about 0.00158% to about 0.00042%; from about 0.00159% to about 0.00041%; from about 0.0016% to about 0.0004%; from about 0.00161% to about 0.00039%; from about 0.00162% to about 0.00038%; from about 0.00163% to about 0.00037%; from about 0.00164% to about 0.00036%; from about 0.00165% to about 0.00035%; from about 0.00166% to about 0.00034%; from about 0.00167% to about 0.00033%; from about 0.00168% to about 0.00032%; from about 0.00169% to about 0.00031%; from about 0.0017% to about 0.0003%; from about 0.00171% to about 0.00029%; from about 0.00172% to about 0.00028%; from about 0.00173% to about 0.00027%; from about 0.00174% to about 0.00026%; from about 0.00175% to about 0.00025%; from about 0.00176% to about 0.00024%; from about 0.00177% to about 0.00023%; from about 0.00178% to about 0.00022%; from about 0.00179% to about 0.00021%; from about 0.0018% to about 0.0002%; from about 0.00181% to about 0.00019%; from about 0.00182% to about 0.00018%; from about 0.00183% to about 0.00017%; from about 0.00184% to about 0.00016%; from about 0.00185% to about 0.00015%; from about 0.00186% to about 0.00014%; from about 0.00187% to about 0.00013%; from about 0.00188% to about 0.00012%; from about 0.00189% to about 0.00011%; from about 0.0019% to about 0.0001%; from about 0.00191% to about 0.00009%; from about 0.00192% to about 0.00008%; from about 0.00193% to about 0.00007%; from about 0.00194% to about 0.00006%; from about 0.00195% to about 0.00005%; from about 0.00196% to about 0.00004%; from about 0.00197% to about 0.00003%; from about 0.00198% to about 0.00002%; or from about 0.00199% to about 0.00001%, w/w of the total composition.
[0900] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0901] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the excipient is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47 % to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42% ; from about 59 % to about 41%; from about 60% to about 40% ; from about 61 % to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71 % to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77 % to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, w/w of the total composition.
[0902] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the excipient is in an amount of about 0.000001%, 0.00001%, 0.0001%, 0.001%, 0.01%, 0.02%, 0.03%, 0.04%, 0.05%, 0.06%, 0.07%, 0.08%, 0.09%, 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6%, 0.7%, 0.8%, 0.9%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%,
34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%,
50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%,
66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%,
82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, 99.99%, 99.999%, 99.9999%, or 99.99999% by weight of the total composition.
[0903] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 5000:1.
[0904] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 5000:1, about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1 :5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1.
[0905] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 3000:1.
[0906] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1000:1.
[0907] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 500:1.
[0908] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 : 10 to about 400: 1.
[0909] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 300:1.
[0910] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 5000:1.
[0911] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 3000:1.
[0912] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 1000:1.
[0913] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 500:1 .
[0914] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 400:1 .
[0915] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :1 to about 300:1 .
[0916] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1 :10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1 :10 to about 1:4, from about 1:10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1 :2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1 :10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1.
[0917] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) ranges from about 1 :10 to about 2:1, about 1 :10 to about 3:1, about 1:10 to about 4:1, about 1:10 to about 5:l, about 1:10 to about 6:1, about 1 :10 to about 7:l, about 1:10 to about 8:1, about 1:10 to about 9:1, about 1:10 to about 10:1, about 1:10 to about 11:1, about 1:10 to about 12:1, about 1:10 to about 13:1, about 1:10 to about 14:1, about 1:10 to about 15:1, about 1:10 to about 16:1, about 1:10 to about 17:1, about 1:10 to about 18:1, about 1 :10 to about 19:1, about 1:10 to about 20:1, about 1:10 to about 21 :1, about 1:10 to about 22:1, about 1:10 to about 23:1, about 1:10 to about 24:1, about 1:10 to about 25:1, about 1 :10 to about 26:1, about 1:10 to about 27:1, about 1:10 to about 28:1, about 1:10 to about 29:1, about 1:10 to about 30:1, about 1:10 to about 31:1, about 1:10 to about 32:1, about 1 :10 to about 33:1, about 1:10 to about 34:1, about 1:10 to about 35:1, about 1:10 to about 36:1, about 1:10 to about 37:1, about 1:10 to about 38:1, about 1:10 to about 39:1, about 1 :10 to about 40:1, about 1:10 to about 41:1, about 1:10 to about 42:1, about 1:10 to about 43:1, about 1:10 to about 44:1, about 1:10 to about 45:1, about 1:10 to about 46:1, about 1 :10 to about 47:1, about 1:10 to about 48:1, about 1:10 to about 49:1, about 1:10 to about 50:1, about 1:10 to about 51:1, about 1:10 to about 52:1, about 1:10 to about 53:1, about 1 :10 to about 54:1, about 1:10 to about 55:1, about 1:10 to about 56:1, about 1:10 to about 57:1, about 1:10 to about 58:1, about 1:10 to about 59:1, about 1:10 to about 60:1, about 1 :10 to about 61 :1, about 1:10 to about 62:1, about 1:10 to about 63:1, about 1:10 to about 64:1, about 1:10 to about 65:1, about 1:10 to about 66:1, about 1:10 to about 67:1, about 1 :10 to about 68:1, about 1:10 to about 69:1, about 1:10 to about 70:1, about 1:10 to about 71:1, about 1:10 to about 72:1, about 1:10 to about 73:1, about 1:10 to about 74:1, about 1 :10 to about 75:1, about 1:10 to about 76:1, about 1:10 to about 77:1, about 1:10 to about 78:1, about 1:10 to about 79:1, about 1:10 to about 80:1, about 1:10 to about 81:1, about 1 :10 to about 82:1, about 1:10 to about 83:1, about 1:10 to about 84:1, about 1:10 to about 85:1, about 1:10 to about 86:1, about 1:10 to about 87:1, about 1:10 to about 88:1, about 1 :10 to about 89:1, about 1:10 to about 90:1, about 1:10 to about 91 :1, about 1:10 to about 92:1, about 1:10 to about 93:1, about 1:10 to about 94:1, about 1:10 to about 95:1, about 1 :10 to about 96:1, about 1:10 to about 97:1, about 1:10 to about 98:1, about 1:10 to about 99:1, about 1:10 to about 100:1, about 1:10 to about 101:1, about 1:10 to about 102:1, about 1:10 to about 103:1, about 1:10 to about 104:1, about 1:10 to about 105:1, about 1:10 to about 106:1, about 1:10 to about 107:1, about 1:10 to about 108:1, about 1:10 to about 109:1, about 1:10 to about 110:1, about 1:10 to about 111 :1, about 1:10 to about 112:1, about 1:10 to about 113:1, about 1:10 to about 114:1, about 1:10 to about 115:1, about 1:10 to about 116:1, about 1:10 to about 117:1, about 1:10 to about 118:1, about 1:10 to about 119:1, about 1:10 to about 120:1, about 1:10 to about 121:1, about 1:10 to about 122:1, about 1:10 to about 123:1, about 1:10 to about 124:1, about 1:10 to about 125:1, about 1:10 to about 126:1, about 1:10 to about 127:1, about 1:10 to about 128:1, about 1:10 to about 129:1, about 1:10 to about 130:1, about 1:10 to about 131:1, about 1:10 to about 132:1, about 1:10 to about 133:1, about 1:10 to about 134:1, about 1:10 to about 135:1, about 1:10 to about 136:1, about 1:10 to about 137:1, about 1:10 to about 138:1, about 1:10 to about 139:1, about 1:10 to about 140:1, about 1:10 to about 141:1, about 1:10 to about 142:1, about 1:10 to about 143:1, about 1:10 to about 144:1, about 1:10 to about 145:1, about 1:10 to about 146:1, about 1:10 to about 147:1, about 1:10 to about 148:1, about 1:10 to about 149:1, about 1:10 to about 150:1, about 1:10 to about 151:1, about 1:10 to about 152:1, about 1:10 to about 153:1, about 1:10 to about 154:1, about 1:10 to about 155:1, about 1:10 to about 156:1, about 1:10 to about 157:1, about 1:10 to about 158:1, about 1:10 to about 159:1, about 1:10 to about 160:1, about 1:10 to about 161:1, about 1:10 to about 162:1, about 1:10 to about 163:1, about 1:10 to about 164:1, about 1:10 to about 165:1, about 1:10 to about 166:1, about 1:10 to about 167:1, about 1:10 to about 168:1, about 1:10 to about 169:1, about 1:10 to about 170:1, about 1:10 to about 171:1, about 1:10 to about 172:1, about 1:10 to about 173:1, about 1:10 to about 174:1, about 1:10 to about 175:1, about 1:10 to about 176:1, about 1:10 to about 177:1, about 1:10 to about 178:1, about 1:10 to about 179:1, about 1:10 to about 180:1, about 1:10 to about 181 :1, about 1:10 to about 182:1, about 1:10 to about 183:1, about 1:10 to about 184:1, about 1:10 to about 185:1, about 1:10 to about 186:1, about 1:10 to about 187:1, about 1:10 to about 188:1, about 1:10 to about 189:1, about 1:10 to about 190:1, about 1:10 to about 191:1, about 1:10 to about 192:1, about 1:10 to about 193:1, about 1:10 to about 194:1, about 1:10 to about 195:1, about 1:10 to about 196:1, about 1:10 to about 197:1, about 1:10 to about 198:1, about 1:10 to about 199:1, about 1:10 to about 200:1, about 1:10 to about 201:1, about 1:10 to about 202:1, about 1:10 to about 203:1, about 1:10 to about 204:1, about 1:10 to about 205:1, about 1:10 to about 206:1, about 1:10 to about 207:1, about 1:10 to about 208:1, about 1:10 to about 209:1, about 1:10 to about 210:1, about 1:10 to about 211:1, about 1:10 to about 212:1, about 1:10 to about 213:1, about 1:10 to about 214:1, about 1:10 to about 215:1, about 1:10 to about 216:1, about 1:10 to about 217:1, about 1:10 to about 218:1, about 1:10 to about 219:1, about 1:10 to about 220:1, about 1:10 to about 221:1, about 1:10 to about 222:1, about 1:10 to about 223:1, about 1:10 to about 224:1, about 1:10 to about 225:1, about 1:10 to about 226:1, about 1:10 to about 227:1, about 1:10 to about 228:1, about 1:10 to about 229:1, about 1:10 to about 230:1, about 1:10 to about 231:1, about 1:10 to about 232:1, about 1:10 to about 233:1, about 1:10 to about 234:1, about 1:10 to about 235:1, about 1:10 to about 236:1, about 1:10 to about 237:1, about 1:10 to about 238:1, about 1:10 to about 239:1, about 1:10 to about 240:1, about 1:10 to about 241:1, about 1:10 to about 242:1, about 1:10 to about 243:1, about 1:10 to about 244:1, about 1:10 to about 245:1, about 1:10 to about 246:1, about 1:10 to about 247:1, about 1:10 to about 248:1, about 1:10 to about 249:1, about 1:10 to about 250:1, about 1:10 to about 251 :1, about 1:10 to about 252:1, about 1:10 to about 253:1, about 1:10 to about 254:1, about 1:10 to about 255:1, about 1:10 to about 256:1, about 1:10 to about 257:1, about 1:10 to about 258:1, about 1:10 to about 259:1, about 1:10 to about 260:1, about 1:10 to about 261:1, about 1:10 to about 262:1, about 1:10 to about 263:1, about 1:10 to about 264:1, about 1:10 to about 265:1, about 1:10 to about 266:1, about 1:10 to about 267:1, about 1:10 to about 268:1, about 1:10 to about 269:1, about 1:10 to about 270:1, about 1:10 to about 271:1, about 1:10 to about 272:1, about 1:10 to about 273:1, about 1:10 to about 274:1, about 1:10 to about 275:1, about 1:10 to about 276:1, about 1:10 to about 277:1, about 1:10 to about 278:1, about 1:10 to about 279:1, about 1:10 to about 280:1, about 1:10 to about 281:1, about 1:10 to about 282:1, about 1:10 to about 283:1, about 1:10 to about 284:1, about 1:10 to about 285:1, about 1:10 to about 286:1, about 1:10 to about 287:1, about 1:10 to about 288:1, about 1:10 to about 289:1, about 1:10 to about 290:1, about 1:10 to about 291:1, about 1:10 to about 292:1, about 1:10 to about 293:1, about 1:10 to about 294:1, about 1:10 to about 295:1, about 1:10 to about 296:1, about 1:10 to about 297:1, about 1:10 to about 298:1, about 1:10 to about 299:1, about 1:10 to about 300:1, about 1:10 to about 301:1, about 1:10 to about 302:1, about 1:10 to about 303:1, about 1:10 to about 304:1, about 1:10 to about 305:1, about 1:10 to about 306:1, about 1:10 to about 307:1, about 1:10 to about 308:1, about 1:10 to about 309:1, about 1:10 to about 310:1, about 1:10 to about 311:1, about 1:10 to about 312:1, about 1:10 to about 313:1, about 1:10 to about 314:1, about 1:10 to about 315:1, about 1:10 to about 316:1, about 1:10 to about 317:1, about 1:10 to about 318:1, about 1:10 to about 319:1, about 1:10 to about 320:1, about 1:10 to about 321 :1, about 1:10 to about 322:1, about 1:10 to about 323:1, about 1:10 to about 324:1, about 1:10 to about 325:1, about 1:10 to about 326:1, about 1:10 to about 327:1, about 1:10 to about 328:1, about 1:10 to about 329:1, or about 1:10 to about 330:1.
[0918] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 319.6030164.
[0919] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 317.1530072.
[0920] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 252.4672893.
[0921] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 145.4905117.
[0922] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 129.4347391.
[0923] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 124.2900619.
[0924] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 87.94027452.
[0925] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 86.24648324.
[0926] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 77.5140482.
[0927] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.897205.
[0928] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 73.44210553.
[0929] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 72.98700605.
[0930] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 53.38351062.
[0931] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 50.94513553.
[0932] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 49.98224086. [0933] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 40.88162007.
[0934] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 37.17101954.
[0935] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 34.35145587.
[0936] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.97249146.
[0937] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 33.69789197.
[0938] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 32.90403423.
[0939] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.89973577.
[0940] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 31.85696326.
[0941] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 26.92272685.
[0942] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.34350224.
[0943] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.07788497.
[0944] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 22.02784114.
[0945] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 20.15554593.
[0946] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.31431086.
[0947] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 17.17059524.
[0948] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.81691793.
[0949] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 16.3653315.
[0950] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 15.94308131.
[0951] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 15.84806932.
[0952] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 12.25073038.
[0953] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 11.87450341.
[0954] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.72015899.
[0955] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.61784715.
[0956] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 10.0903766. [0957] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 9.56792468.
[0958] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.89924782.
[0959] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.77691845.
[0960] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 8.563483639.
[0961] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 7.655822524.
[0962] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 5.84571854.
[0963] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 4.758355866.
[0964] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 4.155776786.
[0965] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.778146876.
[0966] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 3.014708952.
[0967] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.620072693.
[0968] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.582603977.
[0969] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 2.212878425.
[0970] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.886062254.
[0971] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.860604057.
[0972] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.826172189.
[0973] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.355945504.
[0974] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.11798779.
[0975] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 1.055796564.
[0976] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.977591312.
[0977] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.770646517.
[0978] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.750571954.
[0979] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.730349113.
[0980] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.599431023. [0981] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.536093495.
[0982] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.40062441.
[0983] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.356748372.
[0984] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.327975307.
[0985] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1 ):(2) has a ratio of about 0.254984024.
[0986] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.22877018.
[0987] In some embodiments, an antimicrobial composition of the present disclosure comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the ratio of (1):(2) has a ratio of about 0.139327165.
[0988] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.000016287% w/w of the total weight of the composition.
[0989] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.000057139% w/w of the total weight of the composition.
[0990] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00006467% w/w of the total weight of the composition.
[0991] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.000076679% w/w of the total weight of the composition.
[0992] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.000094002% w/w of the total weight of the composition.
[0993] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00010875% w/w of the total weight of the composition.
[0994] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00013069% w/w of the total weight of the composition.
[0995] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00035036% w/w of the total weight of the composition.
[0996] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00055207% w/w of the total weight of the composition.
[0997] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00064032% w/w of the total weight of the composition.
[0998] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00067121% w/w of the total weight of the composition.
[0999] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.00088103% w/w of the total weight of the composition.
[1000] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0020078% w/w of the total weight of the composition.
[1001] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0021463% w/w of the total weight of the composition.
[1002] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0026119% w/w of the total weight of the composition.
[1003] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0029214% w/w of the total weight of the composition.
[1004] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0035342% w/w of the total weight of the composition. [1005] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0036323% w/w of the total weight of the composition.
[1006] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.004048% w/w of the total weight of the composition.
[1007] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0058977% w/w of the total weight of the composition.
[1008] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0064125% w/w of the total weight of the composition.
[1009] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0069889% w/w of the total weight of the composition.
[1010] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.0078005% w/w of the total weight of the composition.
[1011] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvDl is in an amount that is about 0.010863% w/w of the total weight of the composition.
[1012] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1013] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1014] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1015] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1016] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1017] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1018] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1019] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000876731% w/w of the total weight of the composition.
[1020] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1021] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1022] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1023] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001461219% w/w of the total weight of the composition.
[1024] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001461219% w/w of the total weight of the composition. [1025] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1026] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1027] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1028] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1029] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002922438% w/w of the total weight of the composition.
[1030] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002922438% w/w of the total weight of the composition.
[1031] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0004383657% w/w of the total weight of the composition.
[1032] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0005844876% w/w of the total weight of the composition.
[1033] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0005844876% w/w of the total weight of the composition.
[1034] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0007306095% w/w of the total weight of the composition.
[1035] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0008767314% w/w of the total weight of the composition.
[1036] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0075653% w/w of the total weight of the composition.
[1037] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0073782% w/w of the total weight of the composition.
[1038] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.006399% w/w of the total weight of the composition.
[1039] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.004655% w/w of the total weight of the composition.
[1040] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00425187% w/w of the total weight of the composition.
[1041] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0039713% w/w of the total weight of the composition.
[1042] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00358422% w/w of the total weight of the composition.
[1043] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00297768% w/w of the total weight of the composition.
[1044] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00258085% w/w of the total weight of the composition. [1045] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00245732% w/w of the total weight of the composition.
[1046] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0022653% w/w of the total weight of the composition.
[1047] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0020072% w/w of the total weight of the composition.
[1048] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0019232% w/w of the total weight of the composition.
[1049] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0017901 % w/w of the total weight of the composition.
[1050] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0014348% w/w of the total weight of the composition.
[1051] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00029807% w/w of the total weight of the composition.
[1052] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.0002927% w/w of the total weight of the composition.
[1053] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00020057% w/w of the total weight of the composition.
[1054] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00015314% w/w of the total weight of the composition.
[1055] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00013906% w/w of the total weight of the composition.
[1056] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00013513% w/w of the total weight of the composition.
[1057] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.00012342% w/w of the total weight of the composition.
[1058] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.000083406% w/w of the total weight of the composition.
[1059] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the PvD1a is in an amount that is about 0.000055119% w/w of the total weight of the composition.
[1060] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about
[1061] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1062] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1063] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1064] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1065] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1066] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1067] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1068] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1069] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1070] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000876731% w/w of the total weight of the composition.
