WO2023219510A1 - Treatment of haematological malignancies - Google Patents
Treatment of haematological malignancies Download PDFInfo
- Publication number
- WO2023219510A1 WO2023219510A1 PCT/NL2023/050268 NL2023050268W WO2023219510A1 WO 2023219510 A1 WO2023219510 A1 WO 2023219510A1 NL 2023050268 W NL2023050268 W NL 2023050268W WO 2023219510 A1 WO2023219510 A1 WO 2023219510A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- acid sequence
- tcr
- amino acid
- hla
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4201—Neoantigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/46—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6006—Cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
Definitions
- Novel nucleic acid sequences, vectors, modified cells, peptides and pharmaceutical compositions are provided that are useful in the treatment of human subjects having a AN PM 1 positive haematological malignancy. Corresponding methods and uses are also provided.
- Haematological malignancies are cancers that affect the blood and lymph system.
- the cancer may begin in blood-forming tissue (e.g. bone marrow), or in the cells of the immune system.
- blood-forming tissue e.g. bone marrow
- myeloid malignancies such as acute myeloid leukemia (AML).
- Acute myeloid leukemia is a malignant disease of the bone marrow characterized by accumulation of myeloid precursor cells that are arrested in differentiation.
- standard therapy consists of induction chemotherapy followed by intensive consolidation chemotherapy or high dose therapy in combination with autologous or allogeneic hematopoietic stem cell transplantation (alloSCT), resulting in 5-year survival rates of 40-45% in patients ⁇ 65 years and only 10% in patients >65 years.
- AlloSCT is associated with low relapse rates, but this benefit is limited by high toxicity. Therefore, treatment with alloSCT is restricted to patients with good performance status, but poor prognosis based on adverse cytogenetic or molecular abnormalities or detectable persistent or relapsed disease after chemotherapy. In the majority of patients, relapses occur within 3 years after start of chemotherapy, indicating the pressing need for new targeted therapies with high efficacy and no or limited toxicity to treat and improve survival of patients with AML. 2
- Neoantigens are peptides arising from tumor-specific DNA mutations that can be recognized by specific T cells when presented in the context of H LA on the tumor cell. The formation of these antigens is a probabilistic process in which each additional mutation increases the chance that a neoantigen is created. Since mutational load in AML is low, the number of neoantigens is expected to be limited.
- 3 Neoantigens can serve as cancer rejection antigens in vivo after therapy with checkpoint inhibitors or adoptive transfer of in vitro expanded tumor-infiltrating lymphocytes (TILs).
- 3-4 Checkpoint inhibitors are antibodies that block inhibitory signals on T cells mediated by CTLA-4 (ipilimumab) or PD-1 (pembrolizumab and nivolumab), thereby stimulating the immune system to target neoantigens.
- Checkpoint inhibitors and TIL therapy have proven successful for tumors with high mutational load, but are ineffective for tumors with low mutational load.
- overall mutational load in AML is low, somatic abnormalities often occur in a limited number of driver genes that are recurrently mutated in multiple patients. 5
- neoantigens arising from recurrent mutations in AML are relevant for development of targeted immunotherapy.
- ANPM1 or NPM1 mut a mutated form of nucleophosmin
- AML a mutated form of nucleophosmin
- Nucleophosmin is a driver gene that is frequently mutated in approximately 30% of patients with AML. 5 Mutated NPM1 has also been observed in other types of haematological malignancies (e.g. other myeloid malignancies), although frequencies in tumours other than AML are much lower. Patients with mutated NPM1 (ANPM1, or NPM1 mut ) carry a characteristic 4 base pair (4-bp) frameshift insertion in exon 12 of the gene. The resulting ANPM1 protein is 4 amino acids (AA) longer than the wild type counterpart and its C-terminal 11 AA are translated in an alternative reading frame (CLAVEEVSLRK (SEQ ID NO: 27)).
- the ANPM1 protein is dislocated from the nucleolus, where it functions as a nucleocytoplasmic shuttle protein, to the cytoplasm. 6
- the ANPM1 protein is thus localized intracellularly.
- HLA- restricted AN PM 1 -derived peptides are accessible on the cell surface to T cell receptors, and thus can be recognized by T cells.
- RNA molecules encoded by the alternative reading frame of ANPM1 that are presented by HLA class I.
- the five identified peptides are CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO: 27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- These peptides can be used as therapeutic agents (e.g. vaccines) to treat or prevent ANPM1 positive AML 23 .
- they can be used as a target antigen for treatment of such patients with modified cells described herein (e.g. peripheral blood lymphocytes or tumourinfiltrating lymphocytes (TILs)) having T cell receptors that specifically recognize one of the specified peptides).
- modified cells described herein e.g. peripheral blood lymphocytes or tumourinfiltrating lymphocytes (TILs) having T cell receptors that specifically recognize one of the specified peptides.
- CLAVEEVSL (SEQ ID NO:1) is presented on the surface of primary AML cells isolated from HLA-A*02:01 positive patients with AML.
- the peptide can therefore be used as a therapeutic agent (e.g. vaccine) to treat or prevent ANPM1 positive AML in a HLA-A*02:01 positive human patient.
- it can be used as a target antigen for treatment of such patients with modified cells described herein (e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs)) having T cell receptors that specifically recognize CLAVEEVSL (SEQ ID NO:1)).
- modified cells described herein e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs) having T cell receptors that specifically recognize CLAVEEVSL (SEQ ID NO:1)).
- TCRs T cell receptors
- CLAVEEVSL SEQ ID NO:1
- PBMC peripheral blood mononuclear cells
- the T cell receptor of the most reactive clone (1A2) was sequenced and introduced into CD8 + and CD4 + T cells, which demonstrated specific recognition and lysis of HLA-A*02:01 positive primary AML with ANPM1 in a co-receptor independent fashion.
- T cells expressing TCRs specific to CLAVEEVSL can therefore be used as an effective immunotherapy in the treatment of HLA-A*02:01 positive patients having a ANPM1 positive AML.
- TCR gene transfer approaches using CLAVEEVSL (SEQ ID NO:1) -specific TCRs can therefore bring novel treatment modalities for HLA-A*02:01 positive patients with ANPM1 positive AML.
- the peptide CLAVEEVSL (SEQ ID NO:1) (and specifically its cysteinylated form i.e. C*LAVEEVSL) can be used as a therapeutic agent (e.g. a vaccine) to treat or prevent ANPM1 positive AML in HLA-A*02:01 positive patients.
- a therapeutic agent e.g. a vaccine
- the peptide itself therefore also has utility e.g. in isolated form, or when formulated as a pharmaceutical composition.
- each of the AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) peptides can be used as a therapeutic agent (e.g. vaccine) to treat or prevent ANPM1 positive AML in a HLA-A*03:01 or HLA-A*11:01 positive human patient.
- each of these peptides can be used as a target antigen for treatment of such patients with modified cells described herein (e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs)) having T cell receptors that specifically recognize AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) respectively).
- modified cells described herein e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs) having T cell receptors that specifically recognize AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) respectively.
- AVEEVSLRK SEQ ID NO:26
- HLA-A*01:01 as described herein in detail for the CLAVEEVSL (SEQ ID NO:1) peptide.
- the capacity of AVEEVSLRK (SEQ ID NO:26) to bind HLA-A*01:01 has therefore been confirmed.
- AVEEVSLRK (SEQ ID NO:26) has also been identified in the HLA class I ligandome from a HLA-A*01:01 positive AML subject (AML4443) which lacks HLA- A*03:01 and HLA-A*11:01 (see Figure 2).
- the AVEEVSLRK (SEQ ID NO:26) peptide can also be used as a therapeutic agent (e.g. vaccine) to treat or prevent ANPM1 positive AML in a HLA-A*01:01 positive human patient.
- this peptide can be used as a target antigen for treatment of such patients with modified cells described herein (e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs)) having T cell receptors that specifically recognize AVEEVSLRK(SEQ ID NO:26)).
- modified cells described herein e.g. peripheral blood lymphocytes or tumour-infiltrating lymphocytes (TILs) having T cell receptors that specifically recognize AVEEVSLRK(SEQ ID NO:26)
- T cells with T cell receptors (TCRs) specific for AVEEVSLRK SEQ ID NO:26
- TCRs T cell receptors
- HLA-A*03:01 tetramers and HLA-A*11:01 tetramers were produced for AVEEVSLRK (SEQ ID NO:26) and tetramer positive CD8 T cells were isolated from peripheral blood mononuclear cells (PBMC) from healthy individuals.
- PBMC peripheral blood mononuclear cells
- the inventors have therefore identified four TCRs that specifically bind to the neoantigen AVEEVSLRK (SEQ ID NO:26) in the context of HLA-A*03:01 (the TCR from clone 3B3, and the TCR from clone 31.3.F1) or HLA-A*11:01 (the TCR from clone 6F11 , and the TCR from clone 26.2. D6).
- the T cell receptors of clones 26.2. D6 and 6F11 were sequenced and introduced into CD8 + T cells.
- the TCR-T cells showed specific binding to PE-labelled pHLA-A*11:01-AVEEVSLRK tetramers.
- IFN-y ELISA the TCR-T cells specifically reacted against HLA-A*11 :01 positive AML with ANPM1.
- the T cell receptor of clone 31.3.F1 was also sequenced and introduced into CD8 + T cells.
- the TCR-T cells showed specific binding to PE-labelled pHLA-A*03:01-AVEEVSLRK tetramers.
- IFN-y ELISA the TCR-T cells specifically reacted against HLA-A*03:01 positive AML with ANPM1.
- T cells expressing TCRs specific to AVEEVSLRK can therefore be used as an effective immunotherapy in the treatment of HLA-A*03:01 , HLA- A*11 :01 or HLA-A*01 :01 positive patients having a ANPM1 positive AML.
- TCR gene transfer approaches using AVEEVSLRK (SEQ ID NO:26) -specific TCRs can therefore bring novel treatment modalities for HLA-A*03:01 , HLA-A*11 :01 or HLA-A*01:01 positive patients having a ANPM1 positive AML.
- the inventors have also identified that the TCRs from clones 6F11 and 26.2. D6, whilst binding strongly to AVEEVSLRK (SEQ ID NO: 26), also bind to a lesser extent to CLAVEEVSLRK (SEQ ID NO: 27) (when CLAVEEVSLRK (SEQ ID NO: 27) is presented by HLA-A*11:01).
- AVEEVSLRK SEQ ID NO: 26
- CLAVEEVSLRK SEQ ID NO: 27
- these clones specifically bind to neoantigens that comprise this core sequence.
- TCRs with “specific binding to AVEEVSLRK (SEQ ID NO: 26)” described herein encompass those that bind to AVEEVSLRK (SEQ ID NO: 26) and CLAVEEVSLRK (SEQ ID NO: 27), but not TCRs that bind to CLAVEEVSLRK (SEQ ID NO: 27) only (the latter TCRs would be described as specific for CLAVEEVSLRK (SEQ ID NO: 27) only).
- the peptide AVEEVSLRK (SEQ ID NO:26) can be used as a therapeutic agent (e.g. a vaccine) to treat or prevent AN PM 1 positive AML in HLA-A*03:01 , HLA-A*11 :01 or HLA- A*01 :01 positive patients.
- the peptide itself therefore also has utility e.g. in isolated form or when formulated as a pharmaceutical composition.
- CLAVEEVSLRK (SEQ ID NO:27) is presented by HLA-A*03:01 or HLA-A*11:01. Specific binding to CLAVEEVSLRK (SEQ ID NO:27) may occur in the context of the appropriate HLA (i.e. specific binding to the peptide may occur only when it is presented by the appropriate HLA, as described above).
- T cells with T cell receptors (TCRs) specific for CLAVEEVSLRK (SEQ ID NO:27) presented in the context of HLA-A*03:01 are present in the T cell repertoire from healthy individuals
- HLA-A*03:01 tetramers were produced for CLAVEEVSLRK (SEQ ID NO:27) and its cysteinylated variant and tetramer positive CD8 T cells were isolated from peripheral blood mononuclear cells (PBMC) from healthy individuals.
- PBMC peripheral blood mononuclear cells
- Several tetramer positive T cell clones were tested and one was identified as having specific binding to C*LAVEEVSLRK in the context of HLA-A*03:01 (reactive clone (1F2); Figure 37).
- the inventors have therefore identified a TCR that specifically binds to the neoantigen C*LAVEEVSLRK in the context of HLA-A*03:01 (the TCR from clone 1F2).
- T cells expressing TCRs specific to CLAVEEVSLRK (SEQ ID NO:27) (and specifically to the cysteinylated form of SEQ ID NO:27 i.e. C*LAVEEVSLRK) can therefore be used as an effective immunotherapy in the treatment of HLA-A*03:01 or HLA-A*11:01 positive patients having a AN PM 1 positive AML.
- TCR gene transfer approaches using CLAVEEVSLRK (SEQ ID NO:27) -specific TCRs (and specifically C*LAVEEVSLRK) can therefore bring novel treatment modalities for HLA-A*03:01 and HLA-A*11:01 positive patients having a ANPM1 positive AML.
- the peptide CLAVEEVSLRK (and specifically its cysteinylated form i.e. C*LAVEEVSLRK) can be used as a therapeutic agent (e.g. a vaccine) to treat or prevent ANPM1 positive AML in HLA-A*03:01 or HLA-A*11 :01 positive patients.
- the peptide itself therefore also has utility e.g. in isolated form or when formulated as a pharmaceutical composition.
- the invention provides an isolated nucleic acid sequence encoding:
- a polypeptide comprising a CDR3 of a TCR chain polypeptide that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- the nucleic acid sequence may encode both (a) and (b), wherein (a) and (b) together specifically bind to the peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- the encoded polypeptide(s) may specifically bind to CLAVEEVSL (SEQ ID NO:1).
- the peptide may be in cysteinylated form.
- the encoded polypeptide(s) may therefore specifically bind C*LAVEEVSL (SEQ ID NO:1 in cysteinylated form) only.
- the encoded polypeptide(s) may specifically bind to AVEEVSLRK (SEQ ID NO:26).
- the encoded polypeptide(s) may specifically bind to CLAVEEVSLRK (SEQ ID NO:27).
- the peptide may be in cysteinylated form.
- the encoded polypeptide(s) may therefore specifically bind C*LAVEEVSLRK (SEQ ID NO:27 in cysteinylated form) only.
- the isolated nucleic acid sequence may comprise one or more features of the TCR of clone 1A2 described herein.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to CAVTGARLMF (SEQ ID NO:2).
- the CDR3 of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 3 or SEQ ID NO:4, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to CASSPGGLSNEQF (SEQ ID NO:5).
- the CDR3 of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 6 or SEQ ID NO:7, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region that specifically binds to the selected peptide (i.e. SEQ ID NO:1, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28 or SEQ ID NO:29).
- polypeptide of (a) may further comprise a TCR a chain constant region.
- polypeptide of (a) may comprise a full length TCR a chain variable region that specifically binds to the selected peptide and a full length TCR a chain constant region.
- the TCR a chain variable region may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:8.
- the TCR a chain variable region of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 9 or SEQ ID NQ:10, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may be within a TCR p chain variable region that specifically binds to the selected peptide (i.e. SEQ ID NO:1, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28 or SEQ ID NO:29).
- polypeptide of (b) may further comprise a TCR chain constant region.
- polypeptide of (b) may comprise a full length TCR p chain variable region that specifically binds to the selected peptide and a full length TCR p chain constant region.
- the TCR p chain variable region of (b) may have an amino acid sequence having at least 90% sequence identity to SEQ I D NO: 11.
- the TCR p chain variable region of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 12 or SEQ ID NO:13, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:8, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 2.
- (a) comprises a TCR a chain constant region.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO: 14 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO: 15.
- the CDR3 of (b) may be within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:11, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 5.
- (b) comprises a TCR p chain constant region.
- the TCR p chain variable region CDR1 may have an amino acid sequence of SEQ ID NO: 16 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO: 17.
- the isolated nucleic acid sequence may comprise one or more features of the TCR of clone 26.2. D6 described herein.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to CAESKGQNFVF (SEQ ID NO:35).
- the CDR3 of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 36, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to CASTTWGTGGHEQYF (SEQ ID NO:43).
- the CDR3 of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 44, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (a) may further comprise a TCR a chain constant region.
- polypeptide of (a) may comprise a full length TCR a chain variable region that specifically binds to the selected peptide and a full length TCR a chain constant region.
- the TCR a chain variable region may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:37.
- the TCR a chain variable region of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 38, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may be within a TCR p chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (b) may comprise a full length TCR p chain variable region that specifically binds to the selected peptide and a full length TCR p chain constant region.
- the TCR p chain variable region of (b) may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:45.
- the TCR chain variable region of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 46, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:37, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 35.
- (a) comprises a TCR a chain constant region.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:39 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:41.
- the CDR3 of (b) may be within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:45, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 43.
- (b) comprises a TCR p chain constant region.
- the TCR p chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:47 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:49.
- the isolated nucleic acid sequence may comprise one or more features of the TCR of clone 6F11 described herein.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to CAVSPAGNQFYF (SEQ ID NO:51).
- the CDR3 of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 52, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to CASSLGSNQPQHF (SEQ ID NO:59).
- the CDR3 of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 60, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (a) may further comprise a TCR a chain constant region.
- polypeptide of (a) may comprise a full length TCR a chain variable region that specifically binds to the selected peptide and a full length TCR a chain constant region.
- the TCR a chain variable region may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:53.
- the TCR a chain variable region of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 54, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may be within a TCR p chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (b) may further comprise a TCR chain constant region.
- polypeptide of (b) may comprise a full length TCR p chain variable region that specifically binds to the selected peptide and a full length TCR p chain constant region.
- the TCR p chain variable region of (b) may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:61.
- the TCR p chain variable region of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 62, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:53, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 51.
- (a) comprises a TCR a chain constant region.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:55 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:57.