[1071] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000876731% w/w of the total weight of the composition. [1072] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000876731% w/w of the total weight of the composition.
[1073] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1074] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1075] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1076] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1077] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001461219% w/w of the total weight of the composition.
[1078] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001461219% w/w of the total weight of the composition.
[1079] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001461219% w/w of the total weight of the composition.
[1080] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1081] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1082] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0007306095% w/w of the total weight of the composition.
[1083] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0008767314% w/w of the total weight of the composition.
[1084] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0011689752% w/w of the total weight of the composition.
[1085] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Dm-AMP1a is in an amount that is about 0.0093402% w/w of the total weight of the composition.
[1086] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Dm-AMP1a is in an amount that is about 0.00514% w/w of the total weight of the composition.
[1087] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Dm-AMP1a is in an amount that is about 0.003729% w/w of the total weight of the composition.
[1088] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Dm-AMP1a is in an amount that is about 0.0016777% w/w of the total weight of the composition.
[1089] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Dm-AMP1a is in an amount that is about 0.0006038% w/w of the total weight of the composition.
[1090] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1091] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition. [1092] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1093] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1094] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1095] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Rs-AFP2a is in an amount that is about 0.00017548% w/w of the total weight of the composition.
[1096] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Rs-AFP2a is in an amount that is about 0.00023776% w/w of the total weight of the composition.
[1097] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the Rs-AFP2a is in an amount that is about 0.00031329% w/w of the total weight of the composition.
[1098] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1099] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1100] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1101] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the SPE10a is in an amount that is about 0.00042695% w/w of the total weight of the composition.
[1102] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the SPE10a is in an amount that is about 0.0007287% w/w of the total weight of the composition.
[1103] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the SPE10a is in an amount that is about 0.0010403% w/w of the total weight of the composition.
[1104] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the SPE10a is in an amount that is about 0.0012875% w/w of the total weight of the composition.
[1105] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1106] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1107] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1108] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1109] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0013667% w/w of the total weight of the composition.
[1110] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0013881% w/w of the total weight of the composition.
[1111] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0018618% w/w of the total weight of the composition. [1112] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0019696% w/w of the total weight of the composition.
[1113] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0020021% w/w of the total weight of the composition.
[1114] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0021596% w/w of the total weight of the composition.
[1115] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0027789% w/w of the total weight of the composition.
[1116] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0031472% w/w of the total weight of the composition.
[1117] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.005041% w/w of the total weight of the composition.
[1118] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the So-D2 is in an amount that is about 0.0092686% w/w of the total weight of the composition.
[1119] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1120] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000292244% w/w of the total weight of the composition.
[1121] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1122] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0000584488% w/w of the total weight of the composition.
[1123] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1124] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001168975% w/w of the total weight of the composition.
[1125] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1126] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0001753463% w/w of the total weight of the composition.
[1127] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1128] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) a chelating agent; wherein the chelating agent is in an amount that is about 0.0002337950% w/w of the total weight of the composition.
[1129] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0021463% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1130] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0020078% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1131] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00067121% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1132] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000057139% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1133] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000016287% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1134] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0036323% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1135] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0029214% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1136] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0026119% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1137] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0035342% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1138] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.004048% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1139] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0078005% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1140] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.010863% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition.
[1141] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0069889% w/w, and wherein the EDTA is an amount of about 0.0004383657% w/w of the total weight of the composition.
[1142] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0058977% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition. [1143] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0064125% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition.
[1144] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00055207% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1145] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00088103% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition.
[1146] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00035036% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition.
[1147] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00064032% w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition.
[1148] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00006467% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1149] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00010875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1150] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00013069% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1151] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000094002% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1152] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000076679% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1153] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00425187% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1154] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00297768% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1155] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00358422% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1156] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00258085% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1157] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00245732% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1158] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000055119% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1159] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0022653% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition. [1160] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0019232% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1161] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0014348% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1162] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0020072% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1163] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0017901% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1164] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0073782% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1165] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0075653% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1166] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.006399% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1167] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0039713% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1168] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.004655% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1169] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0002927% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition.
[1170] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00020057% w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition.
[1171] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00029807% w/w, and wherein the EDTA is an amount of about 0.0011689752% w/w of the total weight of the composition.
[1172] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013906% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1173] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00015314% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1174] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00012342% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1175] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013513% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1176] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000083406% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition. [1177] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0093402% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1178] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.00514% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1179] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.003729% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1180] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0016777% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1181] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0006038% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1182] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00031329% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1183] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00023776% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1184] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00017548% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1185] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0012875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1186] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0010403% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1187] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0007287% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1188] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.00042695% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1189] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0021596% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1190] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0019696% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1191] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013881% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1192] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0018618% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1193] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013667% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition. [1194] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0092686% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1195] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.005041% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1196] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0031472% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1197] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0027789% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1198] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises: (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0020021% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1199] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000015% w/w to about 0.012% w/w, and the EDTA is in an amount ranging from about 0.000028% w/w to about 0.0012% w/w of the total weight of the composition.
[1200] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000016287% w/w to about 0.010863% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
[1201] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.00003% w/w to about 0.008% w/w, and the EDTA is in an amount ranging from about 0.000029% w/w to about 0.0012% w/w of the total weight of the composition.
[1202] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.000034157% w/w to about 0.0075653% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
[1203] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00025% w/w to about 0.0095% w/w, and the EDTA is in an amount ranging from about 0.000029% w/w to about 0.0002% w/w of the total weight of the composition.
[1204] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00023018% w/w to about 0.0093402% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1205] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00018% w/w to about 0.0008% w/w, and the EDTA is in an amount ranging from about 0.000029% w/w to about 0.0002% w/w of the total weight of the composition.
[1206] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1207] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.00003% w/w to about 0.0015% w/w, and the EDTA is in an amount ranging from about 0.000029% w/w to about 0.0002% w/w of the total weight of the composition.
[1208] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.000030081% w/w to about 0.0014937% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1209] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.0004% w/w to about 0.0013% w/w, and the EDTA is in an amount ranging from about 0.00006% w/w to about 0.0002% w/w of the total weight of the composition.
[1210] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.00042695% w/w to about 0.0012875% w/w, and the EDTA is in an amount ranging from about 0.0000584488% w/w to about 0.0002337950% w/w of the total weight of the composition. [1211] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013% w/w to about 0.01% w/w, and the EDTA is in an amount ranging from about 0.000029% w/w to about 0.0002% w/w of the total weight of the composition.
[1212] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013667% w/w to about 0.0092686% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1213] In some embodiments, an antimicrobial composition comprises an antimicrobial combination and at least one excipient; wherein the antimicrobial combination comprises :(1) an AMP and (2) a chelating agent, wherein the amount of the AMP in the composition ranges from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21% to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47 % to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51% to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42% ; from about 59 % to about 41%; from about 60% to about 40% ; from about 61 % to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71 % to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77 % to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, and wherein the ratio of AMP:chelating agent in the composition ranges from about 1 : 10 to about 5000: 1 , or from 1 : 10 to about 5000: 1 , about 1 :5 to about 5000: 1 , about 3 : 10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1 :10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1:10 to about 500:1, or from about 1:10 to about 400:1, or from about 1:10 to 300:1, or from about 1:10 to 200:1, or from about 1:10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1 :8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1 :10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1:10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1:10 to about 1:6, from about 1 :10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1 :5, from about 1:10 to about 1:4.75, from about 1:10 to about 1:4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1:10 to about 1 :3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1:10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1, and all values and integers therebetween. In exemplary embodiments, the AMP in the antimicrobial composition as described above can comprise one or more AMPs having an amino acid sequence of any one of SEQ ID NOs: 1-19634, or an agriculturally acceptable salt thereof.
[1214] Agriculturally acceptable salts
[1215] As used herein, the term “pharmaceutically acceptable salt” and “agriculturally acceptable salt” are synonymous, hi some embodiments, pharmaceutically acceptable salts, hydrates, solvates, crystal forms and individual isomers, enantiomers, tautomers, diastereomers and prodrugs of the antimicrobial peptides described herein can be utilized.
[1216] In some embodiments, an agriculturally acceptable salt of the present disclosure possesses the desired pharmacological activity of the parent compound. Such salts include: acid addition salts, formed with inorganic acids; acid addition salts formed with organic acids; or salts formed when an acidic proton present in the parent compound is replaced by a metal ion, e.g., an alkali metal ion, aluminum ion; or coordinates with an organic base such as ethanolamine, and the like.
[1217] In some embodiments, agriculturally acceptable salts include conventional non-toxic salts. For example, in some embodiments, convention non-toxic salts include those such as fumarate, phosphate, citrate, chlorydrate, and the like. In some embodiments, the agriculturally acceptable salts of the present disclosure can be synthesized from a parent compound by conventional chemical methods. In some embodiments, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two. hi some embodiments, non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, the disclosure of which is incorporated herein by reference in its entirety. [1218] In some embodiments, an agriculturally acceptable salt can be one of the following: hydrochloride; sodium; sulfate; acetate; phosphate or diphosphate; chloride; potassium; maleate; calcium; citrate; mesylate; nitrate; tartrate; aluminum; or gluconate.
[1219] In some embodiments, a list of agriculturally acceptable acids that can be used to form salts can be: glycolic acid; hippuric acid; hydrobromic acid; hydrochloric acid; isobutyric acid; lactic acid (DL); lactobionic acid; lauric acid; maleic acid; malic acid (- L); malonic acid; mandelic acid (DL); methanesulfonic acid ; naphthalene- 1,5 -disulfonic acid; naphthalene-2-sulfonic acid; nicotinic acid; nitric acid; oleic acid; oxalic acid; palmitic acid; pamoic acid; phosphoric acid; proprionic acid; pyroglutamic acid (- L); salicylic acid; sebacic acid; stearic acid; succinic acid; sulfuric acid; tartaric acid (+ L); thiocyanic acid; toluenesulfonic acid (p); undecylenic acid; a 1 -hydroxy- 2-naphthoic acid; 2,2-dichloroacetic acid; 2-hydroxyethanesulfonic acid; 2-oxoglutaric acid; 4-acetamidobenzoic acid; 4- aminosalicylic acid; acetic acid; adipic acid; ascorbic acid (L); aspartic acid (L); benzenesulfonic acid; benzoic acid; camphoric acid (+); camphor- 10- sulfonic acid (+); capric acid (decanoic acid); caproic acid (hexanoic acid); caprylic acid (octanoic acid); carbonic acid; cinnamic acid; citric acid; cyclamic acid; dodecylsulfuric acid; ethane- 1 ,2-disulfonic acid; ethanesulfonic acid; formic acid; fumaric acid; galactaric acid; gentisic acid; glucoheptonic acid (D); gluconic acid (D); glucuronic acid (D); glutamic acid; glutaric acid; or glycerophosphoric acid.
[1220] In some embodiments, agriculturally acceptable salt can be any organic or inorganic addition salt.
[1221] In some embodiments, the salt may use an inorganic acid and an organic acid as a free acid. The inorganic acid may be hydrochloric acid, bromic acid, nitric acid, sulfuric acid, perchloric acid, phosphoric acid, etc. The organic acid may be citric acid, acetic acid, lactic acid, maleic acid, fumaric acid, gluconic acid, methane sulfonic acid, gluconic acid, succinic acid, tartaric acid, galacturonic acid, embonic acid, glutamic acid, aspartic acid, oxalic acid, (D) or (L) malic acid, maleic acid, methane sulfonic acid, ethane sulfonic acid, 4- toluene sulfonic acid, salicylic acid, citric acid, benzoic acid, malonic acid, etc.
[1222] In some embodiments, the salts include alkali metal salts (sodium salts, potassium salts, etc.) and alkaline earth metal salts (calcium salts, magnesium salts, etc.). For example, the acid addition salt may include acetate, aspartate, benzoate, besylate, bicarbonate/carbonate, bisulfate/sulfate, borate, camsylate, citrate, edisilate, esylate, formate, fumarate, gluceptate, gluconate, ghicuronate, hexafluorophosphate, hibenzate, hydrochloride/chloride, hydrobromide/bromide, hydroiodide/iodide, isethionate, lactate, malate, maleate, malonate, mesylate, methyl sulfate, naphthalate, 2-napsylate, nicotinate, nitrate, orotate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydrogen phosphate, saccharate, stearate, succinate, tartrate, tosylate, trifluoroacetate, aluminum, arginine, benzathine, calcium, choline, diethylamine, diolamine, glycine, lysine, magnesium, meglumine, olamine, potassium, sodium, tromethamine, zinc salt, etc., and among them, hydrochloride or trifluoroacetate may be used.
[1223] In yet other embodiments, the agriculturally acceptable salt can be a salt with an acid such as acetic acid, propionic acid, butyric acid, formic acid, trifluoroacetic acid, maleic acid, tartaric acid, citric acid, stearic acid, succinic acid, ethylsuccinic acid, lactobionic acid, gluconic acid, glucoheptonic acid, benzoic acid, methanesulfonic acid, ethanesulfonic acid, 2-hydroxyethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, laurylsulfuric acid, malic acid, aspartic acid, glutaminic acid, adipic acid, cysteine, N- acetylcysteine, hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, hydroiodic acid, nicotinic acid, oxalic acid, picric acid, thiocyanic acid, undecanoic acid, polyacrylate or carboxyvinyl polymer.
[1224] In some embodiments, the agriculturally acceptable salt can be prepared from either inorganic or organic bases. Salts derived from inorganic bases include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium, ferrous, zinc, copper, manganous, aluminum, ferric, manganic salts, and the like. Preferred inorganic salts are the ammonium, sodium, potassium, calcium, and magnesium salts. Salts derived from organic bases include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally-occurring substituted amines, and cyclic amines, including isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, 2-dimethylaminoethanol, tromethamine, lysine, arginine, histidine, caffeine, procaine, hydrabamine, choline, betaine, ethylenediamine, glucosamine, N-alkylglucamines, theobromine, purines, piperazine, piperidine, N-ethylpiperidine, and the like. Preferred organic bases are isopropylamine, diethylamine, ethanolamine, piperidine, tromethamine, and choline.
[1225] In some embodiments, agriculturally acceptable salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge, et al. describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 66: 1-19 (1977), the disclosure of which is incorporated herein by reference in its entirety.