- the CDR3 of (b) may be within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:61 , wherein the CDR3 has an amino acid sequence of SEQ ID NO: 59.
- (b) comprises a TCR chain constant region.
- the TCR p chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:63 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:65.
- the isolated nucleic acid sequence may comprise one or more features of the TCR of clone 31.3.F1 described herein.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to CALSGGGQNFVF (SEQ ID NO:67).
- the CDR3 of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 68, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to CASSQGSGFRHF (SEQ ID NO:75).
- the CDR3 of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 76, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (a) may further comprise a TCR a chain constant region.
- polypeptide of (a) may comprise a full length TCR a chain variable region that specifically binds to the selected peptide and a full length TCR a chain constant region.
- the TCR a chain variable region may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:69.
- the TCR a chain variable region of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 70, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (b) may be within a TCR p chain variable region that specifically binds to the selected peptide (e.g. SEQ ID NO:26).
- polypeptide of (b) may further comprise a TCR chain constant region.
- polypeptide of (b) may comprise a full length TCR p chain variable region that specifically binds to the selected peptide and a full length TCR p chain constant region.
- the TCR p chain variable region of (b) may have an amino acid sequence having at least 90% sequence identity to SEQ ID NO:77.
- the TCR p chain variable region of (b) is encoded by the nucleic acid sequence of SEQ ID NO:78, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the CDR3 of (a) may be within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:69, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 67.
- (a) comprises a TCR a chain constant region.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:71 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:73.
- the CDR3 of (b) may be within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:77, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 75.
- (b) comprises a TCR p chain constant region.
- the TCR p chain variable region CDR1 may have an amino acid sequence of SEQ ID NO: 79 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:81.
- the selected peptide CLAVEEVSL (SEQ ID NO:1) may be cysteinylated.
- the selected peptide CLAVEEVSLRK (SEQ ID NO:27) may be cysteinylated.
- the nucleic acid sequence may encode a T cell receptor.
- the inventors have identified that the peptide CLAVEEVSL (SEQ ID NO:1) is presented by HLA-A*02:01 (i.e. is HLA-A*02:01 restricted). Furthermore, the inventors have identified that the peptides AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) are each presented by HLA-A*03:01 or HLA-A*11 :01 , and that AVEEVSLRK (SEQ ID NO:26) is also presented by HLA-A*01 :01. Therefore, specific binding to any one of these peptides may occur in the context of the appropriate HLA (i.e. specific binding to the peptide may occur only when it is presented by the appropriate HLA, as described above).
- the nucleic acid sequence of the invention may be a non-naturally occurring nucleic acid sequence (e.g. it may be that the entire sequence does not occur in its entirety in nature.
- the nucleic acid sequence of the invention may be operably linked to a promoter, wherein the promoter is not naturally associated with equivalent human nucleic acid sequences in nature (e.g. human TCR sequences or fragments thereof); i.e. it is not the entire promoter that is naturally associated with the nucleic acid in its natural environment.
- such promoters may be considered exogenous promoters. Examples of appropriate promoters are described elsewhere.
- the invention provides a vector comprising a nucleic acid sequence of the invention.
- the vector may be a plasmid or a viral vector.
- the vector is selected from the group consisting of an adenovirus, adeno-associated virus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or RNA.
- the vector includes a promoter to which the nucleic acid sequence is operably linked, as described above.
- the invention provides a modified cell transfected or transduced with a nucleic acid sequence of the invention, or a vector of the invention.
- transfected or transduced nucleic acid sequence of the invention, or vector of the invention may be operably linked to a promoter, as described above.
- the modified cell may be selected from the group consisting of a CD8 T cell, a CD4 T cell, an NK cell, an NKT cell, a gamma-delta T cell, a hematopoietic stem cell, a progenitor cell, a T cell line or a NK-92 cell line.
- the invention provides an isolated peptide comprising an amino acid sequence selected from: (i) CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid may or may not be cysteinylated;
- VEEVSLRK (SEQ ID NO:28);
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the peptide may have no more than 20 amino acids.
- the peptide may consist of a sequence selected from:
- the peptide may consist of the sequence of SEQ ID NO:1 , wherein the cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- the peptide may consist of the sequence of SEQ ID NO:27, wherein the cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the invention provides an isolated nucleic acid sequence encoding the peptide of the invention.
- the invention provides a vector comprising the nucleic acid sequence of the invention.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising a nucleic acid sequence of the invention, a vector of the invention, a modified cell of the invention, or an isolated peptide of the invention, and a pharmaceutically acceptable excipient, adjuvant, diluent and/or carrier.
- the pharmaceutical composition may be formulated as a vaccine when the composition comprises an isolated peptide according to the invention (or a nucleic acid or vector encoding said isolated peptide).
- Suitable vaccine formulations for peptides and nucleic acids are well known in the art.
- the invention provides a method of treating or preventing a AN PM 1 positive haematological malignancy in a human subject, the method comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition of the invention.
- the method of treating or preventing a ANPM1 positive haematological malignancy in a human subject may comprise administering to the subject a therapeutically effective amount of a peptide described herein (or a nucleic acid (e.g. RNA or DNA), or vector, encoding the peptide).
- a peptide described herein or a nucleic acid (e.g. RNA or DNA), or vector, encoding the peptide).
- an isolated peptide comprising or consisting of an amino acid sequence selected from:
- VEEVSLRK (SEQ ID NO:28);
- AVEEVSLR (SEQ ID NO:29) may be administered as an immunotherapy (e.g. as a vaccine).
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the haematological malignancy may be a myeloid malignancy.
- the myeloid malignancy may be acute myeloid leukemia.
- the method may induce or enhance a cell mediated immune response in the subject.
- CLAVEEVSL SEQ ID NO:1
- the peptide CLAVEEVSL SEQ ID NO:1 is HLA-A*02:01 restricted.
- the inventors have identified that the peptides AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) are each presented by any one of HLA-A*03:01 and HLA-A*11:01, and that AVEEVSLRK (SEQ ID NO:26) is also presented by HLA-A*01:01.
- CLAVEEVSL (SEQ ID NO:1) and/or CLAVEEVSLRK SEQ ID NO:27 may specifically be in cysteinylated form.
- methods of treating or preventing a ANPM1 positive haematological malignancy in a HLA-A*02:01 positive human subject may preferentially use a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to CLAVEEVSL (SEQ ID NO:1), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding CLAVEEVSL (SEQ ID NO:1), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence CLAVEEVSL (SEQ ID NO:1) (all of which are described elsewhere herein in more detail).
- CLAVEEVSL (SEQ ID NO:1) may specifically be in cysteinylated form.
- methods of treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*03:01 or HLA-A*11:01 may preferentially use a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) (all of which are described elsewhere herein in more detail).
- methods of treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*01 :01 may preferentially use a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding AVEEVSLRK (SEQ ID NO:26), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) (all of which are described elsewhere herein in more detail).
- CLAVEEVSLRK (SEQ ID NO:27) may specifically be in cysteinylated form.
- the invention provides a pharmaceutical composition of the invention for use in treating or preventing a ANPM1 positive haematological malignancy in a human subject.
- composition of the invention for use in treating or preventing a ANPM1 positive haematological malignancy in a human subject may comprise a therapeutically effective amount of a peptide described herein (or a nucleic acid (e.g. RNA or DNA), or vector, encoding the peptide).
- the pharmaceutical composition may comprise an isolated peptide comprising or consisting of an amino acid sequence selected from:
- VEEVSLRK (SEQ ID NO:28);
- the pharmaceutical composition may be for use as an immunotherapy (e.g. as a vaccine).
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the haematological malignancy may be a myeloid malignancy.
- the myeloid malignancy may be acute myeloid leukemia.
- the pharmaceutical composition may be for use in inducing or enhancing a cell mediated immune response in the subject.
- the inventors have identified that the peptide CLAVEEVSL (SEQ ID NO:1) is HLA-A*02:01 restricted. Furthermore, the inventors have identified that the peptides AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) are each presented by HLA-A*03:01 and HLA-A*11:01, and that AVEEVSLRK (SEQ ID NO:26) is also presented by HLA-A*01:01.
- CLAVEEVSL (SEQ ID NO:1) and/or CLAVEEVSLRK (SEQ ID NO:27) may specifically be in cysteinylated form.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to CLAVEEVSL (SEQ ID NO:1), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding CLAVEEVSL (SEQ ID NO:1), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence CLAVEEVSL (SEQ ID NO:1) (all of which are described elsewhere herein in more detail) may be preferentially used when treating or preventing a ANPM1 positive haematological malignancy in a HLA-A*02:01 positive human subject.
- CLAVEEVSL (SEQ ID NO:1) may specifically be in cysteinylated form.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) (all of which are described elsewhere herein in more detail) may be preferentially used when treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*03:01 or HLA-A*11 :01.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or a nucleic acid encoding AVEEVSLRK (SEQ ID NO:26), a vector encoding such nucleic acid sequences or a protein or peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) (all of which are described elsewhere herein in more detail) may be preferentially used when treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*01 :01.
- CLAVEEVSLRK (SEQ ID NO:27) may specifically be in cysteinylated form.
- the invention provides for the use of a pharmaceutical composition of the invention in the manufacture of a medicament for treating or preventing a AN PM 1 positive haematological malignancy in a human subject.
- the pharmaceutical composition may comprise a therapeutically effective amount of a peptide described herein (or a nucleic acid (e.g. RNA or DNA), or vector, encoding the peptide).
- the pharmaceutical composition may comprise an isolated peptide comprising or consisting of an amino acid sequence selected from:
- VEEVSLRK (SEQ ID NO:28);
- the pharmaceutical composition may be for use as an immunotherapy (e.g. as a vaccine).
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the haematological malignancy may be a myeloid malignancy.
- the myeloid malignancy may be acute myeloid leukemia.
- CLAVEEVSL (SEQ ID NO:1) is HLA-A*02:01 restricted. Furthermore, the inventors have identified that the peptides AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) are each presented by HLA-A*03:01 and HLA-A*11:01, and that AVEEVSLRK (SEQ ID NO:26) is also presented by HLA-A*01:01. CLAVEEVSL (SEQ ID NO:1) and/or CLAVEEVSLRK (SEQ ID NO:27) may specifically be in cysteinylated form.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to CLAVEEVSL(SEQ ID NO:1), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or an isolated peptide comprising the sequence CLAVEEVSL (SEQ ID NO:1) (all of which are described elsewhere herein in more detail) may be preferentially used in the manufacture of a medicament for treating or preventing a AN PM 1 positive haematological malignancy in a HLA- A*02:01 positive human subject.
- CLAVEEVSL (SEQ ID NO:1) may specifically be in cysteinylated form.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or an isolated peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) (all of which are described elsewhere herein in more detail) may be preferentially used in the manufacture of a medicament for treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*03:01 or HLA-A*11:01.
- a pharmaceutical composition comprising a nucleic acid sequence encoding a polypeptide with specific binding to AVEEVSLRK (SEQ ID NO:26), a vector encoding such nucleic acid sequences, modified cells comprising such nucleic acid sequences or vectors, or an isolated peptide comprising the sequence AVEEVSLRK (SEQ ID NO:26) (all of which are described elsewhere herein in more detail) may be preferentially used in the manufacture of a medicament for treating or preventing a ANPM1 positive haematological malignancy in a human subject that is positive for HLA-A*01 :01.
- CLAVEEVSLRK (SEQ ID NO:27) may specifically be in cysteinylated form.
- the invention provides a method of generating a T cell receptor, comprising contacting a nucleic acid sequence of the invention with a cell under conditions in which the nucleic acid sequence is incorporated and expressed by the cell to generate the T cell receptor that specifically binds to a peptide selected from SEQ ID NO:1 , SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28 and SEQ ID NO:29.
- the method may be ex vivo.
- specific binding to any one of CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) may occur in the context of the appropriate HLA (e.g. specific binding to the peptide may only occur when it is presented by the appropriate HLA, as described above).
- the invention provides for the use of a peptide as a biomarker for a AN PM 1 positive haematological malignancy in a human subject, wherein the peptide is selected from:
- VEEVSLRK (SEQ ID NO:28);
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- the cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the invention provides a method of diagnosing a AN PM 1 positive haematological malignancy in a human subject comprising: determining the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from: (i) CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid may or may not be cysteinylated; (ii) AVEEVSLRK (SEQ ID NO:26); (iii) CLAVEEVSLRK (SEQ ID NO:27), wherein the cysteine amino acid may or may not be cysteinylated; (iv) VEEVSLRK (SEQ ID NO:28); and AVEEVSLR (SEQ ID NO:29), wherein the presence of the peptide in the sample identifies the subject as having a ANPM1 positive haematological malignancy and wherein the absence of the peptid
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the invention provides a method of treating or preventing a AN PM 1 positive haematological malignancy in a human subject, the method comprising: (i) determining the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from CLAVEEVSL (SEQ ID NO:1) wherein the cysteine amino acid may or may not be cysteinylated, AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27) wherein the cysteine amino acid may or may not be cysteinylated; VEEVSLRK (SEQ ID NO:28); and AVEEVSLR (SEQ ID NO:29); and (ii) administering to the subject a therapeutically effective amount of a pharmaceutical composition of the invention.
- CLAVEEVSL SEQ ID NO:1 wherein the cysteine amino acid may or may not be cysteinylated
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- the invention provides a pharmaceutical composition of the invention for use in treating or preventing a ANPM1 positive haematological malignancy in a human subject, wherein the subject has been identified as having a AN PM 1 positive haematological malignancy by the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from:
- VEEVSLRK (SEQ ID NO:28);
- a subject that has been identified as having a AN PM 1 positive haematological malignancy is a subject that has already been diagnosed as having a ANPM1 positive haematological malignancy prior to treatment due to the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from:
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- VEEVSLRK (SEQ ID NO:28);
- cysteine amino acid of SEQ ID NO:1 is cysteinylated.
- cysteine amino acid of SEQ ID NO:27 is cysteinylated.
- Figure 1 provides validation of C*LAVEEVSL (SEQ ID NO:1 in cysteinylated form) as peptide eluted from HLA-A*02:01 positive AML with ANPM1. Mass spectra are shown for the eluted peptide from HLA-A*02:01 positive AML10197 with ANPM1 (top) and the synthetic peptide C*LAVEEVSL (SEQ ID NO:1 in cysteinylated form) after cysteinylation of the first residue (bottom). The data show a complete match between the mass spectra of both peptides.
- A Tandem mass spectra for eluted peptides from AML10197 (upper) and AML 3361 (middle) and synthetic peptide C*LAVEEVSL (SEQ ID NO:1 in cysteinylated form) and an eluted peptide from AML3361 and synthetic peptide AVEEVSLRK (lower).
- FIG. 3 shows that CD8 cells for ANPM1 were single cell isolated from PBMC from HLA- A*02:01 positive healthy individuals using a mix of ANPM1-CLA and ANPM1-C*LA pMHC tetramers.
- B shows that CD8 cells for ANPM1 were single cell isolated from PBMC from HLA- A*02:01 positive healthy individuals using a mix of ANPM1-CLA and ANPM1-C*LA pMHC tetramers.
- Tetramer positive T cell clones 1A2 (top) and 4A8 (bottom) were tested for reactivity against HLA-A*02:01 positive T2 cells exogenously loaded with titrated concentrations of uncysteinylated ANPM1 peptide CLAVEEVSL (SEQ ID NO:1) (circles), cysteinylated ANPM1 peptide C*LAVEEVSL (SEQ ID NO:1 in cysteinylated form) 1
- the panel included 3 AML with ANPM1 and 2 AML with wtNPMI .
- T cell clone 1A2 reacted against all 3 AML with ANPM1 to different extents, whereas clone 4A8 recognized only 2 out of 3 AML. Both T cell clones failed to recognize AML with wtNPMI .
- FIG. 4 shows specificity for AN PM 1 after TCR gene transfer.
- the genes for the AN PM 1- specific TCR a and chains of clone 1A2 were cloned into a modified MP71-TCR-flex retroviral vector for TCR gene transfer.
- CD8 and CD4 cells isolated from HLA-A*02:01 positive healthy individuals were retrovirally transduced with the TCR for AN PM 1 and, as a control, with the TCR for the HLA-A*02:01-restricted CMV peptide NLVPMVATV (SEQ ID NO:31).
- TCR-transduced T cells were purified using an APC-conjugated antibody against mouse TCR-Cp and magnetic anti-APC beads.
- TCR-transduced T cells were analyzed by flow cytometry at day 7 after transduction using antibodies against CD8 or CD4 and pMHC tetramers for CLAVEEVSL (SEQ ID NO:1) (ANPM1-CLA; left) or NLVPMVATV (SEQ ID NO:31) (CMV-NLV; right).
- CD8 (CD80NPM1) and CD4 (CD40NPM1) cells transduced with the TCR for ANPM1 stained with the ANPM1-CLA tetramer, but not with the CMV-NLV tetramer.
- CD8 (CD80CMV) and CD4 (CD40CMV) T cells transduced with the CMV-specific TCR showed binding to the CMV-NLV tetramer, but not to the ANPM1-CLA tetramer. Results are shown for donor 1 , but results were similar for donor 2.
- B. TCR-transduced T cells were analyzed for reactivity against their target peptides by IFN-y ELISA.
- TCR-transduced CD8 and CD4 cells were co-incubated with T2 cells exogenously loaded with titrated concentrations of ANPM1 peptide CLAVEEVSL (SEQ ID NO:1) (circles) or CMV-derived peptide NLVPMVATV (SEQ ID NO:31) (squares).
- CD80NPM1 (upper left) and CD40NPM1 (lower left) showed half maximum recognition of T2 cells loaded with CLAVEEVSL (SEQ ID NO:1) at concentrations of 30-100 nM (dotted lines), but no recognition of T2 cells loaded with NLVPMVATV.