[1226] In some embodiments, the salts of the present disclosure can be prepared in situ during the final isolation and purification of the compounds of the disclosure, or separately by reacting the free base function with a suitable organic acid. Examples of agriculturally acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other agriculturally acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3 -phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further agriculturally acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
[1227] Exemplary descriptions of pharmaceutically acceptable salts is provided in P. H. Stahl and C. G. Wermuth, (editors), Handbook of Pharmaceutical Salts: Properties, Selection and Use, John Wiley & Sons, Aug 23, (2002), the disclosure of which is incorporated herein by reference in its entirety.
[1228] METHODS OF USING THE PRESENT DISCLOSURE
[1229] Methods for protecting plants, plant parts, and seeds
[1230] The present disclosure provides methods of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1231] In some embodiments, the present disclosure provides a method for controlling pathogenic microbes, comprising contacting the pathogenic microbes with an antimicrobially-effective amount of the antimicrobial combinations and/or antimicrobial compositions of the present disclosure.
[1232] In some embodiments, the present disclosure provides a method for controlling a pathogenic microbe in agronomic and/or nonagronomic applications, comprising contacting the pathogenic microbe or its environment, a solid surface, including a plant surface or part thereof, with an antimicrobially effective amount of antimicrobial combinations and/or antimicrobial compositions of the present disclosure.
[1233] In some embodiments, to achieve contact with the antimicrobial combinations and/or antimicrobial compositions of the present disclosure, to protect a field crop from microbes, the antimicrobial combinations and/or antimicrobial compositions of the present disclosure is typically applied to the seed of the crop before planting, to the foliage (e.g., leaves, stems, flowers, fruits) of crop plants, or to the soil or other growth medium before or after the crop is planted.
[1234] One embodiment of a method of the present disclosure is to contact microbes with antimicrobial combinations and/or antimicrobial compositions of the present disclosure via spraying. Alternatively, a granular formulation comprising the antimicrobial combinations and/or antimicrobial compositions of the present disclosure, can be applied to the plant foliage or the soil. Antimicrobial combinations and/or antimicrobial compositions of the present disclosure can also be effectively delivered through plant uptake by contacting the plant with the antimicrobial combinations and/or antimicrobial compositions of the present disclosure, applied as a soil drench of a liquid formulation, a granular formulation to the soil, a nursery box treatment or a dip of transplants. Of note is an antimicrobial composition of the present disclosure in the form of a soil drench liquid formulation. Also of note is a method for inhibiting or killing a microbe comprising contacting the microbe or its environment with an antimicrobially-effective amount of an antimicrobial peptide.
[1235] In some illustrative embodiments, the illustrative method contemplates a soil environment, wherein the antimicrobial combinations and/or antimicrobial compositions of the present disclosure is applied to the soil as a soil drench formulation. Other methods of contact include application of an antimicrobial combination and/or antimicrobial composition of the present disclosure by direct and residual sprays, aerial sprays, gels, seed coatings, microencapsulations, systemic uptake, baits, ear tags, boluses, foggers, fumigants, aerosols, dusts and many others. One embodiment of a method of contact is a dimensionally stable fertilizer granule, stick or tablet comprising a combination or composition of the present disclosure.
[1236] In some embodiments, antimicrobial combinations and/or antimicrobial compositions of the present disclosure are also useful in seed treatments for protecting seeds from pathogenic microbes, hi the context of the present disclosure and claims, treating a seed means contacting the seed with an antimicrobially-effective amount of an antimicrobial combination and/or antimicrobial composition of the present disclosure. This seed treatment protects the seed from pathogenic microbes and generally can also protect roots and other plant parts in contact with the soil of the seedling developing from the germinating seed. The seed treatment may also provide protection of foliage by translocation of the wild-type antimicrobial peptide within the developing plant. Seed treatments can be applied to all types of seeds, including those from which plants genetically transformed to express specialized traits will germinate.
[1237] One method of seed treatment is by spraying or dusting the seed with an antimicrobial combination and/or antimicrobial composition of the present disclosure before sowing the seeds. Compositions formulated for seed treatment generally have an antimicrobial peptide, a chelating agent, and a film former or adhesive agent. Therefore, typically, a seed coating composition of the present disclosure consists of an antimicrobially- effective amount of an antimicrobial peptide, and a film former or adhesive agent. Seeds can be coated by spraying a flowable suspension concentrate directly into a tumbling bed of seeds and then drying the seeds. Alternatively, other composition types such as wetted powders, solutions, suspoemulsions, emulsifiable concentrates and emulsions in water can be sprayed on the seed. This process is particularly useful for applying film coatings on seeds. Various coating machines and processes are available to one skilled in the art. Suitable processes include those fisted in P. Kosters et al., Seed Treatment: Progress and Prospects, 1994 BCPC Monograph No. 57, and references listed therein, the disclosures of which are incorporated herein by reference in their entireties.
[1238] The treated seed typically comprises an antimicrobial peptide and a chelating agent in an amount ranging from about 0.01 g to 1 kg per 100 kg of seed (i.e. from about 0.00001 to 1 % by weight of the seed before treatment). A flowable suspension formulated for seed treatment typically comprises from about 0.5 to about 70% of the active ingredient, from about 0.5 to about 30% of a film-forming adhesive, from about 0.5 to about 20% of a dispersing agent, from 0 to about 5% of a thickener, from 0 to about 5% of a pigment and/or dye, from 0 to about 2% of an antifoaming agent, from 0 to about 1% of a preservative, and from 0 to about 75% of a volatile liquid diluent.
[1239] Methods of using the antimicrobial compositions and combinations
[1240] In some embodiments, the present disclosure provides a method of using an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to inhibit growth of a microbe; wherein said method comprises, preparing the combination and then applying said combination to the microbe or its environment.
[1241] In some embodiments, the present disclosure provides a method of using an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to combat, control, inhibit, or kill pathogenic microbes (e.g., plant pathogenic microbes).
[1242] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1243] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1244] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe.
[1245] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe.
[1246] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide or a wildtype defensin.
[1247] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628.
[1248] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide.
[1249] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
[1250] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type NCR13 peptide amino acid sequences set forth in any one of SEQ ID NOs: 1 or 14.
[1251] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type NCR13 peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild- type NCR 13 peptide amino acid sequences set forth in any one of SEQ ID NO: 1.
[1252] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is a metal-ion chelating agent.
[1253] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an AU3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[1254] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (α,α',α",α ")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2,3,-dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N, N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,11- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [1255] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the chelating agent is EDTA.
[1256] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is any deleterious microbe as described herein.
[1257] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Alternaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
[1258] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia or Botrytis.
[1259] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide has an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-19628; and wherein the microbe is a Monilinia fructicola or a Botrytis cinerea.
[1260] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising, consisting essentially of, or consisting of, WT-NCR13, comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least
90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least
94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least
98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least
99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or an EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising, consisting essentially of, or consisting of, WT-NCR13 comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or an EDTA derived salt thereof, for example EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1261] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a WT-NCR13 comprising an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of the wild-type NCR13 peptide amino acid sequence set forth in SEQ ID NO: 1 , or an agriculturally acceptable salt thereof; EDTA; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition; and wherein the microbe is Monilinia fructicola or a Botrytis cinerea.
[1262] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially-effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type antimicrobial peptide consists of an amino acid sequence as set forth in any one of SEQ ID NOs: 1-19628.
[1263] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide.
[1264] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide having an amino acid sequence consisting of any one of SEQ ID NOs: 1-32.
[1265] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type NCR13 peptide consists of an amino acid sequence as set forth in any one of SEQ ID NOs: 1 or 14.
[1266] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type NCR13 peptide is a wild-type NCR13, or an agriculturally acceptable salt thereof.
[1267] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the wild-type NCR13 peptide consists of an amino acid sequence as set forth in SEQ ID NO: 1.
[1268] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the chelating agent is a metal-ion chelating agent.
[1269] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2"1" chelating agent; or a Zn2+ chelating agent.
[1270] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3 -(4-ethoxyphenyl)propyl)]-N- [2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [1271] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the chelating agent is EDTA.
[1272] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is any deleterious microbe as described herein.
[1273] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
[1274] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia or Botrytis.
[1275] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a Monilinia fructicola or a Botrytis cinerea.
[1276] Any of the methods described herein can be practiced using any of the wildtype antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in SEQ ID NOs: 1-19628), any of the chelating agents described herein (e.g., EDTA), and any of the excipients described herein.
[1277] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising, consisting essentially of, or consisting of, WT-NCR13, consisting of an amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or an EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially- effective amount of an antimicrobial composition comprising, consisting essentially of, or consisting of, WT-NCR13 consisting of an amino acid sequence of SEQ ID NO: 1, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is EDTA, or an EDTA derived salt thereof, for example EDTA derived salt thereof, for example, disodium EDTA, sodium calcium edetate and tetrasodium EDTA; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1278] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of the combination of (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent, and an excipient, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1279] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of the combination of (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent, and an excipient, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, Puccinia, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, or Didymella.
[1280] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of the combination of (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent, and an excipient, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe from the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
[1281] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of the combination of (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent, and an excipient, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe belonging to the genera: Monilinia or Botrytis.
[1282] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of the combination of (1) a wild- type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) a composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, a chelating agent, and an excipient, to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a Monilinia fructicola or a Botrytis cinerea.
[1283] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe, said method comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: a WT-NCR13 consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition; and wherein the microbe is Monilinia fructicola or a Botrytis cinerea.
[1284] In some embodiments, a method of the present disclosure comprises using an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising: an antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to inhibit growth of a microbe; wherein said method comprises, preparing the combination and then applying said combination to the microbe or its environment. For example, in some embodiments,
[1285] In some embodiments, a method of the present disclosure comprises using an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising an antimicrobial combination of an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to inhibit growth of a microbe; wherein said method comprises, preparing the combination and then applying said combination to the microbe or its environment.
[1286] In some embodiments, the present disclosure provides a method of using an antimicrobially-effective amount of: (1) an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising an antimicrobial combination of an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to combat, control, inhibit, or kill pathogenic microbes (e.g., plant pathogenic microbes).
[1287] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs- AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1288] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs- AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1289] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe.
[1290] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially- effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the pathogenic microbe.
[1291] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1292] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; anNa+ chelating agent; anNi2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[1293] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (D03A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPD03A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N"', N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1, 4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof. [1294] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the chelating agent is EDTA.
[1295] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is any deleterious microbe as described herein.
[1296] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially- effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, Aspergillus, or Puccinia.
[1297] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Phytophthora, Cercospora, or Aspergillus.
[1298] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: (1) applying an antimicrobially-effective amount of an antimicrobial combination comprising an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and a chelating agent; the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; or (2) applying an antimicrobially-effective amount of an antimicrobial composition comprising: an antimicrobial peptide selected from: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the microbe is a microbe belonging to the genera: Monilinia fructicola, Botrytis cinerea, Fusarium graminearum, Phytophthora inf estans, Cercospora sojina, or Aspergillus nig er.
[1299] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1300] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1301] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1302] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe. [1303] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1304] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1305] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1306] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1307] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1308] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1309] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1310] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1311] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1312] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1313] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1314] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1315] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1316] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1317] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1318] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1319] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1320] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1321] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1322] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe. [1323] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1324] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1325] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1326] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1327] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1328] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1329] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1330] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1331] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1332] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1333] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1334] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1335] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1336] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1337] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1338] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1339] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1340] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1341] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1342] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe. [1343] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1344] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1345] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1346] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1347] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1348] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1349] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1350] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1351] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1352] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1353] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1354] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1355] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1356] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1357] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1358] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1359] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1360] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1361] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1362] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe. [1363] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1364] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1365] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1366] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1367] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1368] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial combination comprising (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1369] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0021463% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1370] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0020078% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1371] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00067121 % w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1372] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000057139% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1373] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000016287% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1374] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0036323% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1375] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0029214% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1376] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0026119% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1377] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0035342% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition. [1378] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.004048% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1379] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0078005% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1380] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.010863% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition.
[1381] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0069889% w/w, and wherein the EDTA is an amount of about 0.0004383657% w/w of the total weight of the composition.
[1382] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0058977% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition.
[1383] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0064125% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition.
[1384] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00055207 % w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1385] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00088103% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition.
[1386] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00035036% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition.
[1387] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00064032% w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition.
[1388] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00006467 % w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1389] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00010875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1390] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00013069% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1391] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000094002% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1392] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000076679% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1393] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00425187% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1394] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00297768% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition. [1395] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00358422% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1396] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00258085% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1397] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00245732% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1398] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000055119% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1399] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0022653% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1400] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0019232% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1401] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0014348% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1402] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0020072% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1403] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0017901% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1404] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0073782% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1405] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0075653% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1406] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.006399% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition.
[1407] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0039713% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1408] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.004655% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition.
[1409] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0002927% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition.
[1410] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00020057 % w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition.
[1411] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00029807 % w/w, and wherein the EDTA is an amount of about 0.0011689752% w/w of the total weight of the composition. [1412] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013906% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1413] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00015314% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1414] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00012342% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1415] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013513% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1416] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000083406% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1417] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0093402% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1418] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.00514% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1419] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.003729% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1420] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0016777% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1421] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0006038% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1422] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00031329% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1423] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00023776% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1424] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00017548% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1425] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0012875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1426] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0010403% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1427] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0007287% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1428] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.00042695% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition. [1429] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0021596% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1430] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0019696% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1431] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013881% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1432] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0018618% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1433] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013667% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1434] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0092686% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition.
[1435] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.005041% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition.
[1436] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0031472% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition.
[1437] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0027789% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition.
[1438] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0020021% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition.
[1439] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0021463% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1440] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0020078% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1441] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00067121 % w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1442] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000057139% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Monilinia fructicola.
[1443] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000016287% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Monilinia fructicola.
[1444] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0036323% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1445] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0029214% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1446] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0026119% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1447] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0035342% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1448] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.004048% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans. [1449] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0078005% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1450] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.010863% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1451] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0069889% w/w, and wherein the EDTA is an amount of about 0.0004383657% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1452] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0058977% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1453] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.0064125% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1454] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00055207 % w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminear um.
[1455] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00088103% w/w, and wherein the EDTA is an amount of about 0.0002922438% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminear um.
[1456] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00035036% w/w, and wherein the EDTA is an amount of about 0.0005844876% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminear urn.
[1457] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00064032% w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition; and wherein the microbe is Fusarium grammearum.
[1458] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00006467 % w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1459] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00010875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1460] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.00013069% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1461] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000094002% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1462] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvDl or the agriculturally acceptable salt thereof is in an amount of about 0.000076679% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1463] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00425187% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea. [1464] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00297768% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1465] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00358422% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1466] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00258085% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1467] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00245732% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1468] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000055119% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Monilinia fructicola.
[1469] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0022653% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1470] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0019232% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1471] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0014348% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1472] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0020072% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1473] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0017901% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition; and wherein the microbe is Phytophthora infestans.
[1474] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0073782% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1475] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0075653% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1476] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.006399% w/w, and wherein the EDTA is an amount of about 0.0000876731% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1477] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0039713% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina.
[1478] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.004655% w/w, and wherein the EDTA is an amount of about 0.0001461219% w/w of the total weight of the composition; and wherein the microbe is Cercospora sojina. [1479] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.0002927% w/w, and wherein the EDTA is an amount of about 0.0007306095% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminearum.
[1480] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00020057 % w/w, and wherein the EDTA is an amount of about 0.0008767314% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminearum.
[1481] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00029807 % w/w, and wherein the EDTA is an amount of about 0.0011689752% w/w of the total weight of the composition; and wherein the microbe is Fusarium graminearum.
[1482] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013906% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1483] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00015314% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1484] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00012342% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1485] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.00013513% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1486] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the PvD1a or the agriculturally acceptable salt thereof is in an amount of about 0.000083406% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1487] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0093402% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1488] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.00514% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1489] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.003729% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1490] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0016777% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1491] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Dm-AMP1a or the agriculturally acceptable salt thereof is in an amount of about 0.0006038% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1492] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00031329% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1493] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00023776% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger. [1494] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFPla (SEQ ID NO: 19632), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the Rs-AFPla or the agriculturally acceptable salt thereof is in an amount of about 0.00017548% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1495] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0012875% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1496] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0010403% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1497] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.0007287% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1498] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the SPE10a or the agriculturally acceptable salt thereof is in an amount of about 0.00042695% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1499] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0021596% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1500] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0019696% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1501] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013881% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1502] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0018618% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1503] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0013667% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Botrytis cinerea.
[1504] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0092686% w/w, and wherein the EDTA is an amount of about 0.0000292244% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1505] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.005041% w/w, and wherein the EDTA is an amount of about 0.0000584488% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1506] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0031472% w/w, and wherein the EDTA is an amount of about 0.0001168975% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1507] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0027789% w/w, and wherein the EDTA is an amount of about 0.0001753463% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1508] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of an antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634), or an agriculturally acceptable salt thereof; and (2) EDTA; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe; wherein the So-D2 or the agriculturally acceptable salt thereof is in an amount of about 0.0020021% w/w, and wherein the EDTA is an amount of about 0.0002337950% w/w of the total weight of the composition; and wherein the microbe is Aspergillus niger.
[1509] PATHOGENIC MICROBES [1510] “Pathogenic microbe” refers to any microbe that is deleterious or pathogenic to an organism; e.g., any microbe that causes or exacerbates an infection or disease in a living organism. For example, in some embodiments, a pathogenic microbe of the present disclosure can be a pathogen to plants, e.g., a phytopathogen, such as a bacterium, a protozoan, or a fungus; in other embodiments, a pathogenic microbe can be a pathogen to animals. As used herein, a “plant pathogenic microbe” or “plant pathogen” can refer to a microbe that can cause disease into whole plants, plant tissues, plant organs (e.g., leaves, stems, roots, etc.), seeds, plant cells, propagules, embryos and progeny of the same. Plant cells can be differentiated or undifferentiated (e.g. callus, suspension culture cells, protoplasts, leaf cells, root cells, phloem cells, and pollen).
[1511] In some embodiments, the present disclosure provides a method for combating, controlling, or inhibiting microbes, e.g., pathogenic microbes.
[1512] In some embodiments, the present disclosure provides a method for combating, controlling, or inhibiting microbes, e.g., pathogenic microbes, wherein the pathogenic microbe is a Fusarium sp., Altemaria sp., Verticillium sp., Phytophthora sp., Colletotrichum sp., Botrytis sp., Cercospora sp., Phakopsora sp. Rhizoctonia sp., Sclerotinia sp., Pythium sp., Phoma sp., Gaeumannomces sp. Leptoshaeria sp., Puccinia sp., Ascochyta sp., Diplodia sp., Erysiphe sp., Gaeumanomyces sp., Helminthosporium sp., Macrophomina sp., Nectria sp., Peronospora sp., Phymatotrichum sp., Plasmopara sp., Podosphaera sp., Pyrenophora sp., Pyricularia sp., Scerotium sp., Septaria sp., Thielaviopsis sp., Uncinula sp., or Venturia sp.
[1513] In some embodiments, the pathogenic microbe is a pathogenic fungus. In some embodiments, the pathogenic fungus is a dermatophyte. In some embodiments, the dermatophyte is selected from the group consisting of Trichophyton ruhrum, Trichophyton interdigitale, Trichophyton violaceum, Trichophyton tonsurans, Trichophyton soudanense, Trichophyton mentagrophytes, Microsporumflavum, Epidermophyton floccosum, and Microsporum gypseum.
[1514] In some embodiments, the pathogenic microbe is an organism belonging to the Aspergillus, Cryptococcus, Penicillium, Rhizopus, Apophysomyces, Cunninghamella, Saksenaea, Rhizomucor, Syncephalostrum, Cokeromyces, Actinomucor, Pythium, Fusarium, Histoplasmosis, or Blastomyces genus.
[1515] In some embodiments, the pathogenic microbe is derived from organisms belonging to Candida genus, hi some embodiments, the pathogenic microbes derived from the Candida genus are from the species Candida albicans, C. glabrata, C parasilosis, C. tropicalis, or C. krusei.
[1516] In some embodiments, a pathogenic microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, Puccinia, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, or Didymella.
[1517] Any of the pathogenic microbes described herein can combatted, controlled, or inhibited using any of the wild-type antimicrobial peptides described herein (e.g., a wild-type antimicrobial peptide consisting of an amino acid sequence set forth in SEQ ID NOs: - 19628), any of the chelating agents described herein (e.g., EDTA), and any of the excipients described herein.
[1518] Illustrative embodiments
[1519] In some embodiments, the present disclosure provides an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent.
[1520] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide is a wild-type NCR 1 peptide (NCR01), a wild-type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wildtype NCR 4 peptide (NCR04), a wild-type NCR 5 peptide (NCR05), a wild-type NCR 6 peptide (NCR06), a wild-type NCR 7 peptide (NCR07), a wild-type NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide (NCR11), a wild-type NCR 12 peptide (NCR12), a wild-type NCR 13 peptide (NCR13), a wild-type NCR 14 peptide (NCR14), or a wild-type NCR 15 peptide (NCR15), or a wild-type agriculturally acceptable salt thereof.
[1521] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1- 32.
[1522] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide is a wild-type NCR13, or an agriculturally acceptable salt thereof.
[1523] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least
92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least
96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least
99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1.
[1524] In some embodiments, an antimicrobial combination of the present disclosure comprises a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; wherein the wild-type antimicrobial peptide is consists of an amino acid sequence as set forth in SEQ ID NO: 1 .
[1525] In some embodiments, the present disclosure provides an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
[1526] In some embodiments, the present disclosure provides an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[1527] In some embodiments, the present disclosure provides an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a metal-ion chelating agent, wherein the metal-ion chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof.
[1528] In some embodiments, the present disclosure provides an antimicrobial combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a metal ion chelating agent, wherein the metal-ion chelating agent is EDTA.
[1529] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient.
[1530] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type defensin peptide or a wild-type NCR peptide.
[1531] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR peptide.
[1532] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR 1 peptide (NCR01), a wild-type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wild-type NCR 4 peptide (NCR04), a wild-type NCR 5 peptide (NCR05), a wildtype NCR 6 peptide (NCR06), a wild-type NCR 7 peptide (NCR07), a wild-type NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide (NCR11), a wild-type NCR 12 peptide (NCR12), a wild-type NCR 13 peptide (NCR13), a wild-type NCR 14 peptide (NCR14), or a wild-type NCR 15 peptide (NCR15), or a wild-type agriculturally acceptable salt thereof.
[1533] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least
99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
[1534] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide is a wild-type NCR13, or an agriculturally acceptable salt thereof.
[1535] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide comprises an amino acid sequence that is at least 85% identical, at least 86% identical, at least 87% identical, at least 88% identical, at least 89% identical, at least 90% identical, at least 91% identical, at least 92% identical, at least 93% identical, at least 94% identical, at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical, at least 99.5% identical, at least 99.6% identical, at least 99.7% identical, at least 99.8% identical, at least 99.9% identical, or 100% identical to the full-length amino acid sequence of any of the wild-type antimicrobial peptide amino acid sequences set forth in any one of SEQ ID NO: 1.
[1536] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide consists of an amino acid sequence as set forth in any one of SEQ ID NOs: 1-32.
[1537] In some embodiments, an antimicrobial composition of the present disclosure comprises: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; wherein the wild-type antimicrobial peptide consists of an amino acid sequence as set forth in SEQ ID NO: 1.
[1538] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is a metal-ion chelating agent.
[1539] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a metal-ion chelating agent; and an excipient, wherein the metal- ion chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[1540] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a metal-ion chelating agent; and an excipient, wherein the metal- ion chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N, N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof.
[1541] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a metal-ion chelating agent; and an excipient, wherein the metal- ion chelating agent is EDTA.
[1542] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000001% w/w to about 99.99999% w/w, of the total weight of the composition.
[1543] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000010% w/w to about 0.00500% w/w, of the total weight of the composition. [1544] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, of the total weight of the composition.
[1545] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.000017% w/w of the total weight of the composition.
[1546] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.00004% w/w of the total weight of the composition.
[1547] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.000024% w/w of the total weight of the composition.
[1548] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.000056% w/w of the total weight of the composition.
[1549] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.00077% w/w of the total weight of the composition.
[1550] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the wild-type antimicrobial peptide is in an amount that is about 0.00399% w/w of the total weight of the composition.
[1551] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount ranging from about 0.000070% w/w to about 0.000400% w/w, of the total weight of the composition. [1552] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
[1553] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount that is about 0.000088% w/w of the total weight of the composition.
[1554] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount that is about 0.000146% w/w of the total weight of the composition.
[1555] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount that is about 0.000205% w/w of the total weight of the composition.
[1556] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient, wherein the chelating agent is EDTA, and wherein the EDTA is in an amount that is about 0.000292% w/w of the total weight of the composition.
[1557] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of (1) a combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe.
[1558] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of (1) a combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, Puccinia, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, or Didymella.
[1559] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of (1) a combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, Didymella, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
[1560] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of (1) a combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a microbe belonging to the genera: Monilinia or Botrytis.
[1561] In some embodiments, the present disclosure provides a method of combating, controlling, or inhibiting a microbe comprising: applying an antimicrobially-effective amount of (1) a combination comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof, and a chelating agent; and/or (2) an antimicrobial composition comprising a wild-type antimicrobial peptide, or an agriculturally acceptable salt thereof; a chelating agent; and an excipient; to the locus of the microbe, or to a plant or animal susceptible to an attack by the microbe, wherein the microbe is a Monilinia fructicola or a Botrytis cinerea.
[1562] In some embodiments, the present disclosure provides an antimicrobial composition comprising: a wild-type nodule-specific cysteine-rich 13 peptide (NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