- CD80CMV upper right
- CD40CMV lower right
- reacted against T2 cells loaded with NLVPMVATV SEQ ID NO:31
- CLAVEEVSL SEQ ID NO:1
- Mean release of IFN-y ng/ml
- donor 1 results were similar for donor 2.
- TCR-transduced T cells (CD80NPM1 and CD40NPM1 represented by black bars; CD80CMV and CD40CMV represented by grey bars) were tested for recognition of HLA-A*02:01 positive AML cell lines with ANPM1 (OCI-AML3) or wtNPMI (OCI-AML2) in the absence or presence of blocking antibodies against HLA class I (W6/32) or HLA class II (PdV5.1) by IFN-y ELISA. Recognition of OCI-AML3 by CD8 and CD4 cells transduced with the TCR for AN PM 1 is mediated by HLA class I. Mean release of IFN-y (ng/ml) in duplicate wells is shown for donor 2.
- Figure 5 shows recognition of AN PM 1 on primary AM L after TCR gene transfer.
- TCR- transduced CD8 and CD4 cells were tested for reactivity against a panel of 13 HLA-A*02:01 positive primary AML including 9 samples with ANPM1 and 4 samples with wtNPMI by IFN-y ELISA.
- CD8 CD80NPM1 ; top panel; black bars
- CD4 CD40NPM1 ; bottom panel; black bars
- CD8 CD80CMV; top panel; dark grey bars
- CD4 CD40CMV; bottom panel; dark grey bars
- TCR-transduced CD8 and CD4 cells also failed to recognize HLA-A*02:01 negative AML with ANPM1 (data not shown).
- the allo-A2 clone (light grey bars) is included as positive control. Mean release of IFN-y (ng/ml) in duplicate wells is shown for donor 1.
- FIG. 6 shows TCR-transduced T cells tested on monocyte-derived mature DC by IFN-y ELISA.
- T cells from donor 2 transduced with the TCR for ANPM1 (CD80NPM1 and CD40NPM1 ; black bars) or CMV (CD80CMV and CD40CMV; middle grey bars) were tested for reactivity against autologous monocyte-derived mature DC as well as ANPM1 positive AML that were HLA-A*02:01 positive (AML8861) or negative (AML587).
- Figure 7 shows lysis of primary AML with ANPM1 after TCR gene transfer in 51 Cr release assays.
- TCR-transduced CD8 and CD4 cells were tested for cytolytic capacity by 9 hrs 51 Cr- release assay on a panel of 6 HLA-A*02:01 positive primary AML including 4 samples with ANPM1 and 2 samples with wtNPMI .
- CD8 (CD80NPM1 ; black circles) and CD4 (CD40NPM1 ; black squares) cells transduced with the TCR for ANPM1 showed specific lysis of all 4 AML with ANPM1 , but not of AML with wtNPMI , whereas none of the 6 AML samples were specifically lysed by CD8 (CD80CMV; grey circles) or CD4 (CD40CMV; bottom panel; grey squares) cells after transfer of the CMV-specific TCR.
- the allo-A2 clone (grey triangles) is included as positive control. Mean percentage of specific lysis in triplicate wells is shown at an E:T ratio of 30:1 for donor 2, but results were similar for donor 1.
- Figure 8 shows the immunogenic peptide amino acid sequence of SEQ ID NO:1. It is noted that the cysteine amino acid of SEQ ID NO:1 may or may not be cysteinylated.
- Figure 9 shows an amino acid sequence of CDR3 (TCR a chain) (SEQ ID NO:2).
- Figure 10 shows a non-optimised nucleic acid sequence encoding CDR3 (TCR a chain) (SEQ ID NO:3).
- Figure 11 shows an optimised nucleic acid sequence encoding CDR3 (TCR a chain) (SEQ ID NO:4).
- Figure 12 shows an amino acid sequence of CDR3 (TCR p chain) (SEQ ID NO:5).
- Figure 13 shows a non-optimised nucleic acid sequence encoding CDR3 (TCR chain) (SEQ ID NO:6).
- Figure 14 shows an optimised nucleic acid sequence encoding CDR3 (TCR p chain) (SEQ ID NO:7).
- Figure 15 shows an amino acid sequence of a chain variable region (SEQ ID NO: 8) (CDR3 underlined)
- Figure 16 shows a non-optimised nucleic acid sequence encoding a chain variable region (SEQ ID NO: 9) (CDR3 underlined).
- Figure 17 shows an optimised nucleic acid sequence encoding a chain variable region (SEQ ID NO: 10) (CDR3 underlined).
- Figure 18 shows an amino acid sequence of p chain variable region (SEQ ID NO: 11) (CDR3 underlined).
- Figure 19 shows a non-optimised nucleic acid sequence encoding p chain variable region (SEQ ID NO: 12) (CDR3 underlined).
- Figure 20 shows an optimised nucleic acid sequence encoding chain variable region (SEQ ID NO: 13) (CDR3 underlined).
- Figure 21 shows an amino acid sequence of CDR1 (TOR a chain) (SEQ ID NO: 14).
- Figure 22 shows an amino acid sequence of CDR2 (TCR a chain) (SEQ ID NO: 15).
- Figure 23 shows an amino acid sequence of CDR1 (TCR p chain) (SEQ ID NO: 16).
- Figure 24 shows an amino acid sequence of CDR2 (TCR p chain) (SEQ ID NO: 17).
- Figure 25 shows a non-optimised nucleic acid sequence encoding CDR1 (TCR a chain) (SEQ ID NO:18).
- Figure 26 shows an optimised nucleic acid sequence encoding CDR1 (TCR a chain) (SEQ ID NO:19).
- Figure 27 shows a non-optimised nucleic acid sequence encoding CDR2 (TCR a chain) (SEQ ID NQ:20).
- Figure 28 shows an optimised nucleic acid sequence encoding CDR2 (TCR a chain) (SEQ ID NO:21).
- Figure 29 shows a non-optimised nucleic acid sequence encoding CDR1 (TCR p chain) (SEQ ID NO:22).
- Figure 30 shows an optimised nucleic acid sequence encoding CDR1 (TCR p chain) (SEQ ID NO:23).
- Figure 31 shows a non-optimised nucleic acid sequence encoding CDR2 (TCR p chain) (SEQ ID NO:24).
- Figure 32 shows an optimised nucleic acid sequence encoding CDR2 (TCR p chain) (SEQ ID NO:25).
- Figure 33 shows the immunogenic peptide amino acid sequence of SEQ ID NO:26.
- Figure 34 shows the immunogenic peptide amino acid sequence of SEQ ID NO:27. It is noted that the cysteine amino acid of SEQ ID NO:27 may or may not be cysteinylated.
- Figure 35 shows the immunogenic peptide amino acid sequence of SEQ ID NO:28.
- Figure 36 shows the immunogenic peptide amino acid sequence of SEQ ID NO:29.
- Figures 37 to 39 show T cells for AN PM 1 peptides in A*03;01 and A*11 :01.
- Figure 37 shows T-cell clones binding to PE-conjugated HLA-A*03:01 UV-C*LA (clone 1 F2; left), A*03:01 AVE (clone 3B3; middle) and A*11 :01 AVE (clone 6F11 ; right) tetramers are shown.
- FIG 38 shows T-cell clone 3B3 (left) was tested for reactivity against T2 cells transduced with HLA-A*03:01 that were exogenously pulsed with titrated concentrations of ANPM1 peptides AVEEVSLRK (SEQ ID NO:26) (triangles), CLAVEEVSLRK (SEQ ID NO:27) (circles) or C*LAVEEVSLRK (SEQ ID NO:27 in cysteinylated form) (squares). Indicated is the release of GM- CSF (ng/ml) at different peptide concentrations (nM).
- T-cell clone 6F11 (right) was tested for reactivity against T2 cells transduced with HLA-A*11 :01 that were exogenously pulsed with titrated concentrations of ANPM1 peptide AVEEVSLRK (SEQ ID NO:26) (triangles). Indicated is the release of IFN-y (ng/ml) at different peptide concentrations (nM).
- Figure 39 shows T-cell clones 3B3 (left) and 6F11 (right) were tested for reactivity against K562 cells, K562 transduced with HLA-A*03:01 or A*11 :01, K562 transduced with HLA-A*03:01 or A*11 :01 as well as the genes encoding full-length wildtype or ANPM1 , and the OCI-AML2 and OCI-AML3 cell lines endogenously expressing wildtype and ANPM1 , respectively, transduced with A*03:01 or A*11 :01. Indicated is the release of GM-CSF (clone 3B3) or IFN-y (clone 6F11) in ng/ml.
- GM-CSF clone 3B3
- IFN-y clone 6F11
- Figure 40 shows T cell clones for mutant NPM1 in HLA-A*03:01 or HLA-A*11 :01.
- Figure 40(A) shows the activity of T cell clone 31.3.F1 that has been isolated from an HLA-A*03:01 positive healthy individual.
- the T cell clone showed specific binding to PE-labelled pHLA-A*03:01- AVEEVSLRK (SEQ ID NO:26) tetramer, but not to PE-labelled pHLA-A*03:01-CLAVEEVSLRK (SEQ ID NO:27) tetramer (upper graph). Both pHLA-tetramers did not bind to a control T cell clone (lower two histograms).
- the T cell clone (black bars) specifically reacted against OCI-AML3 (mutant NPM1 ; dNPM1) transduced with HLA-A*03:01 and T2 cells transduced with HLA-A*03:01 pulsed with titrated concentrations of the AVEEVSLRK (SEQ ID NO:26) peptide, but not against OCI-AML3, OCI-AML3 transduced with HLA-A*11:01, OCI-AML2 (wildtype NPM1 ; wtNPMI) and OCI-AML2 transduced with HLA-A*03:01 or HLA-A*11 :01 (middle graph).
- T cell clone also reacted against HLA-A*03:01 positive primary AML with mutant NPM1 , but not HLA-A*03:01 positive AML with wildtype NPM1 (lower graph). Indicated is the mean release of IFN-y in culture supernatants of duplicate wells.
- Figure 40(B) shows the activity of T cell clones 6F11 and 26.2. D6 that have been isolated from an HLA-A*11 :01 positive and HLA-A*11 :01 negative healthy individual, respectively.
- the T cell clones showed specific binding to PE-labelled pH LA-A*11 :01 -AVEEVSLRK (SEQ ID NO:26) tetramer and to a lesser extent to PE-labelled pHLA-A*11 :01-CLAVEEVSLRK (SEQ ID NO:27) (upper graph). Both pHLA- tetramers did not bind to a control T cell clone (lower two histograms). In IFN-y ELISA, the T cell clones 6F11 (grey shaded bars) and 26.2.
- D6 black bars specifically reacted against OCI-AML3 (mutant NPM1 ; dNPM1) transduced with HLA-A*11 :01 and T2 cells transduced with HLA-A*11 :01 pulsed with titrated concentrations of the AVEEVSLRK (SEQ ID NO:26) peptide, but not against OCI-AML3, OCI-AML3 transduced with HLA-A*03:01 , OCI-AML2 (wildtype NPM1 ; wtNPMI) and OCI-AML2 transduced with HLA-A*03:01 or HLA-A*11 :01 (middle graph).
- the T cell clones also reacted against HLA-A*11 :01 positive primary AML with mutant NPM1 , but not HLA-A*11 :01 positive AML with wildtype NPM1 (lower graph). Indicated is the mean release of IFN-y in culture supernatants of duplicate wells.
- Figure 41 shows the activity of TCR-T cells for mutant NPM1 in HLA-A*03:01 or HLA-A*11 :01.
- Figure 41(A) relates to the HLA-A*03:01 restricted TCR for mutant NPM1 of clone 31.3.F1 , which has been sequenced, cloned and introduced in CD8+ cells from an HLA-A*03:01 positive healthy individual (donor 10231).
- donor 10231 As a control, the HLA-A*03:01 restricted TCR for EBNA3A was introduced.
- TCR-T cells were isolated, restimulated and tested for binding to pHLA-tetramers and reactivity against AML by IFN-y ELISA.
- the TCR-T cells showed specific binding to the PE- labelled pHLA*03:01-AVEEVSLRK tetramer (upper graph).
- the pHLA-tetramer did not bind to EBNA3A TCR-T cells (lower histogram).
- TCR-T cells for mutant NPM1 in HLA- A*03:01 black bars specifically reacted against OCI-AML3 (mutant NPM1 ; dNPM1) transduced with HLA-A*03:01 and EBV-B cells from an HLA-A*03:01 positive individual pulsed with a mix of dNPM1 and EBNA3A peptides, but not against non-pulsed EBV-B cells, OCI-AML3, OCI-AML3 transduced with HLA-A*11:01 , OCI-AML2 (wildtype NPM1 ; wtNPMI) and OCI-AML2 transduced with HLA-A*03:01 or HLA-A*11 :01 (middle graph).
- Figure 41(B) relates to the HLA-A*11 :01 restricted T cell receptor (TCR) for mutant NPM1 of clone 6F11 , which has been sequenced, cloned and introduced in CD8+ cells from an HLA-A*11 :01 positive healthy individual (donor 10095).
- TCR-T cells were isolated, restimulated and tested for pHLA-tetramer binding and reactivity against AML by IFN-y ELISA.
- the TCR-T cells showed specific binding to the PE-labelled pHLA*11 :01-AVEEVSLRK tetramer and to a lesser extent to PE-labelled pH LA-A*11 :01-CLAVEEVSLRK tetramer (upper graph). Both pHLA-tetramers did not bind to EBNA3B TCR-T cells (lower two histograms).
- TCR-T cells for dNPM1 in HLA-A*11 :01 black bars specifically reacted against OCI-AML3 (mutant NPM1 ; dNPM1) transduced with HLA-A*11 :01 and EBV-B cells from an HLA-A*11 :01 positive individual pulsed with a mix of dNPM1 and EBNA3B peptides, but not against non-pulsed EBV-B cells, OCI-AML3, OCI-AML3 transduced with HLA-A*03:01 , OCI-AML2 (wildtype NPM1 ; wtNPMI) and OCI-AML2 transduced with HLA-A*11 :01 or HLA-A*03:01 (middle graph).
- OCI-AML3 wildtype NPM1 ; wtNPMI
- Figure 41 (C) relates to the HLA-A*11 :01 restricted T cell receptor (TCR) for mutant NPM1 of clone 26.2. D6, which has been sequenced, cloned and introduced in CD8+ cells from an HLA-A*11 :01 positive healthy individual (donor 10231). As a control, the HLA-A*11 :01 restricted TCR for EBNA3B was introduced. TCR- T cells were isolated, restimulated and tested for pHLA-tetramer binding and reactivity against AML by IFN-y ELISA.
- the TCR-T cells showed specific binding to the PE-labelled pHLA*11 :01- AVEEVSLRK tetramer and to a lesser extent to the PE-labelled pHLA*11 :01-CLAVEEVSLRK tetramer (upper graph). Both pHLA-tetramers did not bind to EBNA3B TCR-T cells (lower two histograms).
- TCR-T cells for dNPM1 in HLA-A*11 :01 black bars specifically reacted against OCI-AML3 (mutant NPM1 ; dNPM1) transduced with HLA-A*11 :01 and EBV-B cells from an HLA-A*11 :01 positive individual pulsed with a mix of dNPM1 and EBNA3B peptides, but not against non-pulsed EBV-B cells, OCI-AML3, OCI-AML3 transduced with HLA-A*03:01 , OCI-AML2 (wildtype NPM1 ; wtNPMI) and OCI-AML2 transduced with HLA-A*11:01 or HLA- A*03:01 (middle graph). Indicated is the mean release of IFN-y in culture supernatants of duplicate wells.
- FIG 42 shows reactivity of T cell clones for mutant NPM1 in HLA-A*11 :01 against healthy hematopoietic cell types.
- the T cell clones 26.2. D6 and 6F11 which are both specific for mutant NPM1 in HLA-A*11 :01 , were tested against PHA-T cells, PBMC and monocyte-derived dendritic cells (moDCs) from HLA-A*11 :01 positive healthy donor PBL3499 by IFN-y ELISA. Both T cell clones failed to recognize the healthy hematopoietic cell types, whereas all cell types were recognized after exogenous pulsing of the mutant NPM1 derived AVEEVSLRK peptide.
- Figure 43 shows TCR-T cells for mutant NPM1 in HLA-A*11 :01 are reactive against AML in vitro.
- CD8 cells from an HLA-A*11 :01 positive healthy individual were transduced with the HLA-A*11 :01 restricted mutant NPM1 specific (dNPM1-A11) 26.2D6 or 6F11 TCR and tested for reactivity against OCI-AML2 (wildtype NPM1) transduced with HLA-A*11 :01, OCI-AML3 (mutant NPM1) transduced with HLA-A*11 :01 and patient AML case 10535 (mutant NPM1 ; HLA-A*11 :01) and AML case JHZ8388 (wildtype NPM1 ; HLA-A*11 :01) by IFN-y ELISA.
- dNPM1-A11 TCR-T cells were produced with wildtype endogenous human TCRa and genes or with both genes knocked out by CRISPR/C
- Figure 44 shows TCR-T cells for mutant NPM1 in HLA-A*11 :01 are reactive against AML in vivo.
- Immunodeficient NSG-hlL7/hlL15 mice were engrafted with 1x10 A 6 OCI-AML3 (mutant NPM1) cells transduced with HLA-A*11 :01.
- the OCI-AML3 cell line was also transduced with luciferase to follow in vivo tumor growth.
- mice received infusions of 3x10 A 6 CD8 cells transduced with either the HLA-A*11 :01 restricted mutant NPM1 specific (dNPM1-A11) 6F11 or 26.2D6 TCR.
- mice were treated with CD8 cells transduced with the HLA-A*02:01 restricted mutant NPM1 specific 1A2 TCR as positive control and with CD8 cells transduced with an HLA-A*11 :01 restricted EBNA3B-specific TCR as negative control. Mice were sacrificed on day 7 after infusion of the TCR-T cells.