[1563] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
[1564] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide.
[1565] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, or a wildtype defensin.
[1566] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, wherein the wild-type NCR peptide is a wild- type NCR 1 peptide (NCR01), a wild- type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wild-type NCR 4 peptide (NCR04), a wildtype NCR 5 peptide (NCR05), a wild-type NCR 6 peptide (NCR06), a wild-type NCR 7 peptide (NCR07), a wild-type NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide (NCR11), a wild-type NCR 12 peptide (NCR12), a wild-type NCR 13 peptide (NCR13), a wild-type NCR 14 peptide (NCR14), or a wild-type NCR 15 peptide (NCR15), or a wild-type agriculturally acceptable salt thereof.
[1567] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 90% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
[1568] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, wherein the wild-type NCR peptide is a wild-type NCR13, or an agriculturally acceptable salt thereof.
[1569] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a wild-type antimicrobial peptide, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, wherein the wild-type NCR peptide is a wild-type NCR13, or an agriculturally acceptable salt thereof, wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 90% identical to the full-length amino acid sequence of the wild- type NCR 13 peptide amino acid sequence as set forth in SEQ ID NO: 1 .
[1570] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a defensin.
[1571] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a plant defensin.
[1572] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a plant defensin comprising a cysteine-stabilized (CS) αβ motif.
[1573] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a plant defensin comprising 3 or 4 disulfide bonds. [1574] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP comprises a first disulfide bond, a second disulfide bond, a third disulfide bond, and a fourth disulfide bond; wherein each of the first, second, third, and fourth disulfide bonds forms between a pair of cysteine residues selected from: C1-C8, C2- C5, C3-C6, and C4-C7; wherein Cl, C2, C3, C4, C5, C6, C7, and C8 are cysteine residues operable to form a disulfide bond, and which correspond to a first, second, third, fourth, fifth, sixth, seventh, and eighth cysteine residue, respectively, as arranged in the N-terminus to C- terminus orientation of an amino acid sequence of the AMP; wherein one or more accessory cysteine residues are optionally present in the amino acid sequence of the AMP; and wherein the one or more accessory cysteine residues do not form a disulfide bond.
[1575] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP comprises a first disulfide bond, a second disulfide bond, a third disulfide bond, and a fourth disulfide bond; wherein each of the first, second, third, and fourth disulfide bonds forms between a pair of cysteine residues selected from: C1-C8, C2- C5, C3-C6, and C4-C7; wherein Cl, C2, C3, C4, C5, C6, C7, and C8 are cysteine residues operable to form a disulfide bond, and which correspond to a first, second, third, fourth, fifth, sixth, seventh, and eighth cysteine residue, respectively, as arranged in the N-terminus to C- terminus orientation of an amino acid sequence of the AMP; wherein one or more accessory cysteine residues are optionally present in the amino acid sequence of the AMP; and wherein the one or more accessory cysteine residues do not form a disulfide bond, wherein the AMP has a disulfide bond that forms between the first cysteine residue in the linear amino acid sequence, and the last cysteine residue in the linear amino acid sequence.
[1576] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP has a gamma core motif.
[1577] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP comprises: (1) a cysteine-stabilized (CS) αβ motif; (2) a first disulfide bond, a second disulfide bond, a third disulfide bond, and a fourth disulfide bond; wherein each of the first, second, third, and fourth disulfide bonds forms between a pair of cysteine residues selected from: C1-C8, C2-C5, C3-C6, and C4-C7; wherein Cl, C2, C3, C4, C5, C6, C7, and C8 are cysteine residues operable to form a disulfide bond, and which correspond to a first, second, third, fourth, fifth, sixth, seventh, and eighth cysteine residue, respectively, as arranged in the N-terminus to C-terminus orientation of an amino acid sequence of the AMP; wherein one or more accessory cysteine residues are optionally present in the amino acid sequence of the AMP; and wherein the one or more accessory cysteine residues do not form a disulfide bond; and (3) a gamma core motif.
[1578] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is a defensin selected from any one of: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[1579] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the AMP is: a wild-type NCR13 peptide (SEQ ID NO: 1); PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
[1580] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, as described in any of the foregoing paragraphs, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent.
[1581] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent, and wherein the metal-ion chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; a Ba2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a In3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
[1582] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent, and wherein the metal-ion chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine-N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2- hydroxypropan- 1,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo- DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2-[(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(methylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N, N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-D02A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof.
[1583] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the chelating agent is a metal-ion chelating agent, and wherein the metal-ion chelating agent is EDTA.
[1584] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the ratio of AMP:chelating agent ranges from about 1:10 to about 5000:1.
[1585] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the ratio of AMP:chelating agent ranges from about 1:10 to about 3000:1.
[1586] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the ratio of AMP:chelating agent ranges from about 1:10 to about 1000:1.
[1587] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the ratio of AMP:chelating agent ranges from about 1:10 to about 330:1. [1588] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial combination is formulated in separate compositions.
[1589] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial combination is formulated in separate compositions, and wherein the separate compositions are formulated as powders, dusts, pellets, granules, sprays, emulsions, colloids, solutions, or combinations thereof.
[1590] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial combination is formulated in separate compositions, and wherein the separate compositions are formulated using the same excipients or different excipients.
[1591] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial combination is formulated in a single composition.
[1592] In some embodiments, an antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent, wherein the antimicrobial combination is formulated in a single composition, and wherein the single composition is formulated as a powder, a dust, a pellet, a granule, a spray, an emulsion, a colloid, a solution, or combinations thereof.
[1593] In some embodiments, an antimicrobial composition comprise an antimicrobial combination and an excipient, wherein the antimicrobial combination comprises an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
[1594] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of the antimicrobial combination of any one of claims 1-30, or the antimicrobial composition of claim 31, to: the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or any combination thereof. [1595] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of the antimicrobial combination of any one of claims 1-30, or the antimicrobial composition of claim 31, to: the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or any combination thereof, wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, Didymella, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
[1596] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of the antimicrobial combination of any one of claims 1-30, or the antimicrobial composition of claim 31, to: the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or any combination thereof, wherein the microbe is a microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Phytophthora, Cercospora, or Aspergillus.
[1597] In some embodiments, a method of combating, controlling, or inhibiting a microbe comprises: applying an antimicrobially-effective amount of the antimicrobial combination of any one of claims 1-30, or the antimicrobial composition of claim 31, to: the microbe, a locus of the microbe, a food supply of the microbe, a habitat of the microbe, or a breeding ground of the microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the microbe; or any combination thereof, wherein the microbe is Monilinia fructicola, Botrytis cinerea, Fusarium graminearum, Phytophthora infestans, Cercospora sojina, or Aspergillus niger.
[1598] In some embodiments, an antimicrobial composition comprises: a wild-type nodule-specific cysteine-rich 13 peptide (WT-NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
[1599] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000016287% w/w to about 0.010863% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
[1600] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.000034157% w/w to about 0.0075653% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
[1601] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00023018% w/w to about 0.0093402% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1602] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
[1603] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.000030081% w/w to about 0.0014937% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition. [1604] In some embodiments, an antimicrobial composition comprises: an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013667% w/w to about 0.0092686% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
EXAMPLES
[1605] Example 1. Overview of antimicrobial combination bioassay against fungal species
[1606] The effect of an antimicrobial combination comprising a wild-type antimicrobial peptide and a chelating agent was evaluated using a wild-type NCR peptide (NCR13) and the chelating agent, EDTA. The effect of the combination of WT-NCR13 and EDTA on microbe growth was evaluated to determine if the inclusion of EDTA could lower the amount of WT-NCR13 required to reach IC50. The microbes evaluated were the fungal species, Kluyveromyces lactis, Monilinia fructicola, and Botrytis cinereca. their growth was assessed via OD600nm after incubation with WT-NCR13, EDTA, or combinations thereof, at varying concentrations, and at 30°C for 48 hours (K. lactis) or room temperature for 72 hours (M. fructicola, and B. cinerea).
[1607] Materials were as follows: Pure WT-NCR13 (Bachem Americas, Inc.; 3132 Kashiwa Street, Torrance, CA 90505, USA; synthetic native NCR13, Catalog No. 4151056, batch T210805) (SEQ ID NO: 1); and EDTA (ThermoFisher, Catalog No. E478-500): 2x serial dilution doses (50 mM to 4 μM) from 0.5M sterile solution. The amino acid sequence of WT-NCR13 is as follows: TKPCQSDKDCKKFACRKPKVPKCINGFCKCVR (SEQ ID NO: 1).
[1608] Fungal strains were prepared as follows:
[1609] Kluyveromyces lactis'. in exponential growth phase, OD600 = 3.44.
[1610] Monilinia fructicola'. fresh spore suspension, 8.5 x 106 CFU/mL
[1611] Botrytis cinerea'. freshly spore suspension, 1.37 x 107 CFU/mL
[1612] The anti-fungal bioassay setup was prepared in a sterile 96-well clear plate: serial dilutions of combinations were loaded into the plate at 100 μL per well; next, 5 μL of either K. lactis, M. fructicola, orB. cinerea, were added at a cell suspension to OD=0.001, or spore final density at 3x 10+ CFU/mL in bioassay. [1613] The bioassay 96-well plate was incubated at room temperature (anti- M. fructicola, and B. cinerea) for 72 hours; and 30°C incubator (anti- K. lactis) for 48 hours, without shaking. The OD600 of the culture plate was determined using SpectraMax plate reader. A dose-response study for EDTA alone was performed in order to determine the baseline effect of EDTA on fungal growth. To determine inhibition percentage, the EDTA dose-response data was fitted with the Hill Equation curve, thus providing a specific Hill equation for each of the dose-response assay. Relative OD600 was determined by normalizing cell growth to control wells containing neither EDTA nor WT-NCR13.
[1614] The reagent doses evaluated for K. lactis, M. fructicola, and B. cinerea, combined with EDTA, are described in detail below.
[1615] Example 2. Anti- A. lactis - NCR13 and EDTA
[1616] K. lactis growth was assessed after 48 hour incubation at 30°C in low salt medium (LSM). The reagent dose concentrations evaluated are presented in the table below.
[1617] Table 3. Antifungal bioassay array. K. lactis treated with WT-NCR13, EDTA or a combination thereof. “LSM” = low-salt medium. Rows A-D show the doses evaluated for each dose response curve: A = NCR13 (ppm) B = EDTA (μM); C = NCR13 (ppm) with 7 μM EDTA; D = NCR13 (ppm) with 10 μM EDTA.
Figure imgf000389_0001
[1618] Combinations of WT-NCR13 and EDTA were evaluated, with EDTA at a concentration of 0, 7 and 10 μM. A summary of the reagents tested is shown below. Here, the amount shown below is the amount required to achieve IC50 in K. lactis cells:
[1619] (1) NCR13 only = 304 ppm (FIG. 1).
[1620] (2) EDTA only = 26 μM (7.6 ppm) (FIG. 2).
[1621] (3) EDTA = 7 μM (1.6% inhibition by EDTA); WT-NCR13 = 39.9 ppm.
[1622] (4) EDTA = 10 μM (4.7% inhibition by EDTA); WT-NCR13 = 7.7 ppm. [1623] FIGs. 1-2 show the results of the bioassay evaluating NCR13 or EDTA in K. lactis. FIG. 1 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with NCR13 after 48 hours. Here, the amount of WT-NCR13 required to achieve IC50 in K. lactis cells was 304 ppm. FIG. 2 depicts a graph showing the growth of K. lactis as measured via relative OD600 (%), when treated with EDTA after 48 hours. Here, the amount of EDTA required to achieve IC50 in K. lactis cells was 26 μM.
[1624] Dose response curves were created to generate an isobologram showing the effect of combinations of WT-NCR13 and EDTA against K. lactis. The individual IC50 values for each of WT-NCR13 and EDTA dose-response curve were determined and used to establish the baseline (diagonal line) in the isobologram. FIGs. 1-2. The points (dose combinations) shown in the isobologram are based on the IC50 values from the combination dose-response curves. FIGs. 3-4. As shown in the isobologram of FIG. 5, synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
[1625] The results presented as the isobologram depict the effect of combinations of WT-NCR13 and EDTA on K. lactis (YCT306) growth. FIG. 5. Here, when using 7 μM of EDTA, the amount of WT-NCR13 required to achieve IC50 in K. lactis cells was 39.9 ppm (with 1.6% inhibition of growth attributed to EDTA). Using 10 μM of EDTA, the amount of WT-NCR13 required to achieve IC50 in K. lactis was 7.7 ppm (with 4.7% inhibition of growth attributed to EDTA). Accordingly, these results suggest a synergistic effect of combinations of WT-NCR13 and EDTA when used against K. lactis.
[1626] Example 3. Anti-AM. fructicola -NCR13 and EDTA
[1627] M. fructicola growth was assessed after 72 hour incubation at room temperature with WT-NCR13 and EDTA, cultured in synthetic fungal medium (SFM). The reagent dose concentrations evaluated are presented in the table below.
[1628] Table 4. Antifungal bioassay array. M. fructicola treated with WT-NCR13, EDTA, or a combination thereof. Rows A-D show the doses evaluated for each dose response curve: A = WT-NCR13 (amounts shown in ppm); B = EDTA (amounts shown in μM); C = WT-NCR13 with 3 μM EDTA; D = WT-NCR13 with 5 μM EDTA (note: rows C and D show amounts of WT-NCR13 in ppm).
Figure imgf000390_0001
Figure imgf000391_0001
[1629] Combinations of WT-NCR13 and EDTA were evaluated at concentrations of EDTA of 0, 3, and 5 μM. A summary of the combinations tested is shown below. Here, the amount shown below is the amount required to achieve IC50 in M.fructicola cells:
[1630] (1) WT-NCR13 (no EDTA) = 2.24 ppm.
[1631] (2) EDTA only = 6.53 μM (1.9 ppm).
[1632] (3) EDTA = 3 μM (28.2% inhibition by EDTA); WT-NCR13 = 0.4 ppm
[1633] (4) EDTA = 5 μM (43.2% inhibition by EDTA); WT-NCR13 = 0.24 ppm
[1634] As shown in FIG. 6, which shows the growth of M.fructicola as measured via relative OD600 (%), when M.fructicola is treated with WT-NCR13 for 72 hours at room temperature, the amount of WT-NCR13 required to achieve IC50 in M. fructicola cells was 2.24 ppm.
[1635] FIG. 7 depicts a graph showing the growth of M.fructicola as measured via relative OD600 (%), when treated with EDTA for 72 hours at room temperature. Here, the amount of EDTA required to achieve IC50 in M. fructicola cells was 6.53 μM.
[1636] Dose response curves were created to generate an isobologram showing the effect of combinations of WT-NCR13 and EDTA against M.fructicola. The individual IC50 values for each of WT-NCR13 and EDTA were determined and used to establish the baseline (diagonal line) in the isobologram. FIGs. 6-7. The points (dose combinations) shown in the isobologram are based on the IC50 values from the combination dose-response curves. FIGs. 8-9. As shown in the isobologram of FIG. 10, synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
[1637] FIG. 10 depicts an isobologram showing the effect of combinations of WT- WT-NCR13 and EDTA on M. fructicola cells. Using 3 μM EDTA, the amount of WT- NCR13 required to achieve IC50 in M. fructicola cells was 0.4 ppm (with 28.2% inhibition of growth caused by EDTA). Using 5 μM EDTA, the amount of WT-NCR13 required to achieve IC50 in M. fructicola cells was 0.24 ppm (with 43.2% inhibition of growth caused by EDTA). Accordingly, these results suggest a synergistic effect of combinations of NCR13 and EDTA when used against M. fructicola cells.
[1638] Example 4. Anti-B. cinerea - WT-NCR13 and EDTA
[1639] B. cinerea growth was assessed after 72 hour incubation with WT-NCR13, EDTA, and combinations thereof, at room temperature, cultured in synthetic fungal medium (SFM). The reagent dose concentrations evaluated are presented in the table below.
[1640] Table 5. Antifungal bioassay array. B. cinerea treated with WT-NCR13, EDTA or a combination thereof. Rows A-D show the doses evaluated for each dose response curve: A = WT-NCR13 (ppm); B = EDTA (μM); C = WT-NCR13 with 3 μM EDTA; D - WT- NCR13 with 5 μM EDTA (note: rows C and D show amounts of NCR13 in ppm).
Figure imgf000392_0001
[1641] Combinations of WT-NCR13 and EDTA were evaluated at concentrations of EDTA of 0, 3, and 5 μM. A summary of the individual reagents and combinations tested is shown below. Here, the amount shown below is the amount required to achieve IC50 in B. cinerea cells:
[1642] (1) WT-NCR13 (no EDTA) = 2.17 ppm.
[1643] (2) EDTA only = 4.78 μM (1.4 ppm).
[1644] (3) EDTA = 3 μM (22.1% inhibition by EDTA); WT-NCR13 = 0.56 ppm.
[1645] (4) EDTA = 5 μM (55.2% inhibition by EDTA); WT-NCR13 = 0.17 ppm [1646] FIG. 11 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with WT-NCR13 for 72 hours at room temperature. Here, the amount of WT-NCR13 required to achieve IC50 in B. cinerea cells was 2.17 ppm.
[1647] FIG. 12 depicts a graph showing the growth of B. cinerea as measured via relative OD600 (%), when treated with EDTA for 72 hours at room temperature. Here, the amount of EDTA required to achieve IC50 in B. cinerea cells was 4.78 μM.
[1648] Dose response curves were evaluated to generate an isobologram showing the effect of combinations of WT-NCR13 and EDTA against B. cinerea. The individual IC50 values for each of WT-NCR13 and EDTA were determined and used to establish the baseline (diagonal line) in the isobologram. FIGs. 11-12. The points (dose combinations) shown in the isobologram are based on the IC50 values from the combination dose-response curves. FIGs. 13-14.
[1649] As shown in the isobologram of FIG. 15, synergism for two agents is indicated by the presence of points below the diagonal line; additive effect is indicated by the presence of points above the diagonal line; and antagonism is indicated by the presence of points outside the envelope of additivity.
[1650] FIG. 15 depicts an isobologram showing the effect of WT-NCR13 and EDTA on B. cinerea cells. Using 3 μM EDTA, the amount of WT-NCR13 required to achieve IC50 in B. cinerea cells was 0.56 ppm (with 22.1% inhibition of growth caused by EDTA). Using 5 μM EDTA, the amount of WT-NCR13 required to achieve IC50 in B. cinerea cells was 0.17 ppm (with 55.2% inhibition of growth caused by EDTA). These results suggest a synergistic effect when combining WT-NCR13 and EDTA at a concentration of 3 μM against B. cinerea cells; however, at 5 μM of EDTA, the data was inconclusive, as this amount exceeded the IC50 (i.e., 55.2% inhibition).
[1651] Example 5. Antifungal bioassay
[1652] The antimicrobial effect of additional combinations comprising antimicrobial peptides and a chelating agent were also evaluated. Table 6 shows the antimicrobial peptides evaluated.
[1653] Table 6. Antimicrobial peptides.
Figure imgf000393_0001
Figure imgf000394_0001
[1654] Briefly, 96-well assay plates were prepared as follows:
[1655] Row A: antimicrobial peptide with 2x serial dilution in SFM.
[1656] Row B: EDTA with 2x serial dilution in SFM.
[1657] Rows C, D, E, F and G: antimicrobial mixes up with 5 different doses of EDTA.
[1658] Row H: SFM blank.
[1659] The SFM used was a low salt synthetic fungal medium (broth) consisting of the following:
[1660] Table 7. SFM broth ingredients
Figure imgf000394_0002
[1661] A 0.5M sterile solution of EDTA was made in dH2O and adjusted to pH 8.0 using NH4OH; from this, 5 different doses of EDTA were evaluated in combination with native PvDl, PvD1a, Dm-AMP1a, Rs-AFP2a, SPE10a, and So-D2. The EDTA doses were chosen based on EDTA IC50 of a given fungal species (see table below); here, the fungal species evaluated were: Botrytis cinerea, Monilinia fructicola, Phytophthora infestans, Septoria tritici, Cercospora sojina, Fusarium graminearum, Penicillum digitatum, Aspergillus niger, and Sclearotinia clerotiorum.
[1662] Using a multiple channel pipette, 5μL of a fungal spore suspension was added to the assay plate as described above. The assay plates were then incubated at room temperature for 96 hours, at which point a SpectraMax plate reader was used to determine OD600.
[1663] A table showing the averaged IC50 values from multiple EDTA bioassay experiments is provided below.
[1664] Table 8. Averaged IC50 values from multiple EDTA bioassay experiments is provided below.
Figure imgf000395_0001
[1665] Dose response curves were created to generate isobolograms showing the effect of combinations of a given antimicrobial peptide (i.e., native PvDl, PvD1a, Dm- AMP1a, Rs-AFP2a, SPE10a, and So-D2) and EDTA, against either Botrytis cinerea, Monilinia fructicola, Phytophthora infestans, Septoria tritici, Cercospora sojina, Fusarium graminearum, Penicillum digitatum, Aspergillus niger, or Sclearotinia clerotiorum.
[1666] To generate the isobolograms, IC50 for the following groups were determined: antimicrobial peptide alone, EDTA alone, and antimicrobial peptide at each of the 5 specific EDTA doses.
[1667] The individual IC50 values for each of native PvDl, PvD1a, Dm-AMP1a, Rs- AFP2a, SPE10a, and So-D2, and EDTA dose-response curve were determined and used to establish the baseline (diagonal line) in the isobologram. FIGs. 16-84. The points (dose combinations) represents an antimicrobial peptide IC50 vs. a specific EDTA dose, in which the IC50 was generated from 11 serial diluted the peptide doses. FIGs. 16-84. Here, synergism for two agents is indicated by the presence of points below the diagonal line on the isobologram; likewise, an additive effect is indicated by the presence of points above the diagonal line, and antagonism is indicated by the presence of points outside the envelope of additivity.
[1668] A summary of the doses evaluated to generate the isobolograms is provided in the table below.
[1669] Table 9. Doses used to generate isobolograms. The table below describes the doses used the generate the isobolograms in the figures, and provides these doses in both μM and mg/L (ppm). Here, Group = a given antimicrobial peptide and chelator combination being evaluated. Test = the organism being treated by the peptide and chelator combination. FIGs = the corresponding figures showing the dose-response curves and isobolograms for each test. Peptide (μM) = the dose of antimicrobial peptide in μM units. EDTA (μM) = the dose of EDTA in μM units. Ratio1 = ratio of peptide:EDTA in μM units. Peptide (mg/L) = the dose of antimicrobial peptide in mg/L. EDTA (mg/L) = the dose of EDTA in mg/L. Ratio2 = ratio of peptide:EDTA in mg/L.
Figure imgf000396_0001
Figure imgf000397_0001
Figure imgf000398_0001
Figure imgf000399_0001
[1670] Although the disclosure of the invention has been described in detail for purposes of clarity and understanding, it will be obvious to those with skill in the art that certain modifications can be practiced within the scope of the appended claims. All publications and patent documents cited herein are hereby incorporated by reference in their entirety for all purposes to the same extent as if each were so individually denoted.

Claims

1. An antimicrobial combination comprising an antimicrobial peptide (AMP), or an agriculturally acceptable salt thereof, and a chelating agent.
2. The antimicrobial combination of claim 1 , wherein the AMP comprises an amino acid sequence having at least 95% sequence identity to an amino acid sequence of SEQ ID NOs: 1-19634.
3. The antimicrobial combination of claim 1, wherein the AMP is a wild-type antimicrobial peptide.
4. The antimicrobial combination of claim 3, wherein the wild-type antimicrobial peptide is a wild-type nodule-specific cysteine-rich (NCR) peptide, or a wild-type defensin.
5. The antimicrobial combination of claim 4, wherein the wild-type NCR peptide is a wild-type NCR 1 peptide (NCR01), a wild-type NCR 2 peptide (NCR02), a wild-type NCR 3 peptide (NCR03), a wild-type NCR 4 peptide (NCR04), a wild-type NCR 5 peptide (NCR05), a wild- type NCR 6 peptide (NCR06), a wild- type NCR 7 peptide (NCR07), a wildtype NCR 8 peptide (NCR08), a wild-type NCR 9 peptide (NCR09), a wild-type NCR 10 peptide (NCR10), a wild-type NCR 11 peptide (NCR11), a wild-type NCR 12 peptide (NCR12), a wild-type NCR 13 peptide (NCR13), a wild-type NCR 14 peptide (NCR14), or a wild-type NCR 15 peptide (NCR15), or a wild-type agriculturally acceptable salt thereof.
6. The antimicrobial combination of claim 5, wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 90% identical to the full-length amino acid sequence of any of the wild-type NCR peptide amino acid sequences set forth in any one of SEQ ID NOs: 1-32.
7. The antimicrobial combination of claim 6, wherein the wild-type NCR peptide comprises an amino acid sequence that is at least 90% identical to the full-length amino acid sequence of the wild- type NCR 13 peptide amino acid consisting of the sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof..
8. The antimicrobial combination of claim 1 , wherein the AMP is a defensin.
9. The antimicrobial combination of claim 8, wherein the AMP is a plant defensin.
10. The antimicrobial combination of claim 9, wherein the AMP is a plant defensin comprising a cysteine-stabilized (CS) αβ motif.
11. The antimicrobial combination of claim 10, wherein the AMP is a plant defensin comprising 3 or 4 disulfide bonds.
12. The antimicrobial combination of claim 8, wherein the AMP comprises a first disulfide bond, a second disulfide bond, a third disulfide bond, and a fourth disulfide bond; wherein each of the first, second, third, and fourth disulfide bonds forms between a pair of cysteine residues selected from: C1-C8, C2-C5, C3-C6, and C4-C7; wherein C1, C2, C3, C4, C5, C6, C7, and C8 are cysteine residues operable to form a disulfide bond, and which correspond to a first, second, third, fourth, fifth, sixth, seventh, and eighth cysteine residue, respectively, as arranged in the N-terminus to C-terminus orientation of an amino acid sequence of the AMP; wherein one or more accessory cysteine residues are optionally present in the amino acid sequence of the AMP; and wherein the one or more accessory cysteine residues do not form a disulfide bond.
13. The antimicrobial combination of claim 12, wherein the AMP has a disulfide bond that forms between the first cysteine residue in the linear amino acid sequence, and the last cysteine residue in the linear amino acid sequence.
14. The antimicrobial combination of claim 8, wherein the AMP has a gamma core motif.
15. The antimicrobial combination of claim 8, wherein the AMP comprises: (1) a cysteine-stabilized (CS) αβ motif; (2) a first disulfide bond, a second disulfide bond, a third disulfide bond, and a fourth disulfide bond; wherein each of the first, second, third, and fourth disulfide bonds forms between a pair of cysteine residues selected from: C1-C8, C2- C5, C3-C6, and C4-C7; wherein C1, C2, C3, C4, C5, C6, C7, and C8 are cysteine residues operable to form a disulfide bond, and which correspond to a first, second, third, fourth, fifth, sixth, seventh, and eighth cysteine residue, respectively, as arranged in the N-terminus to C- terminus orientation of an amino acid sequence of the AMP; wherein one or more accessory cysteine residues are optionally present in the amino acid sequence of the AMP; and wherein the one or more accessory cysteine residues do not form a disulfide bond; and (3) a gamma core motif.
16. The antimicrobial combination of claim 8, wherein the AMP is: PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm-AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
17. The antimicrobial combination of claim 2, wherein the AMP is: a wild-type NCR13 peptide (SEQ ID NO: 1); PvDl (SEQ ID NO: 19629); PvD1a (SEQ ID NO: 19630); Dm- AMP1a (SEQ ID NO: 19631); Rs-AFP2a (SEQ ID NO: 19632); SPE10a (SEQ ID NO: 19633); or So-D2 (SEQ ID NO: 19634).
18. The antimicrobial combination of any one of claims 1-17, wherein the chelating agent is a metal-ion chelating agent.
19. The antimicrobial combination of claim 18, wherein the metal-ion chelating agent is an Al3+ chelating agent; an Ag+ chelating agent; an As3+ chelating agent; an Au+ chelating agent; an Au3+ chelating agent; aBa2+ chelating agent; a Be2+ chelating agent; a Ca2+ chelating agent; a Cd2+ chelating agent; a Co2+ chelating agent; a Co3+ chelating agent; a Cr2+ chelating agent; a Cr3+ chelating agent; a Cs+ chelating agent; a Cu+ chelating agent; a Cu2+ chelating agent; a Fe2+ chelating agent; a Fe3+ chelating agent; a Ga3+ chelating agent; a Hg2+ chelating agent; a Hg22+ chelating agent; a hi3+ chelating agent; a K+ chelating agent; a Li+ chelating agent; a Mg2+ chelating agent; a Mn2+ chelating agent; an Na+ chelating agent; an Ni2+ chelating agent; a Pb2+ chelating agent; a Pb++ chelating agent; a Sn2+ chelating agent; a Sn++ chelating agent; a Sr2+ chelating agent; or a Zn2+ chelating agent.
20. The antimicrobial combination of claim 19, wherein the metal-ion chelating agent is ethylenediaminetetraacetic acid (EDTA); ethylene diamine tetraacetate; ethylenediamine- N,N'-tetraacetic acid; 2,2',2"-nitrilotriacetate (NTA); citrate; 2-hydroxypropan- 1 ,2,3- tricarboxylate; diethylenetriaminepentaacetic acid (DTP A); benzo-DTPA; dibenzo-DTPA; phenyl-DTPA; diphenyl-DTPA; benzyl-DTPA; dibenzyl DTPA; N,N-Bis[2- [(carboxymethyl)[(methylcarbamoyl)methyl]ethyl]-glycine (DTPA-BMA); N-[2- [bis(carboxymethyl)amino]-3-(4-ethoxyphenyl)propyl)]-N-[2- [bis(carboxymethyl)amino]ethyl]glycine (EOB-DTPA); 4-carboxy-5,8,11- tris(carboxymethyl)-1-phenyl-2-oxa-5,8,11-triazatridecan-13-oic acid (BOPTA); N,N-bis[2- [bis(carboxymethyl)amino]ethyl]L-glutamic acid (DTPA-GLU); 1,4,7,10- teraazacyclododecane 1,4 ,7, -triacetic acid (DO3A); oxo-DO3A; [10-(2-hydroxypropyl)-
1.4.7.10-teraazacyclododecane 1 ,4, 7, -triacetic acid (HPDO3A); 1,4, 7 -triazacyclononane N,N',N"-triacetic acid (NOTA); 6-[bis(carboxymethyl)amino]tetrahydro-6-methyl-1H-1,4- diazepine-1,4(5H)-diacetic acid (AAZTA); 1,4,7,10-tetraazacyclotetradecane-1,4,7,10- tetraacetic acid (DOTA); benzo-DOTA; dibenzo-DOTA; (a,a',a",a'")-tetramethyl-1,4,7,10- tetraazacyclotetradecane-1,4,7,10-tetraacetic acid (DOTMA); 1,4,8,11- tetraazacyclotetradecane-N,N',N",N'"-tetraacetic acid (TETA); N'-bis-(pyridoxal-5- phosphate) ethylenediamine-N.N'-diacetic acid (DPDP); ethylenedinitrilotetrakis(niethylphosphonic) acid (EDTP); 1,4,7,10-tetraazacyclotetradecane-
1.4.7.10-tetra(methylenephosphonic) acid (DOTP); texaphirines; porphyrins; phthalocyanines; methylglycinediacetic acid or N,N-bis(carboxymethyl)alanine (MGDA); ethylene glycol tetraacetic acid (EGTA); ethylenediamine-N,N-disuccinic acid (EDDS); L- Glutamic acid; N,N-diacetic acid (GLDA); poly(acrylic acid) (PAA); copoly(acrylic acid/maleic acid) (PAA PMA); Sodium tripolyphosphate (STP); 1-Hydroxyethylidene-1,- Diphosphonic Acid (HEDP); ethylenediamine tetra(methylene phosphonic acid) (EDTMP); ethylenediaminetetramethylenetetraphosphonic acid (EDTMP A); diethylenetriamine penta (methylene phosphonic acid) (DTPMP); diethylene- triaminepenta(methylenehosphonic) acid (DTMPA); phytic acid; Inositol diphosphoric acid; Inositol triphosphoric; Inositol pentaphosphoric acid; dimercaprol; penicillamine; trientine; 4-[3,5-bis (2-hydroxyphenyl)- 1,2,4-triazol-1-yl] benzoic acid; deferiprone; deferoxamine; meso-2, 3, -dimercaptosuccinic acid; N-(1,2-dicarboxy-ethyl)-D,L-aspartic acid (IDS), N-(2-hydroxyethyl)iminodiacetic acid (EDG), aspartic acid-N-monoacetic acid (ASMA), aspartic acid-N,N-diacetic acid (ASDA), aspartic acid-N-monopropionic acid (ASMP), iminodisuccinic acid (IDA), N-(2-sulfomethyl) aspartic acid (SMAS), N-(2-sulfoethyl) aspartic acid (SEAS), N-(2-sulfomethyl) glutamic acid (SMGL), N-(2-sulfoethyl) glutamic acid (SEGL), N-methyliminodiacetic acid (MIDA), a-alanine-N,N-diacetic acid (α- ALDA), serine-N,N-diacetic acid (SEDA), isoserine-N,N- diacetic acid (ISDA), phenylalanine-N,N-diacetic acid (PHDA), anthranilic acid-N,N-diacetic acid (ANDA), sulfanilic acid-N, N-diacetic acid (SLDA), taurine-N, N-diacetic acid (TUDA), sulfomethyl-N, N-diacetic acid (SMDA), N-(hydroxyethyl)- ethylidenediaminetriacetate (HEDTA), diethanolglycine (DEG), aminotris(methylenephosphonic acid) (ATMP); 4,10-bis(carboxymethyl)-1,4,7,10- tetraazabicyclo[5.5.2]tetradecane (CB-DO2A); 4,11 - bis(carboxymethyl)-1,4,8,1 l- tetraazabicyclo[6.6.2]hexadecane (CB-TE2A); 1,4,8,11-tetraazacyclotetradecane-1,4,8, 11- tetraacetic acid (TETA); 1, 4, 7, 10, 13-pentaazacyclopentadecane-N, N', N", N'", N""- pentaacetic acid (PEPA); 2-[(carboxymethyl)][5-(4-nitrophenyl-1-[4,7,10- tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl]pentan-2-yl)amino]acetic acid (3p- C-DEPA); 4, 7, 10-tetra-(2-carbamonyl methyl)-cyclododecane (TCMC); 1 ,8-N,N'-bis- (carboxymethyl)-1,4,8,11-tetraazacyclotetradecane (TEAE); dimethylated tetraazamacrocycle (DM-TEA2A); N-mono tetraazamacrocycle (MM-TEA2A); 1,4, 7 -triazacyclononane- 1- succinic acid-4, 7-diacetic acid (NODASA); 1,4, 7-triazacyclononane,l -glutaric acid-4, 7- acetic acid (NOD AGA); 1,4, 7-tris(2-mercaptoethyl)- 1,4 ,7 -triazacyclononane (TACN-TM); hydroxybenzyl ethylenediamine (HBED); N,N’-bis-(2-hydroxy-5- sulfobenzyl)ethylenediamine-N,N’ -diacetic acid (SHBED); bipyridine; or a salt thereof.
21. The antimicrobial combination of claim 20, wherein the metal-ion chelating agent is EDTA.
22. The antimicrobial combination of any one of claims 1-21, wherein the ratio of AMP:chelating agent ranges from about 1 : 10 to about 5000: 1 , or from 1 : 10 to about 5000: 1 , about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1 :10 to about 500:1, or from about 1 : 10 to about 400: 1 , or from about 1 : 10 to 300: 1 , or from about 1 : 10 to 200: 1 , or from about 1:10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1 :10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1 :10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1 :4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1 :10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1 :10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1.
23. The antimicrobial combination of claim 22, wherein the ratio of AMPxhelating agent ranges from about 1 :10 to about 3000:1.