- ANPM1 mutant NPM1
- CLAVEEVSL SEQ ID NO:1
- CD8 + T cells isolated from healthy individuals and ANPM1 AML patients were stimulated with the peptides and T cell response was measured. Only two of the tested peptides (AIQDLCLAV (SEQ ID NO:32) and AIQDLCVAV (SEQ ID NO:33)) were found to elicit an immune response in vitro. These peptides were therefore considered to be most significant epitopes of AN PM 1, and thus were used for further study.
- the inventors have now identified five different peptides that are present in the HLA class I ligandome of ANPM1 positive primary AML (namely CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO: 27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29)).
- CLAVEEVSL SEQ ID NO:1 positive primary AML
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO: 27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- CLAVEEVSL SEQ ID NO:1
- peptide that is presented on the surface of primary ANPM1 AML cells isolated from HLA-A*02:01 cancer patients, and furthermore that the peptide is found in cysteinylated form on the surface of the isolated primary AML cells.
- AN PM 1 -derived peptides AVEEVSLRK (SEQ ID NO:26) and CLAVEEVSLRK (SEQ ID NO:27) are each presented by HLA-A*03:01 and HLA-A*11 :01 , and that AVEEVSLRK is also presented by HLA-A*01 :01.
- T cell receptors that are reactive with CLAVEEVSL (SEQ ID NO:1) from the T cell repertoire of healthy HLA-A*02:01 positive individuals. They have demonstrated that these T cell receptors can be used for genetic engineering of peripheral blood lymphocytes and that the genetically modified lymphocytes effectively kill HLA-A*02:01 positive AML having ANPM1.
- these TCRs can be used as an effective immunotherapy in the treatment of HLA-A*02:01 positive patients having a ANPM1 positive AML.
- the inventors have also isolated a T cell clone that is reactive with CLAVEEVSLRK (SEQ ID NO:27) (specifically, the cysteinylated variant of this peptide) from the T cell repertoire of healthy HLA-A*03:01 positive individuals.
- the TCR from this clone can be used as an effective immunotherapy in the treatment of HLA-A*03:01 positive patients having a ANPM1 positive AML.
- the inventors have also isolated four T cell clones that are reactive with AVEEVSLRK (SEQ ID NO:26) from the T cell repertoire of healthy HLA-A*03:01 or HLA-A*11 :01 positive individuals.
- T cell clone 26.2 is reactive with CLAVEEVSLRK (SEQ ID NO:27) (specifically, the cysteinylated variant of this peptide) from the T cell repertoire of healthy HLA-A*03:01 positive individuals.
- the TCR from this clone can be used as an effective immunotherapy in the
- D6 has been isolated from an HLA-A*11:01 negative (but A*03:01 positive) individual.
- 6F11 and 31.3.F1 have been isolated from an HLA-A*11:01+ and A*03:01 + individual, respectively.
- the TCRs from these clones can be used as an effective immunotherapy in the treatment of HLA-A*03:01 and HLA-A*11:01 positive patients having a AN PM 1 positive AML.
- the invention provides nucleic acid sequences that encode T cell receptor components that specifically bind to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- the nucleic acid sequences may form part of a larger nucleic acid sequence that encodes a larger component part of a T cell receptor (e.g. TCR a chain variable region, a TCR p chain variable region, a TCR a chain, a TCR chain etc).
- the nucleic acid sequences may also form part of a larger nucleic acid sequence that encodes a functioning T cell receptor (i.e. encodes a functional TCR a chain and a functional TCR p chain, optionally separated by a linker sequence that enables coordinate expression of two proteins or polypeptides by the same vector). More details on this are provided below.
- the nucleic acid sequences may encode a small component of a T cell receptor e.g. a CDR3 domain of a TCR a chain polypeptide, or a CDR3 domain of a TCR p chain polypeptide only.
- the nucleic acid sequence may therefore be considered as a “building block” that provides an essential component for peptide specificity.
- the nucleic acid sequence of the invention may be incorporated into a distinct nucleic acid sequence (e.g.
- a vector that encodes the other elements of a TCR variable chain, such that when the nucleic acid sequence of the invention is incorporated, a new nucleic acid sequence is generated that encodes a TCR a chain variable region and/or a TCR p chain variable region that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- a nucleic acid sequence of the invention therefore has utility as an essential component of TCR specificity for the selected ANPM1 peptide, and thus can be used to generate a nucleic acid sequence encoding a TCR variable region with the required antigen binding activity and specificity to target ANPM1 positive AML.
- a T cell receptor is a molecule found on the surface of T cells (T lymphocytes) that is responsible for recognising a peptide that is bound to (presented by) a major histocompatibility complex (MHC) molecule on a target cell.
- MHC major histocompatibility complex
- the invention is directed to nucleic acid sequences that encode TCRs that interact with a particular peptide in the context of the appropriate serotype of MHC, e.g.
- CLAVEEVSL in the context of HLA-A*02:01 ; or one of AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27), each in the context of one of HLA-A*03:01 and HLA-A*11:01, or AVEEVSLRK (SEQ ID NO:26) in the context of HLA- A*01:01.
- HLA-A*02:01 is a globally common human leukocyte antigen serotype within the HLA-A serotype group. Peptides that are presented by HLA-A*02:01 to TCRs are described as being “HLA-A*02:01 restricted”.
- HLA-A*03:01 , HLA-A*11:01 and HLA-A*01 :01 are also common human leukocyte antigen serotypes within the HLA-A serotype group.
- Peptides that are presented by HLA-A*03:01 to TCRs are described as being “HLA-A*03:01 restricted”.
- peptides that are presented by HLA-A*11:01 to TCRs are described as being “HLA-A*11 :01 restricted”.
- peptides that are presented by HLA-A*01:01 to TCRs are described as being “HLA-A*01 :01 restricted”.
- the TCR is composed of two different polypeptide chains. In humans, 95% of TCRs consist of an alpha (a) chain and a beta (P) chain (encoded by TRA and TRB respectively). When the TCR engages with peptide in the context of HLA (e.g. in the context of HLA-A*02:01 , HLA- A*03:01 or HLA-A*11:01, as appropriate), the T cell is activated through signal transduction.
- the alpha and beta chains of the TCR are highly variable in sequence. Each chain is composed of two extracellular domains, a variable region (V) and a constant region (C). The constant region is proximal to the T cell membrane followed by a transmembrane region and a short cytoplasmic tail while the variable region binds to the peptide/HLA-A complex.
- variable region of each chain has three hypervariable regions (also called complementarity determining regions (CDRs)).
- CDRs complementarity determining regions
- the TCR alpha chain comprises a CDR1, a CDR2 and a CDR3
- the TCR beta chain also comprises a (different) CDR1, CDR2, and a CDR3.
- the invention provides an isolated nucleic acid sequence encoding: (a) a polypeptide comprising a CDR3 of a TCR a chain polypeptide that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29); and/or (b) a polypeptide comprising a CDR3 of a TCR p chain polypeptide that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- the encoded polypeptide(s) specifically bind to CLAVEEVSL (SEQ ID NO:1).
- CLAVEEVSL (SEQ ID NO:1) may be in cysteinylated form.
- the encoded polypeptide(s) may specifically bind the cysteinylated form only.
- the encoded polypeptide(s) specifically bind to AVEEVSLRK (SEQ ID NO:26).
- the encoded polypeptide(s) specifically bind to CLAVEEVSLRK (SEQ ID NO:27).
- CLAVEEVSLRK (SEQ ID NO:27) may be in cysteinylated form.
- the encoded polypeptide(s) may specifically bind the cysteinylated form only.
- the nucleic acid sequence may encode (a), (b), or (a) and (b).
- the nucleic acid sequence therefore encodes at least one polypeptide comprising a CDR3 of a T cell receptor polypeptide, wherein the CDR3 specifically binds to one of the following peptides: CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) or AVEEVSLR (SEQ ID NO:29).
- the nucleic acid sequence may include an alpha chain CDR3 and a beta chain CDR3, wherein the alpha chain CDR3 and the beta chain CDR3 together specifically bind to the selected peptide.
- the nucleic acid sequence therefore encodes a “CDR3 of a TCR a chain polypeptide” (also referred to herein as an alpha chain CDR3, or an a chain CDR3) and/or a “CDR3 of a TCR p chain polypeptide” (also referred to herein as a beta chain CDR3, or an chain CDR3).
- the alpha chain CDR3 may be that of SEQ ID NO:2 or one of the variants described below.
- beta chain CDR3 may be that of SEQ ID NO:5 or one of the variants described below. It is noted that these specific CDR3 have been found by the inventors to specifically bind to the peptide of SEQ ID NO:1.
- the alpha chain CDR3 may be that of SEQ ID NO:35 or one of the variants described below.
- the beta chain CDR3 may be that of SEQ ID NO:43 or one of the variants described below. It is noted that these specific CDR3 have been found by the inventors to specifically bind to the peptide of SEQ ID NO:26.
- the alpha chain CDR3 may be that of SEQ ID NO:51 or one of the variants described below.
- the beta chain CDR3 may be that of SEQ ID NO:59 or one of the variants described below. It is noted that these specific CDR3 have been found by the inventors to specifically bind to the peptide of SEQ ID NO:26.
- the alpha chain CDR3 may be that of SEQ ID NO:67 or one of the variants described below.
- the beta chain CDR3 may be that of SEQ ID NO:75 or one of the variants described below. It is noted that these specific CDR3 have been found by the inventors to specifically bind to the peptide of SEQ ID NO:26.
- any of the permutations described below for (a) may be combined with the permutations described below for (b) (e.g. to form an appropriate nucleic acid sequence that encodes a functioning T cell receptor (i.e. encodes a functional TCR a chain and TCR chain, optionally separated by a linker sequence that enables coordinate expression of two proteins or polypeptides by the same vector).
- a functioning T cell receptor i.e. encodes a functional TCR a chain and TCR chain, optionally separated by a linker sequence that enables coordinate expression of two proteins or polypeptides by the same vector.
- the CDR3 of (a) may have an amino acid sequence of SEQ ID NO:2, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:2.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:2, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 2 that do not specifically bind to SEQ ID NO:1.
- Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:2 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:2, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:1.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:2 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:2).
- the CDR3 of (a) has the amino acid sequence of SEQ ID NO:2
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:3 or SEQ ID NO:4, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:4 is the codon optimised version of the nucleic acid sequence for CDR3 of clone 1A2 (the nonoptimised sequence being SEQ ID NO:3).
- polypeptide of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:3 or SEQ ID NO:4, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:2 or a variant thereof as defined above) within a TCR a chain variable region that specifically binds to the peptide of SEQ ID NO:1.
- the polypeptide of (a) may comprise a TCR a chain variable region which includes the specified CDR3, wherein the TCR a chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:1.
- TCR a chain variable region refers to the variable (V) region (extracellular domain) of a TCR alpha chain, and thus includes three hypervariable regions (CDR1, CDR2 and the specified CDR3), as well as the intervening sequences, but does not include the constant (C) region of the alpha chain, which does not form part of the variable chain.
- the encoded TCR a chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO: 14, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the N-terminus of the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO: 14.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO: 14, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 14 that do not specifically bind to the N-terminus of the peptide of SEQ ID NO:1.
- Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO: 14 or a substitution, insertion or deletion in critical amino acids or critical regions.
- Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (a) may have an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 14, whilst retaining the ability to specifically bind to the N terminus of the peptide of SEQ ID NO:1.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO: 14 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:14).
- the CDR1 of (a) (e.g. within the alpha chain variable region) has the amino acid sequence of SEQ ID NO: 14
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:18 or SEQ ID NO:19, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:19 is the codon optimised version of the nucleic acid sequence for CDR1 of clone 1A2 (the non-optimised sequence being SEQ ID NO:18).
- the polypeptide of (a) may be encoded by the nucleic acid sequence of SEQ ID NO: 18 or SEQ ID NO: 19, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR a chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO: 15, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*02:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO: 15.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO: 15, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 15 that do not specifically bind to HLA-A*02:01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO: 15 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (a) may have an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO:15, whilst retaining the ability to bind to HLA-A*02:01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO: 15 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO: 15).
- the CDR2 of (a) may be encoded by the nucleic acid sequence of SEQ ID NQ:20 or SEQ ID NO:21 , or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:21 is the codon optimised version of the nucleic acid sequence for CDR2 of clone 1A2 (the non-optimised sequence being SEQ ID NQ:20).
- polypeptide of (a) may be encoded by the nucleic acid sequence of SEQ ID NQ:20 or SEQ ID NO:21 , or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may therefore comprise a TCR alpha chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR alpha chain variable region of (a) may have an amino acid sequence of SEQ ID NO:8, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:8.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:8, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 8 that do not specifically bind to SEQ ID NO:1. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:8 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR alpha chain variable region of (a) may have an amino acid sequence having at least 75%, at least 80%, at least 85% or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:8, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:1.
- a functional TCR alpha chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:8 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:8 may all be in regions of the TCR alpha chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 2, SEQ ID NO: 14 and/or SEQ ID NO:15, and still have 25% (or less) sequence variability compared to SEQ ID NO:8).
- the sequence of the CDRs of SEQ ID NO:8 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:8).
- the polypeptide of (a) may comprise the CDR3 within a TCR a chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:8, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 2.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO: 14 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO: 15.
- the TCR alpha chain variable region of (a) has the amino acid sequence of SEQ ID NO:8
- the TCR alpha chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:9 or SEQ ID NQ:10, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NQ:10 is the codon optimised version of the nucleic acid sequence for TCR alpha chain variable region of clone 1 A2 (the non-optimised sequence being SEQ ID NO:9).
- polypeptide of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:9 or SEQ ID NO: 10, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may comprise a TCR a chain variable region (as specified above) and a TCR a chain constant region.
- a suitable constant region is encoded in the MP71-TCR-flex retroviral vector used herein by GenScript.
- the invention is not limited to this specific constant region, and encompasses any appropriate TCR a chain constant region.
- the constant region may be murine derived, human derived or humanised. Methods for identifying or generating appropriate constant regions are well known to a person of skill in the art and are well within their routine capabilities.
- the constant region may be encoded by or derived from a vector, such as a lentiviral, retroviral or plasmid vector but also adenovirus, adeno-associated virus, vaccinia virus, canary poxvirus or herpes virus vectors in which murine or human constant regions are pre-cloned.
- a vector such as a lentiviral, retroviral or plasmid vector but also adenovirus, adeno-associated virus, vaccinia virus, canary poxvirus or herpes virus vectors in which murine or human constant regions are pre-cloned.
- minicircles have also been described for TCR gene transfer (non-viral Sleeping Beauty transposition from minicircle vectors as published by R Monjezi, C Miskey, T Gogishvili, M Schleef, M Schmeer, H Einsele, Z Ivies and M Hudecek in Leukemia 2016).
- naked (synthetic) DNA/RNA can also be used to introduce the TCR.
- a pMSGV retroviral vector with pre-cloned TCR-Ca and Cb genes as described in LV Coren et al., BioTechniques 2015 may be used to provide an appropriate constant region. are in common with the TCR of clone
- the CDR3 of (b) may have an amino acid sequence of SEQ ID NO:5, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:5.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:5, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 5 that do not specifically bind to SEQ ID NO:1. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:5 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:5, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:1.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:5 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:5).
- the CDR3 of (b) has the amino acid sequence of SEQ ID NO:5
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:6 or SEQ ID NO:7, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:7 is the codon optimised version of the nucleic acid sequence for CDR3 of clone 1A2 (the nonoptimised sequence being SEQ ID NO:6).
- the polypeptide of (b) may be encoded by the nucleic acid sequence of SEQ ID NO:6 or SEQ ID NO:7, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:5 or a variant thereof as defined above) within a TCR p chain variable region that specifically binds to the peptide of SEQ ID NO:1.
- the polypeptide of (b) comprises a TCR chain variable region which includes the specified CDR3, wherein the TCR p chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:1.
- TCR p chain variable region refers to the variable (V) region (extracellular domain) of a TCR beta chain, and thus includes three hypervariable regions (CDR1, CDR2 and the specified CDR3) as well as the intervening sequences, but does not include the constant (C) region of the beta chain, which does not form part of the variable chain.
- the encoded TCR p chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO: 16, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the C-terminus of the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO: 16.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO: 16, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 16 that do not specifically bind to the C-terminus of the peptide of SEQ ID NO:1.
- Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:16 or a substitution, insertion or deletion in critical amino acids or critical regions.
- Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:16, whilst retaining the ability to specifically bind to the C terminus of the peptide of SEQ ID NO:1.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO: 16 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:16).
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:22 or SEQ ID NO:23, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:23 is the codon optimised version of the nucleic acid sequence for CDR1 of clone 1A2 (the non-optimised sequence being SEQ ID NO:22).
- polypeptide of (b) may be encoded by the nucleic acid sequence of SEQ ID NO:22 or SEQ ID NO:23, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO: 17, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*02:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO: 17.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:17, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 17 that do not specifically bind to HLA-A*02:01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO: 17 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (b) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:17, whilst retaining the ability to bind to HLA-A*02:01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO: 17 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO: 17).
- the CDR2 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:17
- the CDR2 may be encoded by the nucleic acid sequence of SEQ ID NO:24 or SEQ ID NO:25, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO:25 is the codon optimised version of the nucleic acid sequence for CDR2 of clone 1A2 (the non-optimised sequence being SEQ ID NO:24).
- polypeptide of (b) may be encoded by the nucleic acid sequence of SEQ ID NO:24 or SEQ ID NO:25, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) may therefore comprise a TCR beta chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR beta chain variable region of (b) may have an amino acid sequence of SEQ ID NO:11, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:1).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:11.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:11 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 11 that do not specifically bind to SEQ ID NO:1. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:11 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR beta chain variable region of (b) may have an amino acid sequence having at least 75%, at least 80%, at least 85%, or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:11, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:1.
- a functional TCR beta chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO: 11 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:11 may all be in regions of the TCR beta chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 5, SEQ ID NO:16 and/or SEQ ID NO:17, and still have 25% (or less) sequence variability compared to SEQ ID NO:11).