24. The antimicrobial combination of claim 22, wherein the ratio of AMPxhelating agent ranges from about 1 :10 to about 1000:1.
25. The antimicrobial combination of claim 22, wherein the ratio of AMPxhelating agent ranges from about 1 :10 to about 330:1.
26. The antimicrobial combination of any one of claims 22-25, wherein the combination is formulated as a composition comprising: (1) an AMP and (2) a chelating agent and at least one excipient, wherein the amount of the AMP in the composition ranges from about 0.000001% w/w to about 99.99999% w/w of the total composition, or from about 0.01% to about 99.99%; from about 0.02% to about 99.98%; from about 0.03% to about 99.97%; from about 0.04% to about 99.96%; from about 0.05% to about 99.95; from about 0.06% to about 99.94%; from about 0.07% to about 99.93%; from about 0.08% to about 99.92%; from about 0.09% to about 99.91%; from about 1% to about 99%; from about 2% to about 98%; from about 3% to about 97%; from about 4% to about 96%; from about 5% to about 95%; from about 6% to about 94%; from about 7% to about 93%; from about 8% to about 92%; from about 9% to about 91%; from about 10% to about 90%; from about 11% to about 89%; from about 12% to about 88%; from about 13% to about 87%; from about 14% to about 86%; from about 15% to about 85%; from about 16% to about 84%; from about 17% to about 83%; from about 18% to about 82%; from about 19% to about 81%; from about 20% to about 80%; from about 21 % to about 79%; from about 22% to about 78%; from about 23% to about 77%; from about 24% to about 76%; from about 25% to about 75%; from about 26% to about 74%; from about 27% to about 73%; from about 28% to about 72%; from about 29% to about 71%; from about 30% to about 70%; from about 31% to about 69%; from about 32% to about 68%; from about 33% to about 67%; from about 34% to about 66%; from about 35% to about 65%; from about 36% to about 64%; from about 37% to about 63%; from about 38% to about 62%; from about 39% to about 61 %; from about 40% to about 60%; from about 41 % to about 59%; from about 42% to about 58%; from about 43% to about 57%; from about 44% to about 56%; from about 45% to about 55%; from about 46% to about 54%; from about 47% to about 53%; from about 48% to about 52%; from about 49% to about 51%; from about 50% to about 50%; from about 51 % to about 49%; from about 52% to about 48%; from about 53% to about 47%; from about 54% to about 46%; from about 55% to about 45%; from about 56% to about 44%; from about 57% to about 43%; from about 58% to about 42%; from about 59% to about 41%; from about 60% to about 40%; from about 61% to about 39%; from about 62% to about 38%; from about 63% to about 37%; from about 64% to about 36%; from about 65% to about 35%; from about 66% to about 34%; from about 67% to about 33%; from about 68% to about 32%; from about 69% to about 31%; from about 70% to about 30%; from about 71% to about 29%; from about 72% to about 28%; from about 73% to about 27%; from about 74% to about 26%; from about 75% to about 25%; from about 76% to about 24%; from about 77% to about 23%; from about 78% to about 22%; from about 79% to about 21%; from about 80% to about 20%; from about 81% to about 19%; from about 82% to about 18%; from about 83% to about 17%; from about 84% to about 16%; from about 85% to about 15%; from about 86% to about 14%; from about 87% to about 13%; from about 88% to about 12%; from about 89% to about 11%; from about 90% to about 10%; from about 91% to about 9%; from about 92% to about 8%; from about 93% to about 7%; from about 94% to about 6%; from about 95% to about 5%; from about 96% to about 4%; from about 97% to about 3%; from about 98% to about 2%; from about 99% to about 1%; from about 99.91 to about 0.09%; from about 99.92 to about 0.08%; from about 99.93 to about 0.07%; from about 99.94 to about 0.06%; from about 99.95 to about 0.05%; from about 99.96 to about 0.04%; from about 99.97 to about 0.03%; from about 99.98 to about 0.02%; or from about 99.99 to about 0.01%, and wherein the ratio of AMP:chelating agent ranges from about 1 : 10 to about 5000: 1 , or from 1 : 10 to about 5000: 1 , about 1:5 to about 5000:1, about 3:10 to about 5000:1, about 2:5 to about 5000:1, about 1:5 to about 5000:1, about 6:10 to about 5000:1, about 7:10 to about 5000:1, about 4:5 to about 5000:1, about 9:10 to about 5000:1, or about 1:1 to about 5000:1, or from about 1:10 to about 3000:1, or from about 1:10 to about 1000:1, or from about 1 :10 to about 500:1, or from about 1 : 10 to about 400: 1 , or from about 1 : 10 to 300: 1 , or from about 1 : 10 to 200: 1 , or from about 1:10 to about 1:9.75, from about 1:10 to about 1:9.5, from about 1:10 to about 1:9.25, from about 1:10 to about 1:9, from about 1:10 to about 1:8.75, from about 1:10 to about 1:8.5, from about 1:10 to about 1:8.25, from about 1:10 to about 1:8, from about 1:10 to about 1:7.75, from about 1:10 to about 1:7.5, from about 1:10 to about 1:7.25, from about 1:10 to about 1:7, from about 1 :10 to about 1:6.75, from about 1:10 to about 1:6.5, from about 1:10 to about 1:6.25, from about 1 :10 to about 1:6, from about 1:10 to about 1:5.75, from about 1:10 to about 1:5.5, from about 1:10 to about 1:5.25, from about 1:10 to about 1:5, from about 1:10 to about 1:4.75, from about 1:10 to about 1 :4.5, from about 1:10 to about 1:4.25, from about 1:10 to about 1:4, from about 1 :10 to about 1:3.75, from about 1:10 to about 1:3.5, from about 1:10 to about 1:3.25, from about 1:10 to about 1:3, from about 1:10 to about 1:2.75, from about 1:10 to about 1:2.5, from about 1:10 to about 1:2.25, from about 1:10 to about 1:2, from about 1 :10 to about 1:1.75, from about 1:10 to about 1:1.5, from about 1:10 to about 1:1.25, or from about 1:10 to about 1:1.
27. The antimicrobial combination of any one of claims 1-25, wherein the antimicrobial combination is formulated in separate compositions.
28. The antimicrobial combination of claim 27, wherein the separate compositions are formulated as powders, dusts, pellets, granules, sprays, emulsions, colloids, solutions, or combinations thereof.
29. The antimicrobial combination of claim 27, wherein the separate compositions are formulated using the same excipients or different excipients.
30. The antimicrobial combination of any one of claims 1-26, wherein the antimicrobial combination is formulated in a single composition.
31. The combination of claim 30, wherein the single composition is formulated as a powder, a dust, a pellet, a granule, a spray, an emulsion, a colloid, a solution, or combinations thereof.
32. An antimicrobial composition comprising the antimicrobial combination of any one of claims 1-31; and at least one excipient.
33. A method of combating, controlling, or inhibiting a pathogenic microbe comprising: applying an antimicrobially-effective amount of the antimicrobial combination of any one of claims 1-31, or the antimicrobial composition of claim 32, to: the pathogenic microbe, a locus of the pathogenic microbe, a food supply of the pathogenic microbe, a habitat of the pathogenic microbe, or a breeding ground of the pathogenic microbe; a plant, a seed, a plant part, a locus of a plant, or an environment of a plant that is susceptible to an attack by the pathogenic microbe; an animal, a locus of an animal, or an environment of an animal susceptible to an attack by the pathogenic microbe; or any combination thereof.
34. The method of claim 33, wherein the pathogenic microbe is a pathogenic microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Venturia, Wilsonomyces, Botryosphaeria, Penicillium, Rhizopus, Aspergillus, Podosphaera, Erysiphe, Golovinomyces, Leveillula, Peronospora, Pseudoperonospora, Plasmopara, Bremia, Cladosporium, Neofabraea, Microdochium, Marssonina, Sclerotinia, Rhizopus, Didymella, Altemaria, Verticillium, Phytophthora, Colletotrichum, Cercospora, Phakopsora, Rhizoctonia, Sclerotinia, Pythium, Phoma, Gaeumannomces, Leptoshaeria, or Puccinia.
35. The method of claim 34, wherein the pathogenic microbe is a pathogenic microbe belonging to the genera: Monilinia, Botrytis, Fusarium, Phytophthora, Cercospora, or Aspergillus.
36. The method of claim 35, wherein the pathogenic microbe is Monilinia fructicola, Botrytis cinerea, Fusarium graminearum, Phytophthora infestans, Cercospora sojina, or Aspergillus niger.
37. An antimicrobial composition comprising: a wild-type nodule-specific cysteine-rich 13 peptide (WT-NCR13) consisting of an amino acid sequence as set forth in SEQ ID NO: 1, or an agriculturally acceptable salt thereof; EDTA; and an excipient; wherein the WT-NCR13 is in an amount ranging from about 0.000017% w/w to about 0.00399% w/w, and the EDTA is in an amount ranging from about 0.000088% w/w to about 0.000292% w/w, of the total weight of the composition.
38. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvDl (SEQ ID NO: 19629) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvDl is in an amount ranging from about 0.000016287% w/w to about 0.010863% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
39. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) PvD1a (SEQ ID NO: 19630) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the PvD1a is in an amount ranging from about 0.000034157% w/w to about 0.0075653% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0011689752% w/w of the total weight of the composition.
40. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Dm-AMP1a (SEQ ID NO: 19631) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Dm-AMP1a is in an amount ranging from about 0.00023018% w/w to about 0.0093402% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
41. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) Rs-AFP2a (SEQ ID NO: 19632) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the Rs-AFP2a is in an amount ranging from about 0.00017548% w/w to about 0.00077665% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
42. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) SPE10a (SEQ ID NO: 19633) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the SPE10a is in an amount ranging from about 0.000030081% w/w to about 0.0014937% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
43. An antimicrobial composition comprising an antimicrobial combination and an excipient; wherein the antimicrobial combination comprises (1) So-D2 (SEQ ID NO: 19634) or an agriculturally acceptable salt thereof; and (2) EDTA; wherein the So-D2 is in an amount ranging from about 0.0013667% w/w to about 0.0092686% w/w, and the EDTA is in an amount ranging from about 0.0000292244% w/w to about 0.0002337950% w/w of the total weight of the composition.
PCT/US2023/068585 2022-06-17 2023-06-16 Antimicrobial peptide combinations WO2023245169A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202263366609P 2022-06-17 2022-06-17
US63/366,609 2022-06-17

Publications (1)

Publication Number Publication Date
WO2023245169A1 true WO2023245169A1 (en) 2023-12-21

Family

ID=87245447

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/068585 WO2023245169A1 (en) 2022-06-17 2023-06-16 Antimicrobial peptide combinations

Country Status (1)

Country Link
WO (1) WO2023245169A1 (en)