- the sequence of the CDRs of SEQ ID NO:11 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:11).
- (b) may include the CDR3 within a TCR p chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ I D NO: 11 , wherein the CDR3 has an amino acid sequence of SEQ ID NO: 5.
- the TCR chain variable region CDR1 may have an amino acid sequence of SEQ ID NO: 16
- the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO: 17.
- the TCR beta chain variable region of (b) has the amino acid sequence of SEQ ID NO:11
- the TCR beta chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:12 or SEQ ID NO:13, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- SEQ ID NO: 13 is the codon optimised version of the nucleic acid sequence for TCR beta chain variable region of clone 1A2 (the non-optimised sequence being SEQ ID NO: 12).
- polypeptide of (b) may be encoded by the nucleic acid sequence of SEQ ID NO:12 or SEQ ID NO:13, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- (b) may comprise a TCR p chain variable region (as specified above) and a TCR p chain constant region.
- An example of a suitable constant region is encoded in the MP71-TCR-flex retroviral vector used herein by GenScript.
- the invention is not limited to this specific constant region, and encompasses any appropriate TCR P chain constant region.
- the constant region may be murine derived, human derived or humanised. Methods for identifying or generating appropriate constant regions are well known to a person of skill in the art and are well within their routine capabilities.
- the constant region may be encoded by or derived from a vector, such as a lentiviral, retroviral or plasmid vector but also adenovirus, adeno-associated virus, vaccinia virus, canary poxvirus or herpes virus vectors in which murine or human constant regions are pre-cloned.
- a vector such as a lentiviral, retroviral or plasmid vector but also adenovirus, adeno-associated virus, vaccinia virus, canary poxvirus or herpes virus vectors in which murine or human constant regions are pre-cloned.
- minicircles have also been described for TCR gene transfer (non-viral Sleeping Beauty transposition from minicircle vectors as published by R Monjezi, C Miskey, T Gogishvili, M Schleef, M Schmeer, H Einsele, Z Ivies and M Hudecek in Leukemia 2016).
- naked (synthetic) DNA/RNA can also be used to introduce the TCR.
- a MP71-TCR-flex retroviral vector with pre-cloned TCR-Ca and Cb genes as used by the inventors or a pMSGV retroviral vector with pre-cloned TCR-Ca and Cb genes as described in LV Coren et al., BioTechniques 2015 may be used to provide an appropriate constant region.
- polypeptide (a) - components of the TCR alpha chain that are in common with the TCR of clone 26.2. D6 described herein
- the CDR3 of (a) may have an amino acid sequence of SEQ ID NO:35, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:35.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:35, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 35 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:35 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:35, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:35 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:35).
- the CDR3 of (a) has the amino acid sequence of SEQ ID NO:35
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:36, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:35 or a variant thereof as defined above) within a TCR a chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (a) may comprise a TCR a chain variable region which includes the specified CDR3, wherein the TCR a chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR a chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:39, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the N-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:39.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:39, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 39 that do not specifically bind to the N-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:39 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (a) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:39, whilst retaining the ability to specifically bind to the N terminus of the peptide of SEQ ID NO:26.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:39 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:39).
- the CDR1 of (a) e.g.
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:40, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR a chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:41 , or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*11:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:41.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:41 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 41 that do not specifically bind to HLA-A*11 :01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:41 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (a) may have an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO:41, whilst retaining the ability to bind to HLA-A*11 :01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:41 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:41).
- the CDR2 of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:42, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may therefore comprise a TCR alpha chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR alpha chain variable region of (a) may have an amino acid sequence of SEQ ID NO:37, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:37.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:37, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 37 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:37 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR alpha chain variable region of (a) may have an amino acid sequence having at least 75%, at least 80%, at least 85% or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:37, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR alpha chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:37 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:37 may all be in regions of the TCR alpha chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 35, SEQ ID NO:39 and/or SEQ ID NO:41 , and still have 25% (or less) sequence variability compared to SEQ ID NO:37).
- the sequence of the CDRs of SEQ ID NO:37 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:37).
- the polypeptide of (a) may comprise the CDR3 within a TCR a chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:37, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 35.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:39 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:41.
- the TCR alpha chain variable region of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:38, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- polypeptide of (a) may comprise a TCR a chain variable region (as specified above) and a TCR a chain constant region.
- a suitable constant region is described in detail elsewhere herein, and applies equally here.
- polypeptide polypeptide (b) - components of the TCR beta chain that are in common with the TCR of clone 26.2. D6 described herein.
- the CDR3 of (b) may have an amino acid sequence of SEQ ID NO:43, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:43.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:43, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 43 that do not specifically bind to SEQ ID NO:26.
- Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:43 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:43, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:43 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:43).
- the CDR3 of (b) has the amino acid sequence of SEQ ID NO:43
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:44, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:43 or a variant thereof as defined above) within a TCR p chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (b) comprises a TCR chain variable region which includes the specified CDR3, wherein the TCR P chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR p chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:47, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the C-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:47.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:47, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 47 that do not specifically bind to the C-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:47 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (b) e.g.
- amino acid sequence within the beta chain variable region
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:47 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:47).
- the CDR1 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:47
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:48, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:49, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*11:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:49.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:49, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 49 that do not specifically bind to HLA-A*11 :01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:49 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:49, whilst retaining the ability to bind to HLA-A*11 :01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:49 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:49).
- the CDR2 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:49
- the CDR2 may be encoded by the nucleic acid sequence of SEQ ID NQ:50, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) may therefore comprise a TCR beta chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR beta chain variable region of (b) may have an amino acid sequence of SEQ ID NO:45, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:45.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:45, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO:45 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:45 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR beta chain variable region of (b) may have an amino acid sequence having at least 75%, at least 80%, at least 85%, or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:45, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR beta chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:45 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:45 may all be in regions of the TCR beta chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 43, SEQ ID NO:47 and/or SEQ ID NO:49, and still have 25% (or less) sequence variability compared to SEQ ID NO:45).
- the sequence of the CDRs of SEQ ID NO:45 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:45).
- (b) may include the CDR3 within a TCR p chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:45, wherein the CDR3 has an amino acid sequence of SEQ ID NO:43.
- the TCR chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:47 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:49.
- the TCR beta chain variable region of (b) has the amino acid sequence of SEQ ID NO:45
- the TCR beta chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:46, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- (b) may comprise a TCR p chain variable region (as specified above) and a TCR p chain constant region.
- TCR p chain variable region as specified above
- TCR p chain constant region examples of suitable constant regions are provided elsewhere herein and apply equally here.
- polypeptide (a) - components of the TCR alpha chain that are in common with the TCR of clone 6F11 described herein
- the CDR3 of (a) may have an amino acid sequence of SEQ ID NO:51 , or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:51.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:51 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 51 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a non- conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:51 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:51, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:51 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:51).
- the CDR3 of (a) has the amino acid sequence of SEQ ID NO:51
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:52, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:51 or a variant thereof as defined above) within a TCR a chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (a) may comprise a TCR a chain variable region which includes the specified CDR3, wherein the TCR a chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR a chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:55, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the N-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:55.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:55, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 55 that do not specifically bind to the N-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:55 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (a) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:55, whilst retaining the ability to specifically bind to the N terminus of the peptide of SEQ ID NO:26.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:55 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:55).
- the CDR1 of (a) (e.g. within the alpha chain variable region) has the amino acid sequence of SEQ ID NO:55
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:56, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR a chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:57, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*11:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:57.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:57, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 57 that do not specifically bind to HLA-A*11 :01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:57 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (a) may have an amino acid sequence having at least 85% sequence identity to the amino acid sequence of SEQ ID NO:57, whilst retaining the ability to bind to HLA-A*11 :01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:57 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:57).
- the CDR2 of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:58, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may therefore comprise a TCR alpha chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR alpha chain variable region of (a) may have an amino acid sequence of SEQ ID NO:53, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:53.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:53, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 53 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:53 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR alpha chain variable region of (a) may have an amino acid sequence having at least 75%, at least 80%, at least 85% or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:53, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR alpha chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:53 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:53 may all be in regions of the TCR alpha chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 51 , SEQ ID NO:55 and/or SEQ ID NO:57, and still have 25% (or less) sequence variability compared to SEQ ID NO:53).
- the sequence of the CDRs of SEQ ID NO:53 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:53).
- the polypeptide of (a) may comprise the CDR3 within a TCR a chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:53, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 51.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:55 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:57.
- the TCR alpha chain variable region of (a) has the amino acid sequence of SEQ ID NO:53
- the TCR alpha chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:54, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- polypeptide of (a) may comprise a TCR a chain variable region (as specified above) and a TCR a chain constant region.
- a suitable constant region is described in detail elsewhere herein, and applies equally here.
- polypeptide polypeptide (b) - components of the TCR beta chain that are in common with the TCR of clone 6F11 described herein.
- the CDR3 of (b) may have an amino acid sequence of SEQ ID NO:59, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:59.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:59, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 59 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:59 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:59, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:59 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:59).
- the CDR3 of (b) has the amino acid sequence of SEQ ID NO:59
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NQ:60, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:59 or a variant thereof as defined above) within a TCR p chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (b) comprises a TCR chain variable region which includes the specified CDR3, wherein the TCR P chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR p chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:63, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the C-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:63.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:63, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 63 that do not specifically bind to the C-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:63 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:63, whilst retaining the ability to specifically bind to the C terminus of the peptide of SEQ ID NO:26.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:63 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:63).
- the CDR1 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:63
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:64, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:65, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*11:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:65.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:65, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 65 that do not specifically bind to HLA-A*11 :01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:65 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:65, whilst retaining the ability to bind to HLA-A*11 :01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:65 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:65).
- the CDR2 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:65
- the CDR2 may be encoded by the nucleic acid sequence of SEQ ID NO:66, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) may therefore comprise a TCR beta chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR beta chain variable region of (b) may have an amino acid sequence of SEQ ID NO:61 , or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:61.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:61 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO:61 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:61 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR beta chain variable region of (b) may have an amino acid sequence having at least 75%, at least 80%, at least 85%, or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:61 , whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR beta chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:61 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:61 may all be in regions of the TCR beta chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 59, SEQ ID NO:63 and/or SEQ ID NO:65, and still have 25% (or less) sequence variability compared to SEQ ID NO:61).
- the sequence of the CDRs of SEQ ID NO:61 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:61).
- (b) may include the CDR3 within a TCR p chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:61, wherein the CDR3 has an amino acid sequence of SEQ ID NO:59.
- the TCR chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:63
- the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:65.
- the TCR beta chain variable region of (b) has the amino acid sequence of SEQ ID NO:61
- the TCR beta chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:62, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- (b) may comprise a TCR p chain variable region (as specified above) and a TCR p chain constant region.
- suitable constant regions are provided elsewhere herein and apply equally here.
- the CDR3 of (a) may have an amino acid sequence of SEQ ID NO:67, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:67.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:67, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 67 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:67 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (a) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:67, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:67 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:67).
- the CDR3 of (a) has the amino acid sequence of SEQ ID NO:67
- the CDR3 may be encoded by the nucleic acid sequence of SEQ ID NO:68, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:67 or a variant thereof as defined above) within a TCR a chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (a) may comprise a TCR a chain variable region which includes the specified CDR3, wherein the TCR a chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR a chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:71 , or functional variant thereof (i.e.
- variants retains the ability to specifically bind to the N-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:71.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:71 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 71 that do not specifically bind to the N-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:71 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (a) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:71, whilst retaining the ability to specifically bind to the N terminus of the peptide of SEQ ID NO:26.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:71 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:71).
- the CDR1 of (a) (e.g. within the alpha chain variable region) has the amino acid sequence of SEQ ID NO:71
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NO:72, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR a chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:73, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*03:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:73.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:73, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 73 that do not specifically bind to HLA-A*03:01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:73 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (a) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:73, whilst retaining the ability to bind to HLA-A*03:01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:73 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:73).
- the CDR2 of (a) may be encoded by the nucleic acid sequence of SEQ ID NO:74, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may therefore comprise a TCR alpha chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR alpha chain variable region of (a) may have an amino acid sequence of SEQ ID NO: 69, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:69.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:69, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 69 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a non- conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:69 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR alpha chain variable region of (a) may have an amino acid sequence having at least 75%, at least 80%, at least 85% or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:69, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR alpha chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:69 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:69 may all be in regions of the TCR alpha chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 67, SEQ ID NO:71 and/or SEQ ID NO:73, and still have 25% (or less) sequence variability compared to SEQ ID NO:69).
- the sequence of the CDRs of SEQ ID NO:53 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:69).
- the polypeptide of (a) may comprise the CDR3 within a TCR a chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:69, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 67.
- the TCR a chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:71 and the TCR a chain variable region CDR2 may have an amino acid sequence of SEQ ID NO:73.
- the TCR alpha chain variable region of (a) may be encoded by the nucleic acid sequence of SEQ ID NQ:70, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (a) may comprise a TCR a chain variable region (as specified above) and a TCR a chain constant region. Examples of a suitable constant region is described in detail elsewhere herein, and applies equally here.
- polypeptide polypeptide (b) - components of the TCR beta chain (that are in common with the TCR of clone 31.3.F1 described herein)
- the CDR3 of (b) may have an amino acid sequence of SEQ ID NO:75, or be functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:75.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:75, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 75 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:75 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR3 of (b) may have an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO:75, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional CDR3 with one amino acid substitution compared to the sequence of SEQ ID NO:75 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:75).
- the CDR3 of (b) may be encoded by the nucleic acid sequence of SEQ ID NO:76, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) comprises the CDR3 (e.g. the CDR3 of SEQ ID NO:75 or a variant thereof as defined above) within a TCR p chain variable region that specifically binds to the peptide of SEQ ID NO:26.
- the polypeptide of (b) comprises a TCR chain variable region which includes the specified CDR3, wherein the TCR P chain variable region (and the CDR3 within it) specifically binds to the peptide of SEQ ID NO:26.
- the encoded TCR p chain variable region may comprise, in addition to the specified CDR3, a CDR1 having an amino acid sequence of SEQ ID NO:79, or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the C-terminus of the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:79.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:79, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 79 that do not specifically bind to the C-terminus of the peptide of SEQ ID NO:26. Non-functional variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:79 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR1 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:79, whilst retaining the ability to specifically bind to the C terminus of the peptide of SEQ ID NO:26.
- a functional CDR1 with one amino acid substitution compared to the sequence of SEQ ID NO:79 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:79).
- the CDR1 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:79
- the CDR1 may be encoded by the nucleic acid sequence of SEQ ID NQ:80, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the encoded TCR p chain variable region may also comprise, in addition to the specified CDR3 (and optionally the specified CDR1 above), a CDR2 having an amino acid sequence of SEQ ID NO:81 , or functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to HLA-A*03:01).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:81.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:81 , or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO: 81 that do not specifically bind to HLA-A*03:01. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:81 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the CDR2 of (b) may have an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO:81, whilst retaining the ability to bind to HLA-A*03:01.
- a functional CDR2 with one amino acid substitution compared to the sequence of SEQ ID NO:81 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:81).
- the CDR2 of (b) (e.g. within the beta chain variable region) has the amino acid sequence of SEQ ID NO:81
- the CDR2 may be encoded by the nucleic acid sequence of SEQ ID NO:82, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- the polypeptide of (b) may therefore comprise a TCR beta chain variable region that comprises the CDRs mentioned in detail above (by SEQ ID specifically, or variants thereof), with appropriate intervening sequences between the CDRs.
- the TCR beta chain variable region of (b) may have an amino acid sequence of SEQ ID NO:77, or a functional variant thereof (i.e. wherein the variant retains the ability to specifically bind to the peptide of SEQ ID NO:26).
- Such functional variants may be naturally occurring, synthetic, or synthetically improved functional variants of SEQ ID NO:77.
- the term “variant” also encompasses homologues. Functional variants will typically contain only conservative substitutions of one or more amino acids of SEQ ID NO:77, or substitution, deletion or insertion of non-critical amino acids in non-critical regions of the protein.
- Non-functional variants are amino acid sequence variants of SEQ ID NO:77 that do not specifically bind to SEQ ID NO:26. Non-functional variants will typically contain a nonconservative substitution, a deletion, or insertion or premature truncation of the amino acid sequence of SEQ ID NO:77 or a substitution, insertion or deletion in critical amino acids or critical regions. Methods for identifying functional and non-functional variants are well known to a person of ordinary skill in the art.
- the TCR beta chain variable region of (b) may have an amino acid sequence having at least 75%, at least 80%, at least 85%, or at least 90% (or at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) sequence identity to the amino acid sequence of SEQ ID NO:77, whilst retaining the ability to specifically bind to the peptide of SEQ ID NO:26.
- a functional TCR beta chain variable region with one or more amino acid substitutions compared to the sequence of SEQ ID NO:77 is also encompassed.
- the amino acid substitution may be a conservative amino acid substitution.
- the variability in sequence compared to SEQ ID NO:77 may all be in regions of the TCR beta chain variable region that do not form CDRs (i.e. the variant may have the CDRs of SEQ ID NO: 75, SEQ ID NO:79 and/or SEQ ID NO:81, and still have 25% (or less) sequence variability compared to SEQ ID NO:77).
- the sequence of the CDRs of SEQ ID NO:77 may be retained whilst the rest of the sequence is varied, as appropriate within the “at least 75% identity” parameters specified above.
- percent identity can be calculated as the percentage of identity to the entire length of the reference sequence (e.g. SEQ ID NO:77).
- (b) may include the CDR3 within a TCR p chain variable region having at least 75% (e.g. at least 75%, at least 80%, at least 85%, at least 90%, at least 95% etc) sequence identity to the amino acid sequence of SEQ ID NO:77, wherein the CDR3 has an amino acid sequence of SEQ ID NO:75.