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3714140A (en) 1971-03-16 1973-01-30 Squibb & Sons Inc Peptide synthesis
US4411994A (en) 1978-06-08 1983-10-25 The President And Fellows Of Harvard College Protein synthesis
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5482928A (en) 1991-03-11 1996-01-09 Imperial Chemical Industries Plc Biocidal proteins
US5736135A (en) 1991-07-11 1998-04-07 Genentech, Inc. Method for making variant secreted proteins with altered properties
US6121436A (en) 1996-12-13 2000-09-19 Monsanto Company Antifungal polypeptide and methods for controlling plant pathogenic fungi
WO2000068405A2 (en) 1999-05-07 2000-11-16 E.I. Du Pont De Nemours And Company Plant defensins
US6468523B1 (en) 1998-11-02 2002-10-22 Monsanto Technology Llc Polypeptide compositions toxic to diabrotic insects, and methods of use
US6605698B1 (en) 1995-12-13 2003-08-12 Syngenta Limited Antifungal peptides and composition thereof
US20050106701A1 (en) 2003-11-17 2005-05-19 Ciphergen Biosystems, Inc. Methods for the purification of defensins
US20050165215A1 (en) 2003-12-31 2005-07-28 Bigelow Roger D. Peptide synthesis and deprotection using a cosolvent
US7582147B1 (en) 2004-08-19 2009-09-01 The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration Composite powder particles
US7785832B2 (en) 2000-05-09 2010-08-31 HALLA Patent & Law Firm Method of protein synthesis
WO2011105869A2 (en) * 2010-02-26 2011-09-01 주식회사 나이벡 Dental cleanser composition for improving the properties of adhering to teeth
US8314208B2 (en) 2006-02-10 2012-11-20 Cem Corporation Microwave enhanced N-fmoc deprotection in peptide synthesis
US8592367B2 (en) 2009-06-15 2013-11-26 Centre National De La Recherche Scientifique Nodule specific medicago peptides having antimicrobial activity and pharmaceutical compositions containing the same
US9848603B2 (en) 2008-02-01 2017-12-26 Hexima Limited Methods for protecting plants with antifungal compositions
US10442834B2 (en) 2013-04-04 2019-10-15 Ajinomoto Co., Inc. Deprotection method
WO2020146360A1 (en) * 2019-01-07 2020-07-16 Donald Danforth Plant Science Center Antimicrobial ncr peptides

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3714140A (en) 1971-03-16 1973-01-30 Squibb & Sons Inc Peptide synthesis
US4411994A (en) 1978-06-08 1983-10-25 The President And Fellows Of Harvard College Protein synthesis
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US5482928A (en) 1991-03-11 1996-01-09 Imperial Chemical Industries Plc Biocidal proteins
US5736135A (en) 1991-07-11 1998-04-07 Genentech, Inc. Method for making variant secreted proteins with altered properties
US6605698B1 (en) 1995-12-13 2003-08-12 Syngenta Limited Antifungal peptides and composition thereof
US6121436A (en) 1996-12-13 2000-09-19 Monsanto Company Antifungal polypeptide and methods for controlling plant pathogenic fungi
US6468523B1 (en) 1998-11-02 2002-10-22 Monsanto Technology Llc Polypeptide compositions toxic to diabrotic insects, and methods of use
WO2000068405A2 (en) 1999-05-07 2000-11-16 E.I. Du Pont De Nemours And Company Plant defensins
US7785832B2 (en) 2000-05-09 2010-08-31 HALLA Patent & Law Firm Method of protein synthesis
US20050106701A1 (en) 2003-11-17 2005-05-19 Ciphergen Biosystems, Inc. Methods for the purification of defensins
US20050165215A1 (en) 2003-12-31 2005-07-28 Bigelow Roger D. Peptide synthesis and deprotection using a cosolvent
US7582147B1 (en) 2004-08-19 2009-09-01 The United States Of America As Represented By The Administrator Of The National Aeronautics And Space Administration Composite powder particles
US8314208B2 (en) 2006-02-10 2012-11-20 Cem Corporation Microwave enhanced N-fmoc deprotection in peptide synthesis
US9848603B2 (en) 2008-02-01 2017-12-26 Hexima Limited Methods for protecting plants with antifungal compositions
US8592367B2 (en) 2009-06-15 2013-11-26 Centre National De La Recherche Scientifique Nodule specific medicago peptides having antimicrobial activity and pharmaceutical compositions containing the same
WO2011105869A2 (en) * 2010-02-26 2011-09-01 주식회사 나이벡 Dental cleanser composition for improving the properties of adhering to teeth
US10442834B2 (en) 2013-04-04 2019-10-15 Ajinomoto Co., Inc. Deprotection method
WO2020146360A1 (en) * 2019-01-07 2020-07-16 Donald Danforth Plant Science Center Antimicrobial ncr peptides

Non-Patent Citations (48)

* Cited by examiner, † Cited by third party
Title
"Animal Cell Culture: Practical Approach", 2000
"Atlas of Protein Sequence and Structure", 1978, NATL. BIOMED. RES. FOUND.
"Handbook of Pharmaceutical Salts: Properties, Selection and Use", 23 August 2002, JOHN WILEY & SONS
"Immobilized Cells and Enzymes: A Practical Approach", vol. I-IV, 1986, BLACKWELL SCIENTIFIC PUBLICATIONS
"Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING COMPANY, pages: 1418
"Sequence Analysis Primer", 1991, M STOCKTON PRESS
A LLOYD-WILLIAMS P. ET AL.: "Chemical approaches to the synthesis of peptides and proteins", 1997, COLD SPRING HARBOR, pages: 278
AGARWAL ET AL.: "Chemical synthesis of polynucleotides", ANGEW CHEM INT ED ENGL, vol. 11, no. 6, June 1972 (1972-06-01), pages 451 - 9, XP001096560, DOI: 10.1002/anie.197204511
AGRAWAL: "Protocols for Oligonucleotides and Analogs: Synthesis and Properties", METHODS IN MOLECULAR BIOLOGY, vol. 20, 1993
ALTSCHUL, S. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL, S. F. ET AL., J. MOLEC. BIOL., vol. 215, 1990, pages 403 - 410
ANDERSON G. W.MCGREGOR A. C.: "T-butyloxycarbonylamino acids and their use in peptide synthesis", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 79, 1957, pages 6180 - 3
BARANY, G.MERRIFIELD, R. B.: "The Peptides", vol. 2, 1979, ACADEMIC PRESS, pages: 1 - 284
BEAUCAGE S. L. ET AL.: "Tetrahedron", vol. 48, 1992, ELSEVIER SCIENCE PUBLISHERS, article "Advances in the Synthesis of Oligonucleotides by the Phosphoramidite Approach", pages: 2223 - 2311
BODANSZKY, M., INT. J. PEPTIDE PROTEIN RES, vol. 25, 1985, pages 449 - 474
BODANSZKY, M.BODANSZKY, A.: "Synthese von Peptiden in Houben-Weyls Metoden der Organischen Chemie", vol. 15, 1984, SPRINGER-VERLAG
CARILLO, H.LIPMAN, D., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073
CARPINO L. A.: "Oxidative reactions of hydrazines. Iv. Elimination of nitrogen from 1, 1-disubstituted-2-arenesulfonhydrazidesl-4", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 79, 1957, pages 4427 - 31
CARPINO L. A.HAN G. Y.: "9-fluorenylmethoxycarbonyl amino-protecting group", THE JOURNAL OF ORGANIC CHEMISTRY, vol. 37, 1972, pages 3404 - 9
DEVEREUX, J. ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, no. 1, 1984, pages 387
J. F. RAMALHO ORTIGAO: "Knowledge database of Access to Virtual Laboratory website", INTERACTIVA, article "The Chemistry of Peptide Synthesis"
JANKE ET AL.: "A versatile toolbox for PCR-based tagging of yeast genes: new fluorescent proteins, more markers and promoter substitution cassettes", YEAST, vol. 21, no. 11, August 2004 (2004-08-01), pages 947 - 62, XP055544711, DOI: 10.1002/yea.1142
KERESZT ET AL.: "Impact of Plant Peptides on Symbiotic Nodule Development and Functioning", FRONT PLANT SCI, vol. 9, 2018, pages 1026
KYTEDOOLITTLE, J MOL BIOL., vol. 157, no. 1, 1982, pages 105 - 32
LARKIN M. A. ET AL.: "CLUSTALW2, ClustalW and ClustalX version 2", BIOINFORMATICS, vol. 23, no. 21, 2007, pages 2947 - 2948
MAR6TI ET AL.: "Natural roles of antimicrobial peptides in microbes, plants and animals", RES MICROBIOL., vol. 162, no. 4, May 2011 (2011-05-01), pages 363 - 74
MAROTIKONDOROSI: "Nitrogen-fixing Rhizobium-legume symbiosis: are polyploidy and host peptide-governed symbiont differentiation general principles of endosymbiosis?", FRONT MICROBIOL, vol. 5, 2014, pages 326
MCKAY F. C.ALBERTSON N. F.: "New amine-masking groups for peptide synthesis", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 79, 1957, pages 4686 - 90, XP001184774, DOI: 10.1021/ja01574a029
MERGAERT ET AL.: "Gene Expression in Nitrogen-Fixing Symbiotic Nodule Cells in Medicago truncatula and Other Nodulating Plants", PLANT CELL, vol. 32, no. 1, January 2020 (2020-01-01), pages 42 - 68
MERRIFIELD R. B.: "Solid phase peptide synthesis. I. The synthesis of a tetrapeptide", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 85, 1963, pages 2149 - 54, XP002257754, DOI: 10.1021/ja00897a025
MERRIFIELD, R. B., J. AM. CHEM. SOC., vol. 85, 1963, pages 2149 - 2154
METHODS IN ENZYMOLOGY
MONTIEL ET AL.: "Terminal Bacteroid Differentiation Is Associated With Variable Morphological Changes in Legume Species Belonging to the Inverted Repeat-Lacking Clade", MOL PLANT MICROBE INTERACT, vol. 29, no. 3, March 2016 (2016-03-01), pages 210 - 9
NOTREDAME ET AL.: "T-Coffee: A novel method for multiple sequence alignments", JOURNAL OF MOLECULAR BIOLOGY, vol. 302, 2000, pages 205 - 217, XP004469125, DOI: 10.1006/jmbi.2000.4042
OHTSUKA ET AL.: "Recent developments in the chemical synthesis of polynucleotides", NUCLEIC ACIDS RES., vol. 10, no. 21, 11 November 1982 (1982-11-11), pages 6553 - 6570
P. KOSTERS ET AL.: "Seed Treatment: Progress and Prospects", BCPC MONOGRAPH NO. 57, 1994
PANYUTICH A V ET AL: "Identification of defensin binding to C1 complement", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 356, no. 2-3, 19 December 1994 (1994-12-19), pages 169 - 173, XP025653934, ISSN: 0014-5793, [retrieved on 19941219], DOI: 10.1016/0014-5793(94)01261-X *
PERBAL, B., A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984
REAL HERNANDEZ LUIS M. ET AL: "Enzymatic Production, Bioactivity, and Bitterness of Chickpea ( Cicer arietinum ) Peptides", COMPREHENSIVE REVIEWS IN FOOD SCIENCE AND FOOD SAFETY, vol. 18, no. 6, 15 November 2019 (2019-11-15), US, pages 1913 - 1946, XP093084368, ISSN: 1541-4337, Retrieved from the Internet <URL:https://onlinelibrary.wiley.com/doi/full-xml/10.1111/1541-4337.12504> DOI: 10.1111/1541-4337.12504 *
ROY ET AL.: "Symbiotic Outcome Modified by the Diversification from 7 to over 700 Nodule-Specific Cysteine-Rich Peptides", GENES (BASEL, vol. 11, no. 4, April 2020 (2020-04-01), pages 348
S. M. BERGE ET AL., J. PHARMACEUTICAL SCIENCES, vol. 66, 1977, pages 1 - 19
SAKAKIBARA, D.TEICHMAN, J.LIEN, E.LAND FENICHEL, R. L., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 73, 1976, pages 336 - 342
SAMBROOKFRITSCHMANIATIS: "Molecular Cloning: A Laboratory Manual", vol. I, 1989, COLD SPRING HARBOR LABORATORIES
SONDEKSHORTLE: "A general strategy for random insertion and substitution mutagenesis: substoichiometric coupling of trinucleotide phosphoramidites", PROC NATL ACAD SCI USA., vol. 89, no. 8, 15 April 1992 (1992-04-15), pages 3581 - 3585, XP002901698
THOMPSON J. D.HIGGINS D. G.GIBSON T. J.: "CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice", NUCLEIC ACIDS RESEARCH, vol. 22, 1994, pages 4673 - 4680, XP002956304
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS
WALKENHORST WILLIAM F ED - THOMPSON LYNMARIE ET AL: "Using adjuvants and environmental factors to modulate the activity of antimicrobial peptides", BIOCHIMICA ET BIOPHYSICA ACTA, ELSEVIER, AMSTERDAM, NL, vol. 1858, no. 5, 2 January 2016 (2016-01-02), pages 926 - 935, XP029473764, ISSN: 0005-2736, DOI: 10.1016/J.BBAMEM.2015.12.034 *
YILI A ET AL: "New peptide from seeds of Cicer arietinum", CHEMISTRY OF NATURAL COMPOUNDS, SPRINGER NATURE, 1 May 2012 (2012-05-01), pages 959 - 962, XP018504667, ISSN: 1573-8388, DOI: 10.1007/S10600-012-0113-8 *

Similar Documents

Publication Publication Date Title
CN113766833A (en) Paenibacillus (Paenibacillus) strains and methods of use thereof
WO2019115765A1 (en) Bacterial siderophore gramibactin
CN117396496A (en) Av3 mutant polypeptides for pest control
US20240018198A1 (en) Mu-diguetoxin-dc1a variant polypeptides for pest control
US20220174961A1 (en) Functional peptides having antimicrobial activity against phytopathogenic microorganisms
Muñoz et al. Comparative study of antimicrobial peptides to control citrus postharvest decay caused by Penicillium digitatum
EP3219325B1 (en) Variants of the lantibiotic mu1140 and other lantibiotics with improved pharmacological properties and structural features
EP1143800B1 (en) Biological control of nematodes
WO2023245169A1 (en) Antimicrobial peptide combinations
WO2023245128A1 (en) Antimicrobial peptide
US11713341B1 (en) Antimicrobial NCR13 variant peptides
WO2023245100A1 (en) Antimicrobial ncr13 variant peptides
US11952584B2 (en) Functional peptides having antimicrobial activity against phytopathogenic microorganisms
JP7156980B2 (en) Functional peptides with antibacterial activity against plant pathogens
JP7156979B2 (en) Functional peptides with antibacterial activity against plant pathogens
US20230337684A1 (en) Proteolytically stable u1-agatoxin-ta1b variant polypeptides for pest control
CN108018215B (en) Gene with insect killing function and application thereof in insect prevention and control
KR102641583B1 (en) Composition for preventing plant diseases comprising zidovudine
JP2002511755A (en) Plant protection method against insects or nematodes
WO2023225555A1 (en) Pesticidal actx peptide variants
KR20240021867A (en) Modified antimicrobial peptides
CN117715520A (en) Compositions and methods for improving the rain tolerance of proteins on plant surfaces
Houtz et al. Inhibitors of plant peptide deformylase for use as broad-spectrum herbicides and methods for identifying the same
JP2001010911A (en) Weed-controlling composition and weed-controlling method

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23741230

Country of ref document: EP

Kind code of ref document: A1