- the TCR chain variable region CDR1 may have an amino acid sequence of SEQ ID NO:79 and the TCR p chain variable region CDR2 may have an amino acid sequence of SEQ ID NQ:80.
- the TCR beta chain variable region of (b) has the amino acid sequence of SEQ ID NO:77
- the TCR beta chain variable region may be encoded by the nucleic acid sequence of SEQ ID NO:78, or a genetically degenerate sequence thereof (i.e. other nucleic acid sequences that encode the same protein as a result of the degeneracy of the genetic code).
- (b) may comprise a TCR p chain variable region (as specified above) and a TCR chain constant region.
- TCR p chain variable region as specified above
- TCR chain constant region examples of suitable constant regions are provided elsewhere herein and apply equally here.
- the polypeptide of (a) may be joined to the polypeptide of (b) via a linker, e.g. a linker that enables expression of two proteins or polypeptides by the same vector.
- a linker comprising a porcine teschovirus-1 2A (P2A) sequence may be used, such as 2A sequences from foot-and-mouth disease virus (F2A), equine rhinitis A virus (E2A) or Thosea asigna virus (T2A) as published by A.L.
- P2A porcine teschovirus-1 2A
- 2A and 2A-like sequences are linkers that are cleavable once the nucleic acid molecule has been transcribed and translated.
- Another example of a linker is an internal ribosomal entry sites (IRES) which enables translation of two proteins or polypeptides by the same transcript. Any other appropriate linker may also be used.
- IRS internal ribosomal entry sites
- Any other appropriate linker may also be used.
- the identification of appropriate linkers is well within the routine capabilities of a person of skill in the art.
- the nucleic acid sequence encoding (a) and the nucleic acid sequence encoding (b) may be cloned into a vector with dual internal promoters (see e.g. S Jones et al., Human Gene Ther 2009).
- nucleic acid sequence of the invention may also be encoded by the nucleic acid sequence of the invention.
- the nucleic acid sequence may comprise a membrane targeting sequence that provides for transport of the encoded polypeptide to the cell surface membrane of the modified cell.
- Other appropriate additional domains are well known and are described, for example, in WO2016/071758.
- the nucleic acid sequence of the invention may encode a soluble TCR.
- the nucleic acid sequence may encode (a) and (b), wherein (a) and (b) comprise the variable regions of the TCR alpha and beta chains respectively, and optionally an immune- modulator molecule such as a CD3 agonist (e.g. an anti-CD3 scFv).
- a CD3 agonist e.g. an anti-CD3 scFv
- the CD3 antigen is present on mature human T cells, thymocytes and a subset of natural killer cells. It is associated with the TCR and is involved in signal transduction of the TCR.
- Antibodies specific for the human CD3 antigen are well known.
- One such antibody is the murine monoclonal antibody OKT3, which is the first monoclonal antibody approved by the FDA.
- Immune mobilising mTCR Against Cancer (ImmTAC; Immunocore Limited, Milton Partk, Abington, Oxon, United Kingdom) are bifunctional proteins that combine affinity monoclonal T-cell receptor (mTCR) targeting with a therapeutic mechanism of action (i.e., an anti-CD3 scFv).
- mTCR monoclonal T-cell receptor
- a soluble TCR of the invention may be combined with a radioisotope or a toxic drug. Appropriate radioisotopes and/or toxic drugs are well known in the art and are readily identifiable by a person of ordinary skill in the art.
- the nucleic acid sequence of the invention may encode a chimeric single chain TCR in which the polypeptide of (a) (e.g. the TCR alpha chain variable region) is linked to the polypeptide of (b) (e.g. the TCR beta chain variable region) and a constant region which is e.g. fused to the CD3 zeta signalling domain.
- the linker is non-cleavable.
- the nucleic acid sequence of the invention may encode a chimeric two chain TCR in which the polypeptide of (a) (e.g. the TCR alpha chain variable region) and the polypeptide of (b) (e.g.
- TCR beta chain variable region are each linked to a CD3 zeta signalling domain.
- Methods for preparing such single chain TCRs and two chain TCRs are well known in the art; see for example RA Willemsen et al, Gene Therapy 2000.
- the invention also provides isolated nucleic acid sequences that encode a peptide of the invention (and corresponding vectors). All general statements herein relating to nucleic acid sequences and vectors apply equally. A person of skill in the art would readily identify suitable nucleic acid sequences and vectors on the basis of the peptide sequences provided herein.
- the invention provides a vector that comprises a nucleic acid sequence described herein.
- a vector that comprises a nucleic acid sequence described herein.
- the vector may be a plasmid or a viral vector, such as a retroviral vector or a lentiviral vector.
- Adenovirus, adeno- associated virus, vaccinia virus, canary poxvirus, herpes virus, minicircle vectors and naked (synthetic) DNA/RNA may also be used (for details on minicircle vectors, see for example non- viral Sleeping Beauty transposition from minicircle vectors as published by R Monjezi, C Miskey, T Gogishvili, M Schleef, M Schmeer, H Einsele, Z Ivies and M Hudecek in Leukemia 2016).
- the vector comprises the nucleic acid sequence operably linked to a promoter.
- the term “vector” refers to a nucleic acid sequence capable of transporting another nucleic acid sequence to which it has been operably linked.
- the vector can be capable of autonomous replication or it can integrate into a host DNA.
- the vector may include restriction enzyme sites for insertion of recombinant DNA and may include one or more selectable markers or suicide genes.
- the vector can be a nucleic acid sequence in the form of a plasmid, a bacteriophage or a cosmid.
- the vector is suitable for expression in a cell (i.e. the vector is an “expression vector”).
- the vector is suitable for expression in a human T cell such as a CD8 + T cell or CD4 + T cell.
- the vector is a viral vector, such as a retroviral vector, a lentiviral vector or an adeno-associated vector.
- the vector is selected from the group consisting of an adenovirus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or synthetic RNA.
- the (expression) vector is capable of propagation in a host cell and is stably transmitted to future generations.
- Operaably linked refers to a single or a combination of the below-described control elements together with a coding sequence in a functional relationship with one another, for example, in a linked relationship so as to direct expression of the coding sequence.
- the vector may comprise regulatory sequences.
- Regulatory sequences refers to, DNA or RNA elements that are capable of controlling gene expression. Examples of expression control sequences include promoters, enhancers, silencers, TATA- boxes, internal ribosomal entry sites (IRES), attachment sites for transcription factors, transcriptional terminators, polyadenylation sites etc.
- the vector includes one or more regulatory sequences operatively linked to the nucleic acid sequence to be expressed. Regulatory sequences include those which direct constitutive expression, as well as tissue-specific regulatory and/or inducible sequences.
- the vector may comprise a promoter.
- Promoter refers to the nucleotide sequences in DNA to which RNA polymerase binds to start transcription.
- the promoter may be inducible or constitutively expressed. Alternatively, the promoter is under the control of a repressor or stimulatory protein.
- the promoter may be one that is not naturally found in the host cell (e.g. it may be an exogenous promoter). The skilled person in the art is well aware of appropriate promoters for use in the expression of target proteins, wherein the selected promoter will depend on the host cell.
- the vector may comprise a transcriptional terminator.
- Preferred transcriptional terminators are characterized by a run of T residues preceded by a GC rich dyad symmetrical region.
- the vector may comprise a translational control element.
- Translational control element refers to DNA or RNA elements that control the translation of mRNA.
- Preferred translational control elements are ribosome binding sites.
- the translational control element is from a homologous system as the promoter, for example a promoter and its associated ribozyme binding site. Preferred ribosome binding sites are known, and will depend on the chosen host cell.
- the vector may comprise restriction enzyme recognition sites.
- Restriction enzyme recognition site refers to a motif on the DNA recognized by a restriction enzyme.
- the vector may comprise a selectable marker.
- Selectable marker refers to proteins that, when expressed in a host cell, confer a phenotype onto the cell which allows a selection of the cell expressing said selectable marker gene. Generally this may be a protein that confers a new beneficial property onto the host cell (e.g. antibiotic resistance) or a protein that is expressed on the cell surface and thus accessible for antibody binding. Appropriate selectable markers are well known in the art.
- the vector may also comprise a suicide gene.
- suicide gene refers to proteins that induce death of the modified cell upon treatment with specific drugs.
- suicide can be induced of cells modified by the herpes simplex virus thymidine kinase gene upon treatment with specific nucleoside analogs including ganciclovir, cells modified by human CD20 upon treatment with anti-CD20 monoclonal antibody and cells modified with inducible Caspase9 (iCasp9) upon treatment with AP1903 (reviewed by BS Jones, LS Lamb, F Goldman, A Di Stasi; Improving the safety of cell therapy products by suicide gene transfer. Front Pharmacol. (2014) 5:254. Appropriate suicide genes are well known in the art.
- the vector comprises those genetic elements which are necessary for expression of the polypeptides described herein by a host cell.
- the elements required for transcription and translation in the host cell include a promoter, a coding region for the protein(s) of interest, and a transcriptional terminator.
- the (expression) vector of the present invention can be introduced into cells by conventional techniques such as transformation, transfection or transduction.
- Transformation refer generally to techniques for introducing foreign (exogenous) nucleic acid sequences into a host cell, and therefore encompass methods such as electroporation, microinjection, gene gun delivery, transduction with retroviral, lentiviral or adeno-associated vectors, lipofection, superfection etc. The specific method used typically depends on both the type of vector and the cell.
- the host cell is contacted with the vector (e.g. viral vector) in vitro, ex vivo, and in some embodiments, the host cell is contacted with the vector (e.g. viral vector) in vivo.
- the vector e.g. viral vector
- the term "host cell” includes any cell into which the nucleic acid sequences or vectors of the invention cell may be introduced (e.g. transduced). Once a nucleic acid molecule or vector has been introduced into the cell, it may be referred to as a “modified cell” herein. Once the nucleic acid molecule or vector is introduced into the host cell, the resultant modified cell should be capable of expressing the encoded polypeptide (and e.g. correctly localising the encoded polypeptide for its intended function e.g. transporting the encoded TOR to the cell surface).
- modified cell refers to a genetically altered (e.g. transformed or transfected) cell.
- the term refers to the particular subject cell and also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- the host cell (and thus the modified cell) is typically a eukaryotic cell, and particularly a human cell (e.g. a T cell such as a CD8 + T cell or a CD4 + T cell, or a mixture thereof).
- the host cell (and thus the modified cell) may be an autologous cell (e.g. an autologous T cell such as a CD8 + T cell or a CD4 + T cell, or a mixture thereof), which refers to a cell derived from the same individual to which it is later administered.
- the host cell (and thus the modified cell) may be an isolated T cell from a subject to be treated.
- the host cell (and thus the modified cell) may be isolated from a blood sample e.g. by leukaphoresis.
- the host cell may be any cell that is able to confer anti-tumour immunity after TCR gene transfer.
- suitable cells include autologous or allogeneic Natural Killer (NK) cells, NKT cells, gamma-delta T cells, hematopoietic stem cells or other progenitor cells and any other autologous or allogeneic cell or cell line (NK-92 for example or T cell lines) that is able to confer anti-tumor immunity after TCR gene transfer.
- the modified cell is capable of expressing the polypeptide encoded by the nucleic acid sequence or vector of the invention (e.g. the TCR or TCR component parts) such that the modified cell provides an immunotherapy that specifically targets ANPM1 malignant cells, and thus can be used to treat or prevent haematological malignancies having ANPM1. More details on this use are given below.
- the inventors have identified five peptides that are present in the HLA class I ligandome of ANPM1 positive primary AML patients, namely CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO: 27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- SEQ ID NO:1 encompasses both the cysteinylated and non-cysteinylated forms of the peptide CLAVEEVSL (SEQ ID NO:1).
- the invention specifically provides for an isolated peptide comprising the amino acid sequence CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid in CLAVEEVSL (SEQ ID NO:1) may or may not be cysteinylated.
- cysteine amino acid in CLAVEEVSL (SEQ ID NO:1) is cysteinylated.
- SEQ ID NO:27 encompasses both the cysteinylated and non-cysteinylated forms of the peptide CLAVEEVSLRK (SEQ ID NO:27).
- the invention specifically provides for an isolated peptide comprising the amino acid sequence CLAVEEVSLRK (SEQ ID NO:27), wherein the cysteine amino acid in CLAVEEVSLRK (SEQ ID NO:27) may or may not be cysteinylated.
- cysteine amino acid in CLAVEEVSLRK (SEQ ID NO:27) is cysteinylated.
- the invention therefore provides an isolated peptide comprising an amino acid sequence selected from: (i) CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid may or may not be cysteinylated; (ii) AVEEVSLRK (SEQ ID NO:26); (iii) CLAVEEVSLRK (SEQ ID NO: 27), wherein the cysteine amino acid may or may not be cysteinylated; (iv) VEEVSLRK (SEQ ID NO:28); and (v) AVEEVSLR (SEQ ID NO:29).
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO: 27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- cysteine amino acid in CLAVEEVSL (SEQ ID NO:1) or CLAVEEVSLRK (SEQ ID NO:27) is cysteinylated.
- an “isolated peptide” refers to a peptide that is not in its natural environment.
- the peptide may therefore be of synthetic origin (or alternatively, of natural original, but isolated from its natural environment).
- the isolated peptide may be relatively short (i.e. no more than 20 amino acids; e.g. no more than 19, 18, 17, 16, 15, 14, 13, 12, 11, or 10 amino acids).
- the peptide may consist of the amino acid sequence of SEQ ID NO:1 (wherein the cysteine amino acid may or may not be cysteinylated), SEQ ID NO:26, SEQ ID NO:27 (wherein the cysteine amino acid may or may not be cysteinylated), SEQ ID NO:28 or SEQ ID NO:29 only.
- the cysteine amino acid in CLAVEEVSL (SEQ ID N0:1) or CLAVEEVSLRK (SEQ ID NO:27) is cysteinylated.
- the isolated peptide may be administered to a human subject in order to treat or prevent a ANPM1 positive haematological malignancy.
- the isolated peptide may be administered to the subject in order to induce or enhance their immune response.
- the peptide may therefore be administered to the subject to induce T cell activation (e.g. in vivo T cell activation) in the subject, wherein the activated T cells are specific for the peptide (and thus will specifically target ANPM1 positive malignant cells).
- the isolated peptide may be administered as a peptide vaccine for treating or preventing ANPM1 positive AML.
- the isolated peptide may be administered to induce or enhance activation of T cells specific for ANPM1 positive malignant cells.
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO: 27
- These peptides are presented to the T cell repertoire of a AN PM 1 positive subject in vivo. Binding of these peptides to T cells has been demonstrated herein. These peptides therefore represent bonafide immunogenic AN PM 1 -specific antigens that may be further exploited in the development of personalized vaccines, which may be particularly useful as an adjunct to other therapies (e.g. ACT as described herein).
- These immunogenic peptides can therefore be used as an immunotherapy in the form of peptide, RNA, DNA, dendritic cell based therapies, and adoptive TCR transgenic T cell-based therapies (for a suitable review, see ref 23).
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- An isolated peptide comprising an amino acid sequence selected from: (i) CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid may or may not be cysteinylated; (ii) AVEEVSLRK (SEQ ID NO:26); (iii) CLAVEEVSLRK (SEQ ID NO: 27), wherein the cysteine amino acid may or may not be cysteinylated; (iv) VEEVSLRK (SEQ ID NO:28); and (v) AVEEVSLR (SEQ ID NO:29) may therefore be useful as an immunotherapy.
- such isolated peptides may be used as an immunotherapy for subjects with, at risk of developing, or suspected of having ANPM1 positive AML.
- Nucleic acid sequences and vectors encoding these peptides may also be useful for this purpose.
- the particular peptide for administration may be chosen based on the HLA-A status of the subject.
- a peptide comprising the sequence of SEQ ID NO:1 may be particularly suitable for administration to a subject that is HLA-A*02:01 positive
- a peptide comprising the sequence of SEQ ID NO:26 or SEQ ID NO:27 may be particularly suitable for administration to a subject that is positive for HLA-A*03:01 or HLA- A*11:01.
- Isolated peptides of the invention may also be provided in compositions that comprise more than one of the peptides discussed above.
- an isolated peptide may be provided (and/or administered) as a composition that comprises a mixture of (a) an isolated peptide comprising the amino acid sequence CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid in CLAVEEVSL (SEQ ID NO:1) is cysteinylated; and (b) an isolated peptide comprising the amino acid sequence CLAVEEVSL (SEQ ID NO:1), wherein the cysteine amino acid in CLAVEEVSL (SEQ ID NO:1) is not cysteinylated.
- This composition may be particularly useful in treating or preventing a ANPM1 positive haematological malignancy in a subject that is positive for HLA-A*02:01 because it can be used to induce T cell activation (e.g. in vivo T cell activation in the subject), wherein the activated T cells have TCRs that are specific to one (or both) of the cysteinylated and/or non-cysteinylated forms of the peptide of SEQ ID NO:1.
- a peptide composition may be provided which comprises a mixture of (a) an isolated peptide comprising the amino acid sequence of SEQ ID NO:26 and (b) an isolated peptide comprising the amino acid sequence of SEQ ID NO:27.
- This composition may be particularly useful in treating or preventing a ANPM1 positive haematological malignancy in a subject that is positive for HLA-A*03:01 or HLA-A*11:01, as these peptides are both presented by any one of these HLA-A serotypes.
- an isolated peptide may be provided (and/or administered) as a composition that comprises a mixture of (a) an isolated peptide comprising the amino acid sequence of SEQ ID NO:27, wherein the cysteine amino acid is cysteinylated; and (b) an isolated peptide comprising the amino acid sequence of SEQ ID NO:27, wherein the cysteine amino acid is not cysteinylated.
- This composition may be particularly useful in treating or preventing a ANPM1 positive haematological malignancy in a subject that is positive for HLA- A*03:01 or HLA-A*11 :01 because it can be used to induce T cell activation (e.g. in vivo T cell activation in the subject), wherein the activated T cells have TCRs that are specific to one (or both) of the cysteinylated and/or non-cysteinylated forms of the peptide of SEQ ID NO:27.
- a nucleic acid sequence, vector, modified cell, isolated protein or peptide as described herein may be provided as part of a pharmaceutical composition.
- such compositions may be administered to a human subject having a ANPM1 positive haematological malignancy in order to treat or prevent the ANPM1 positive haematological malignancy (e.g. by inducing or enhancing a AN PM 1 -target specific immune response).
- a particularly suitable composition may be selected based on the HLA-A serotype of the human subject, as described in detail elsewhere herein.
- a pharmaceutical composition may comprise a nucleic acid sequence, vector, modified cell or isolated protein or peptide described herein along with a pharmaceutically acceptable excipient, adjuvant, diluent and/or carrier.
- compositions may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, supplementary immune potentiating agents such as adjuvants and cytokines and optionally other therapeutic agents or compounds.
- pharmaceutically acceptable refers to a material that is not biologically or otherwise undesirable, i.e. , the material may be administered to an individual along with the selected nucleic acid sequence, vector, modified cell or isolated peptide without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
- Excipients are natural or synthetic substances formulated alongside an active ingredient (e.g. a nucleic acid sequence, vector, modified cell or isolated peptide as provided herein), included for the purpose of bulking-up the formulation or to confer a therapeutic enhancement on the active ingredient in the final dosage form, such as facilitating drug absorption or solubility. Excipients can also be useful in the manufacturing process, to aid in the handling of the active substance concerned such as by facilitating powder flowability or non-stick properties, in addition to aiding in vitro stability such as prevention of denaturation over the expected shelf life.
- an active ingredient e.g. a nucleic acid sequence, vector, modified cell or isolated peptide as provided herein
- Excipients can also be useful in the manufacturing process, to aid in the handling of the active substance concerned such as by facilitating powder flowability or non-stick properties, in addition to aiding in vitro stability such as prevention of denaturation over the expected shelf life.
- suitable excipients include water, saline, aqueous dextrose, glycerol, ethanol, and the like.
- Adjuvants are pharmacological and/or immunological agents that modify the effect of other agents in a formulation.
- Pharmaceutically acceptable adjuvants are well known in the art. A suitable adjuvant is therefore easily identifiable by one of ordinary skill in the art.
- Diluents are diluting agents. Pharmaceutically acceptable diluents are well known in the art. A suitable diluent is therefore easily identifiable by one of ordinary skill in the art.
- Carriers are non-toxic to recipients at the dosages and concentrations employed and are compatible with other ingredients of the formulation.
- carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
- Pharmaceutically acceptable carriers are well known in the art. A suitable carrier is therefore easily identifiable by one of ordinary skill in the art.
- compositions of the invention may advantageously be used to treat or prevent a ANPM1 positive haematological malignancy in a human subject.
- An appropriate composition may be selected on the basis of the HLA-A serotype of the human subject, as discussed in detail elsewhere herein.
- the method of treatment or prevention of a AN PM 1 positive haematological malignancy described herein results in an induced or enhanced immune response (e.g. a cell mediated response) in the subject (e.g. a targeted immune response to malignant cells that present the HLA-A restricted peptide).
- an induced or enhanced immune response e.g. a cell mediated response
- a targeted immune response to malignant cells that present the HLA-A restricted peptide e.g. a targeted immune response to malignant cells that present the HLA-A restricted peptide.
- induced or enhanced immune response refers to an increase in the immune response (e.g. a cell mediated immune response such as a T cell mediated immune response) of the subject during or after treatment compared to their immune response prior to treatment.
- An “induced or enhanced” immune response therefore encompasses any measurable increase in the immune response that is directly or indirectly targeted to the ANPM1 positive haematological malignancy being treated.
- Compositions of the invention may be used to treat or prevent a AN PM 1 positive haematological malignancy in a human subject, particularly a ANPM1 positive myeloid malignancy, and more particularly AN PM 1 positive AML.
- a person of skill in the art will be fully aware of haematological malignancies that may be ANPM1 positive and thus may be treated in accordance with the invention. Similarly, a person of skill in the art will be fully aware of myeloid malignancies that may be ANPM1 positive and thus may be treated in accordance with the invention.
- treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) the targeted condition, disorder or symptom.
- Treatment therefore encompasses a reduction, slowing or inhibition of the amount or concentration of malignant cells, for example as measured in a sample obtained from the subject, of at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% when compared to the amount or concentration of malignant cells before treatment.
- Methods of measuring the amount or concentration of malignant cells include, for example, qRT-PCR, and quantification of AN PM 1 positive haematological malignancy specific biomarkers, such as CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28), and/or AVEEVSLR (SEQ ID NO:29) in a sample obtained from the subject.
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- subject refers to an individual, e.g., a human, having or at risk of having a specified condition, disorder or symptom.
- the subject may be a patient i.e. a subject in need of treatment in accordance with the invention.
- the subject may have received treatment for the condition, disorder or symptom.
- the subject has not been treated prior to treatment in accordance with the present invention.
- compositions described herein can be administered to the subject by any conventional route, including injection or by gradual infusion over time.
- the administration may, for example, be by infusion or by intramuscular, intravascular, intracavity, intracerebral, intralesional, rectal, subcutaneous, intradermal, epidural, intrathecal, percutaneous administration.
- the compositions described herein may be in any form suitable for the above modes of administration.
- compositions comprising modified cells may in any form suitable for infusion.
- suitable forms for parenteral injection include a sterile solution, suspension or emulsion
- suitable forms for topical administration include an ointment or cream
- suitable forms for rectal administration include a suppository.
- the route of administration may be by direct injection into the target area, or by regional delivery or by local delivery. The identification of suitable dosages of the compositions of the invention is well within the routine capabilities of a person of skill in the art.
- compositions of the invention may be formulated for use in T cell receptor (TCR) gene transfer, an approach that is rapid, reliable and capable of generating large quantities of T cells with specificity for the ANPM1- specific peptide (e.g. CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28), or AVEEVSLR (SEQ ID NO:29)), regardless of the patient’s pre-existing immune repertoire.
- TCR T cell receptor
- modified autologous cells suitable for infusion may be generated within a few days.
- compositions of the invention may be formulated for use as a vaccine (e.g. a composition comprising one or more peptides selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28), or AVEEVSLR (SEQ ID NO:29) may be formulated as a pharmaceutical composition that is suitable for use as a peptide vaccine. Suitable peptide vaccine formulations are well known in the art.
- the pharmaceutical composition of the invention is a vaccine, preferably a peptide- based vaccine.
- a vaccine preferably a peptide-based vaccine.
- Such a peptide-based vaccine may be used for the prevention or treatment of ANPM1 positive haematological malignancies such as AML.
- the pharmaceutical composition is preferably for, and therefore formulated to be suitable for, administration to a subject, preferably a human or animal subject.
- the administration is parenteral, e.g. intravenous, subcutaneous, intramuscular, intradermal intracutaneous and/or intratumoral administration, i.e. by injection.
- the pharmaceutical composition comprises or consists of an amount of peptide that constitutes a pharmaceutical dosage unit.
- a pharmaceutical dosage unit is defined herein as the amount of active ingredients (i.e. the total amount of peptide in a peptide-based vaccine) that is applied to a subject at a given time point.
- a pharmaceutical dosage unit may be applied to a subject in a single volume, i.e.
- a single shot or may be applied in 2, 3, 4, 5 or more separate volumes or shots that are applied preferably at different locations of the body, for instance in the right and the left limb.
- the separate volumes of a pharmaceutical dosage may differ in composition, i.e. may comprise different kinds or composition of active ingredients and/or adjuvants.
- a single injection volume or shot (i.e. volume applied on one location at a certain time point), comprising a total pharmaceutical dosage, or part thereof in case multiple shots applied at substantially the same time point, may between 100 and 2 mL, or between 100 and 1 mL.
- the single injection volume may be 100 pl, 200 pl, 300 pl, 400 pl, 500 pl, 600 pl, 700 pl, 800 pl, 900 pl, 1 mL, 1.1 mL, 1.2 mL, 1.3 mL, 1.4 mL, 1.5 mL, 1.6 mL, 1.7 mL, 1.8 mL, 1.9 mL, 2 mL, 3 mL or any value in between.
- pharmaceutical dosage unit or total amount of peptide applied to a subject at a given time point, either in a single or in multiple injections at a certain time point, comprises an amount of peptide in the range from 0.1 pg to 20 mg, such as about 0.1 pg, 0.5 pg, 1 pg, 5 pg, 10 pg, 15 pg, 20 pg, 30 pg, 40 pg, 50 pg, 60 pg, 70 pg, 80 pg, 90 pg, 100 pg, 150 pg, 200 pg, 250 pg, 300 pg, 350 pg, 400 pg, 450 pg, 500 pg, 650 pg, 700 pg, 750 pg, 800 pg, 850 pg, 900 pg, 1 mg, 1 ,5 mg, 2 mg, 2.5 mg, 3 mg, 3.5 mg, 4 mg, 4.5 mg , 5 mg, 5.5 mg
- compositions described herein are for administration in an effective amount.
- An “effective amount” is an amount that alone, or together with further doses, produces the desired (therapeutic or non-therapeutic) response.
- the effective amount to be used will depend, for example, upon the therapeutic (or non-therapeutic) objectives, the route of administration, and the condition of the patient/subject.
- the suitable dosage of the composition of the invention for a given patient/subject will be determined by the attending physician (or person administering the composition), taking into consideration various factors known to modify the action of the composition of the invention for example severity and type of haematological malignancy, body weight, sex, diet, time and route of administration, other medications and other relevant clinical factors.
- the dosages and schedules may be varied according to the particular condition, disorder or symptom the overall condition of the patient/subject. Effective dosages may be determined by either in vitro or in vivo methods.
- compositions of the present invention are advantageously presented in unit dosage form.
- the invention provides a method of generating a T cell receptor that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28), and AVEEVSLR (SEQ ID NO:29), the method comprising contacting a nucleic acid seguence of the invention (or vector) with a host cell under conditions in which the nucleic acid seguence (or vector) is incorporated and expressed by the cell to generate the T cell receptor.
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- the method may be carried out on the host cell ex vivo or in vitro.
- the method may be performed in vivo, wherein the nucleic acid seguence (or vector) is administered to the subject and is contacted with the host cell in vivo, under conditions in which the nucleic acid seguence is incorporated and expressed by the host cell to generate the T cell receptor.
- the method is not a method of treatment of the human or animal body.
- nucleic acid seguence or vector
- a host cell under conditions in which the nucleic acid seguence (or vector) is incorporated and expressed by the cell are well known, as described elsewhere herein.
- nucleic acid seguence As used herein “nucleic acid seguence”, “polynucleotide”, “nucleic acid” and “nucleic acid molecule” are used interchangeably to refer to an oligonucleotide seguence or polynucleotide seguence.
- the nucleotide seguence may be of genomic, synthetic or recombinant origin, and may be double-stranded or single-stranded (representing the sense or antisense strand).
- the term “nucleotide seguence” includes genomic DNA, cDNA, synthetic DNA, and RNA (e.g. mRNA) and analogs of the DNA or RNA generated, e.g., by the use of nucleotide analogs.
- the nucleotide seguence lacks introns. In other words, it is an intronless nucleic acid seguence.
- the nucleotide seguence may be a DNA seguence that does not comprise intron seguences.
- isolated nucleic acid sequence refers to a nucleic acid sequence that is not in its natural environment when it is linked to its naturally associated sequence(s) that is/are also in its/their natural environment.
- an isolated nucleic acid sequence is not a native nucleotide sequence, wherein "native nucleotide sequence” means an entire nucleotide sequence that is in its native environment and when operatively linked to an entire promoter with which it is naturally associated, which promoter is also in its native environment.
- “specifically binds to CLAVEEVSL (SEQ ID NO1)” refers to selective binding of the CLAVEEVSL (SEQ ID NO:1) peptide.
- a polypeptide that “specifically binds to CLAVEEVSL” (SEQ ID NO:1) will selectively bind to this peptide and will not bind in a significant amount to other peptides that do not include this sequence.
- the polypeptide may bind to CLAVEEVSL (SEQ ID NO:1) with at least 10, 20, 30, 40, 50, or 100 fold more affinity than it binds to a control antigenic peptide.
- Selective binding may also be determined indirectly in the context of a modified cell that expresses a nucleic acid or vector of the invention.
- the modified cell is specifically reactive against a cell presenting CLAVEEVSL (SEQ ID NO:1) in the context of HLA-A*02:01 (e.g. primary ANPM1 HLA-A*02:01 positive AML cells, or any HLA-A*02:01 positive cell line in which the ANPM1 gene is introduced).
- the modified cell may bind to a cell presenting CLAVEEVSL (SEQ ID NO:1) in the context of HLA-A*02:01 with at least 10, 20, 30, 40, 50, or 100 fold more reactivity when compared to its reactivity against a control cell line that does not present CLAVEEVSL (SEQ ID NO:1) in the context of HLA-A*02:01.
- the selective binding may be in the context of CLAVEEVSL (SEQ ID NO:1) presentation by HLA-A*02:01.
- a polypeptide that “specifically binds to CLAVEEVSL” may only do so when it is being presented (i.e. it is bound by) HLA-A*02:01, or is in an equivalent structural formation as when it is being presented by HLA- A*02:01.
- a polypeptide that “specifically binds CLAVEEVSL” may bind to either (i) the cysteinylated form of CLAVEEVSL (SEQ ID NO:1), (ii) the non- cysteinylated form of CLAVEEVSL (SEQ ID NO:1), or (iii) both the cysteinylated form of CLAVEEVSL (SEQ ID NO:1) and the non-cysteinylated form of CLAVEEVSL (SEQ ID NO:1).
- SEQ ID NO:1 encompasses both the cysteinylated and non-cysteinylated forms of the peptide CLAVEEVSL (SEQ ID NO:1).
- AVEEVSLRK As used herein, “specifically binds to AVEEVSLRK” (SEQ ID NO:26) refers to selective binding of the AVEEVSLRK (SEQ ID NO:26) peptide. Under certain conditions, for example in an immunoassay as described herein, a polypeptide that “specifically binds to AVEEVSLRK” (SEQ ID NO:26) will selectively bind to this peptide and will not bind in a significant amount to other peptides that do not include this sequence. Thus the polypeptide may bind to AVEEVSLRK (SEQ ID NO:26) with at least 10, 20, 30, 40, 50, or 100 fold more affinity than it binds to a control antigenic peptide.
- Selective binding may also be determined indirectly in the context of a modified cell that expresses a nucleic acid or vector of the invention.
- the modified cell is specifically reactive against a cell presenting AVEEVSLRK (SEQ ID NO:26) in the context of HLA-A*03:01 , HLA-A*11 :01 or HLA- A*01:01 (e.g. primary AN PM 1 HLA-A*03:01, HLA-A*11:01 or HLA-A*01 :01 positive AML cells, or any HLA-A*03:01, HLA-A*11:01 or HLA-A*01:01 positive cell line in which the ANPM1 gene is introduced).
- AVEEVSLRK SEQ ID NO:26
- the modified cell may bind to a cell presenting AVEEVSLRK (SEQ ID NO:26) in the context of HLA-A*03:01, HLA-A*11:01 or HLA-A*01:01 with at least 10, 20, 30, 40, 50, or 100 fold more reactivity when compared to its reactivity against a control cell line that does not present AVEEVSLRK (SEQ ID NO:26) in the context of HLA-A*03:01, HLA-A*11:01 or HLA-A*01:01.
- AVEEVSLRK SEQ ID NO:26
- the selective binding may be in the context of AVEEVSLRK (SEQ ID NO:26) presentation by HLA-A*03:01 , HLA-A*11:01 or HLA-A*01:01 only.
- a polypeptide that “specifically binds to AVEEVSLRK” may only do so when it is being presented (i.e. it is bound by) HLA-A*03:01 , HLA-A*11:01 or HLA-A*01:01, or is in an equivalent structural formation as when it is being presented by HLA-A*03:01 , HLA-A*11 :01 or HLA-A*01:01.
- “specifically binds to CLAVEEVSLRK” refers to selective binding of the CLAVEEVSLRK peptide.
- a polypeptide that “specifically binds to CLAVEEVSLRK” will selectively bind to this peptide and will not bind in a significant amount to other peptides that do not include this sequence.
- the polypeptide may bind to CLAVEEVSLRK (SEQ ID NO:27) with at least 10, 20, 30, 40, 50, or 100 fold more affinity than it binds to a control antigenic peptide.
- Selective binding may also be determined indirectly in the context of a modified cell that expresses a nucleic acid or vector of the invention.
- the modified cell is specifically reactive against a cell presenting CLAVEEVSLRK (SEQ ID NO:27) in the context of HLA-A*03:01 or HLA-A*11:01 (e.g. primary AN PM 1 HLA-A*03:01 or HLA-A*11 :01 positive AML cells, or any HLA-A*03:01 or HLA-A*11:01 positive cell line in which the ANPM1 gene is introduced).
- the modified cell may bind to a cell presenting CLAVEEVSLRK (SEQ ID NO:27) in the context of HLA-A*03:01 or HLA-A*11:01 with at least 10, 20, 30, 40, 50, or 100 fold more reactivity when compared to its reactivity against a control cell line that does not present CLAVEEVSLRK (SEQ ID NO:27) in the context of HLA-A*03:01 or HLA-A*11:01.
- CLAVEEVSLRK SEQ ID NO:27
- the selective binding may be in the context of CLAVEEVSLRK (SEQ ID NO:27) presentation by HLA-A*03:01 or HLA-A*11:01 only.
- a polypeptide that “specifically binds to CLAVEEVSLRK” (SEQ ID NO:27) may only do so when it is being presented (i.e. it is bound by) HLA-A*03:01 or HLA-A*11:01, or is in an equivalent structural formation as when it is being presented by HLA-A*03:01 or HLA-A*11:01.
- a polypeptide that “specifically binds CLAVEEVSLRK” may bind to either (i) the cysteinylated form of CLAVEEVSLRK, (ii) the non- cysteinylated form of CLAVEEVSLRK (SEQ ID NO:27), or (iii) both the cysteinylated form of CLAVEEVSLRK and the non-cysteinylated form of CLAVEEVSLRK (SEQ ID NO:27).
- SEQ ID NO:27 or “CLAVEEVSLRK” encompasses both the cysteinylated and non-cysteinylated forms of the peptide CLAVEEVSLRK (SEQ ID NO:27).
- VEEVSLRK As used herein, “specifically binds to VEEVSLRK” (SEQ ID NO:28) refers to selective binding of the VEEVSLRK (SEQ ID NO:28) peptide. Under certain conditions, for example in an immunoassay as described herein, a polypeptide that “specifically binds to VEEVSLRK” (SEQ ID NO:28) will selectively bind to this peptide and will not bind in a significant amount to other peptides that do not include this sequence. Thus the polypeptide may bind to VEEVSLRK (SEQ ID NO:28) with at least 10, 20, 30, 40, 50, or 100 fold more affinity than it binds to a control antigenic peptide.
- Selective binding may also be determined indirectly in the context of a modified cell that expresses a nucleic acid or vector of the invention.
- the modified cell is specifically reactive against a cell presenting VEEVSLRK (SEQ ID NO:28) in the context of the appropriate HLA-A (e.g. primary ANPM1 positive AML cells, or any appropriate HLA-A positive cell line in which the ANPM1 gene is introduced).
- VEEVSLRK SEQ ID NO:28
- the modified cell may bind to a cell presenting VEEVSLRK (SEQ ID NO:28) in the context of and appropriate HLA-A with at least 10, 20, 30, 40, 50, or 100 fold more reactivity when compared to its reactivity against a control cell line that does not present VEEVSLRK in the context of the appropriate HLA-A.
- VEEVSLRK SEQ ID NO:28
- the selective binding may be in the context of VEEVSLRK (SEQ ID NO:28) presentation by an appropriate HLA-A only.
- a polypeptide that “specifically binds to VEEVSLRK” (SEQ ID NO:28) may only do so when it is being presented (i.e. it is bound by) an appropriate HLA-A, or is in an equivalent structural formation as when it is being presented by an appropriate HLA-A.
- AVEEVSLR As used herein, “specifically binds to AVEEVSLR” (SEQ ID NO:29) refers to selective binding of the AVEEVSLR (SEQ ID NO:29) peptide. Under certain conditions, for example in an immunoassay as described herein, a polypeptide that “specifically binds to AVEEVSLR” (SEQ ID NO:29) will selectively bind to this peptide and will not bind in a significant amount to other peptides that do not include this sequence. Thus the polypeptide may bind to AVEEVSLR (SEQ ID NO:29) with at least 10, 20, 30, 40, 50, or 100 fold more affinity than it binds to a control antigenic peptide.
- Selective binding may also be determined indirectly in the context of a modified cell that expresses a nucleic acid or vector of the invention.
- the modified cell is specifically reactive against a cell presenting AVEEVSLR (SEQ ID NO:29) in the context of the appropriate HLA-A (e.g. primary ANPM1 positive AML cells, or any appropriate HLA-A positive cell line in which the ANPM1 gene is introduced).
- HLA-A e.g. primary ANPM1 positive AML cells, or any appropriate HLA-A positive cell line in which the ANPM1 gene is introduced.
- the modified cell may bind to a cell presenting AVEEVSLR (SEQ ID NO:29) in the context of and appropriate HLA-A with at least 10, 20, 30, 40, 50, or 100 fold more reactivity when compared to its reactivity against a control cell line that does not present AVEEVSLR (SEQ ID NO:29) in the context of the appropriate HLA-A.
- AVEEVSLR SEQ ID NO:29
- the selective binding may be in the context of AVEEVSLR (SEQ ID NO:29) presentation by an appropriate HLA-A only.
- a polypeptide that “specifically binds to AVEEVSLR” (SEQ ID NO:29) may only do so when it is being presented (i.e. it is bound by) an appropriate HLA-A, or is in an equivalent structural formation as when it is being presented by an appropriate HLA-A.
- non-essential amino acid residue is a residue that can be altered from the wild-type sequence of (e.g., the sequence identified by SEQ ID NO herein) without abolishing or, more preferably, without substantially altering a biological activity, whereas an “essential” (or “critical”) amino acid residue results in such a change.
- amino acid residues that are conserved are predicted to be particularly non-amenable to alteration, except that amino acid residues within the hydrophobic core of domains can generally be replaced by other residues having approximately equivalent hydrophobicity without significantly altering activity.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- a nonessential (or non-critical) amino acid residue in a protein is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly, and the resultant mutants can be screened for activity to identify mutants that retain activity.
- sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 75%, 80%, 82%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”.
- the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman et al. (1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a BLOSLIM 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1 , 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1 , 2, 3, 4, 5, or 6.
- a particularly preferred set of parameters are a BLOSLIM 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of Meyers et al. (1989) CABIOS 4:11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM 120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences.
- Such searches can be performed using the N BLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-410).
- gapped BLAST can be utilized as described in Altschul et al. (1997, Nucl. Acids Res. 25:3389-3402).
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- the polypeptides and nucleic acid molecules described herein can have amino acid sequences or nucleic acid sequences sufficiently or substantially identical to the sequences identified by SEQ ID NO.
- amino acid or nucleotide sequences that contain a common structural domain having at least about 60%, or 65% identity, likely 75% identity, more likely 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity are defined herein as sufficiently or substantially identical.
- nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context they are used by those of skill in the art.
- HLA class I ligandome data were generated for 12 primary AML using tandem mass spectrometry and searched for peptides matching the alternative reading frame of ANPM1.
- HLA-A*02:01 pMHC tetramers were produced for one identified peptide and used to isolate specific CD8 cells from 6 HLA-A*02:01 positive AML patients and 6 healthy HLA-A*02:01 positive individuals.
- T cell clones isolated from healthy individuals were screened for pMHC tetramer staining and tetramer positive T cell clones were tested for reactivity against peptide-loaded T2 cells and primary AML with ANPM1 or wtNPMI by IFN-y ELISA. From one strongly reactive T cell clone, the TCR was sequenced and cloned into the retroviral MP71-TCR-flex vector.
- This vector was used to introduce the TCR into CD8 and CD4 cells from two healthy HLA-A*02:01 positive individuals and the purity of TCR-transduced T cells was assessed by flow cytometry. TCR-transduced T cells were tested for recognition of HLA-A*02:01 positive AML cell lines and primary AML with ANPM1 or wtNPMI by IFN-y ELISA and specific lysis was measured by 51 Cr release assays.
- Peripheral blood and bone marrow samples were collected from patients with AML and healthy individuals after approval by the Institutional Review Board of the Leiden University Medical Center with informed consent according to the Declaration of Helsinki.
- Peripheral blood and bone marrow mononuclear cells were isolated by Ficoll-lsopaque separation and cryopreserved.
- buffy coats were ordered from Sanquin (Amsterdam, the Netherlands).
- T cells were cultured in T cell medium (TCM) consisting of Iscove’s Modified Dulbecco’s Medium (IMDM; Lonza, Basel, Switzerland) supplemented with 5% heat-inactivated fetal bovine serum (FBS; Gibco, Thermo Fisher Scientific, Waltham, Massachusetts, United States), 5% human serum, 1.5% L-glutamine (Lonza), 1% penicillin/streptomycin (Lonza) and 100 lU/ml IL-2 (Novartis, Basel, Switzerland).
- TCM T cell medium
- AML cell lines expressing wild type NPM1 (OCI-AML2) and ANPM1 (OCI-AML3) were ordered from DSMZ (Braunschweig, Germany) and cultured in minimum essential medium alpha (MEMa; Gibco) with 20% FBS and 1% penicillin/streptomycin.
- Primary AML and T2 cells were cultured in IMDM containing 10% FBS, 1.5% L-glutamine and 1% penicillin/streptomycin.
- Monocytes were isolated from PBMC by magnetic-activated cell sorting (MACS; Miltenyi Biotec, Bergisch Gladbach, Germany) with CliniMACS CD14 beads (Miltenyi Biotec). Isolated monocytes were cultured to immature dendritic cells (DC) in medium with 100 ng/mL GM-CSF (Novartis, Basel, Switzerland) and 500 ILI/mL IL-4 (Schering-Plough, Kenilworth, NJ) for 7 days.
- DC dendritic cells
- GM-CSF GM-CSF
- 10 ng/mL TNF-a Cellgenix, Freiburg, Germany
- 10 ng/mL I L-1 p Cellgenix
- 10 ng/mL IL-6 Cellgenix
- 1 pg/mL prostaglandin E2 Sigma- Aldrich, St. Louis, MO
- 500 ILI/mL IFN-y Boehringer-Ingelheim, Ingelheim, Germany
- Cell pellets of 12 primary AML samples were lysed in 50 mM Tris-HCI, 150 mM NaCI, 5 mM ethylenediaminetetraacetate and 0,5% Zwittergent 3-12 (pH 8.0) and supplemented with Complete protease inhibitor (Sigma-Aldrich, St. Louis, Missouri, United States). After 2 hrs. incubation with tumbling of cells in lysis buffer at 4°C, the preparation was centrifuged for 10 min. at 1000g at 4°C. The supernatant was transferred to a new tube and centrifuged for 35 min. at 13,000g at 4°C.
- the supernatant was pre-cleared with Protein A Sepharose CL-4B beads (GE Healthcare Life Sciences, Chicago, Illinois, United States) and subjected to an immunoaffinity column with dimethyl pimelidate (DMP) immobilized W6/32 antibody (3 mg/ml resin) on Protein A Sepharose CL-4B beads with a flow rate of 1 ml/min.
- DMP dimethyl pimelidate
- Peptides were separated from the HLA class I molecules via passage through a 10 kDa membrane (Macrosep Advance Centrifugal Devices With Supor Membrane, Pall Corporation, Port Washington, New York, United States). The filtrate was freeze dried.
- Eluted peptide pools were fractionated by strong cation exchange chromatography (SCX) with a homemade SCX column (320 pm inner diameter, 15 cm, polysulfoethyl A 3 pm, Poly LC) run at 4 pl/min. Gradients were run for 10 min. at 100% solvent A (100/0.1 water/ trifluoroacetic acid v/v), after which a linear gradient started to reach 100% solvent B (65/35/0.1 250 mM KCI/acetonitrile/trifluoroacetic acid v/v/v) over 15 min., followed by 100% solvent C (65/35/0.1 500 mM KCI/acetonitrile/trifluoroacetic acid v/v/v) over the next 15 min.
- solvent A 100/0.1 water/ trifluoroacetic acid v/v
- solvent B 65/35/0.1 250 mM KCI/acetonitrile/trifluoroacetic acid v/v/v
- solvent C 65/35/0.1 500
- the selected ions were then fragmented in the linear ion trap using collision-induced dissociation at a target value of 10,000.
- the Q-Exactive mass spectrometer was operated in top10-mode. Parameters were resolution 70,000 at an AGC target value of 3,000,000/maximum fill time of 20 ms (full scan) and resolution 17,500 at an AGC target value of 100,000/maximum fill time of 60 ms for MS/MS at an intensity threshold of 17,000. Apex trigger was set to 1 to 10 s. and allowed charges were 2-6.
- Proteome Discoverer version 2.1 (Thermo Fisher Scientific) was used for peptide and protein identification, using the mascot node for identification, using mascot version 2.2.04 with the UniProt Homo Sapiens database (UP000005640; Jan 2015; 67911 entries). Methionine oxidation and cysteinylation of cysteine were set as a variable modification. Peptide assignments were made with a precursor tolerance of 10 ppm and MS/MS fragment tolerance of 20 mmu for the Q-Exactive data and 2 ppm and 0.5 Da for LTQ-FTUItra data. Identification of the ANPM1-derived peptide was confirmed by its synthetic counterpart.
- Peptides were synthesized by standard Fmoc chemistry and dissolved in dimethyl sulfoxide. Cysteinylation of peptides was performed by treating 1 mM peptide with 2 mM 1 ,4-Dithiothreitol in 50 mM ammonium bicarbonate for 15 min. at 50°C, followed by addition of 10 mM free cysteine and 15 mM H2O2 for 30 min. at RT.
- pMHC tetramers were produced as outlined previously (7, 8). In brief, monomers consisting of recombinant HLA-A*02:01 heavy chain and human p2-microglobulin were purified by gel-filtration HPLC and biotinylated.
- pMHC tetramers were generated by adding PE-conjugated streptavidin (Invitrogen, Thermo Fisher Scientific). UV-exchange pMHC tetramers were produced by exposing biotinylated HLA-A*02:01 monomers containing UV-sensitive peptide to 366 nm UV light in the presence of cysteinylated ANPM1 peptide. After 1 hour of peptide exchange, monomers were incubated for 1 hour at 4°C followed by centrifugation at 4000g for 10 min. at 15°C. Tetramers were produced by adding streptavidin-conjugated PE to supernatants. pMHC tetramers were stored at 4°C.
- T cells were stained with FITC-conjugated antibodies against CD3, CD4, CD8 (BD Biosciences, San Jose, California, United States) and TCR-VP5.1 (Beckman Coulter, Brea, California, United States), APC-conjugated antibodies against CD3, CD4, CD8 and mouse TCR-Cp and PE- conjugated pMHC tetramers and antibodies against CD3, CD4 and CD8 (BD Biosciences).
- Cells were measured on a BD FACSCalibur II (BD Biosciences) using BD CellQuest Pro software (BD Biosciences) and analysis was performed with FlowJo software (Flowjo, LLC, Ashland, Oregon, United States).
- T cell isolation and culture pMHC tetramer positive CD8 T cells were isolated from PBMC from patients with AML and healthy individuals as previously described (9).
- PBMC from HLA-*02:01 positive AML patients and healthy individuals were stained with PE-conjugated pMHC tetramers containing ANPM1 peptides for 1 hour at 4°C followed by MACS isolation using anti-PE MicroBeads (Miltenyi Biotec).
- Isolated cells were stained with CD8-Alexa Fluor 700 (Invitrogen), CD4-FITC, CD14-FITC and CD19-FITC (BD Biosciences) antibodies and pMHC tetramer positive CD8 T cells were single cell sorted by a BD FACSAria III cell sorter (BD Biosciences) using BD FACSDiva v6 software (BD Biosciences).
- CD8-Alexa Fluor 700 Invitrogen
- CD4-FITC CD14-FITC
- CD19-FITC BD Biosciences
- pMHC tetramer positive CD8 T cells were single cell sorted by a BD FACSAria III cell sorter (BD Biosciences) using BD FACSDiva v6 software (BD Biosciences).
- Single T cells were stimulated with 50,000 irradiated allogeneic PBMC, 5000 irradiated allogeneic EBV-LCL and 0.8 pg/ml PHA (Oxoid Microbiology Products, Thermo Fisher Scientific) in 100 pl TCM per well in 96-wells U-bottom culture plates (Costar, Sigma-Aldrich). Growing T cell clones were restimulated every 10-14 days with irradiated feeder cells and PHA.
- T cell recognition was measured by IFN-y ELISA (Sanquin). Stimulator cells (30,000 cells) were co-incubated with T cells (2000 cells) in 40 pl TCM per well in 384-wells flat-bottom plates (Greiner Bio One, Kremsmunster, Austria). After overnight co-incubation, culture supernatants were harvested to measure IFN-y release.
- peptide recognition assays T2 cells (15,000 cells) were pre-incubated for 30 min. at 37°C with titrated peptide concentrations and washed twice before co-incubation with T cells. In blocking assays, target cells (10,000 cells) were preincubated for 60 min.
- T cell mediated cytotoxicity was measured in 51 chromium release assays.
- Primary AML cells were labelled with 100 pCi Na2 51 CrC>4 for 1 hour at 37°C, washed and co-incubated with T cells at various E:T ratios in 100 pl TCM per well in 96-wells Il-bottom culture plates (Costar). Spontaneous and maximum 51 Cr release were measured in separate plates containing 100 pl TCM or 100 pl TCM with 1 % Triton- X100 per well (Sigma-Aldrich), respectively.
- TCR a and p chain usage of clone 1A2 was determined as previously described (9) with minor modifications.
- T cells were lysed and mRNA was isolated by the Dynabeads mRNA DIRECT kit (Invitrogen).
- TCR-specific cDNA was generated using two TCR-Cp specific primers, a TCR-Ca specific primer, a SA.rt anchor template-switching oligonucleotide (TSO) and SMARTScribe Reverse Transcriptase (Takara, Clontech, Mountain View, California, United States).
- SMARTScribe reverse transcriptase adds a 3’ non- templated polycytosine terminus, which allows for annealing of the TSO and 2 nd strand cDNA synthesis.
- TCR amplification was performed by PCR using Phusion Flash (Thermo Fisher Scientific), an anchor-specific primer and nested primers annealing to TCR-Ca or -Cp regions.
- TCR sequences for clone 1A2 were identified as TRAV12-2 and TRBV5-1 by Sanger sequencing (Macrogen, Amsterdam, the Netherlands) and the ImMunoGeneTics (IMGT) database (10).
- Codon-optimized TRAV12-2 and TRBV5-1 sequences were synthesized and cloned in the MP71-TCR-flex retroviral vector (11) by GenScript (Piscataway, New Jersey, United States).
- MP71-TCR-flex murine TCR-Ca and -Cp regions contain additional cysteine residues to promote preferential pairing and expression of the TCR, linked by a porcine teschovirus-derived P2A sequence.
- the construct was transfected into packaging cells ⁇
- CD4 and CD8 cells were isolated by MACS using anti-CD4 MicroBeads (Miltenyi Biotec) followed by the CD8 T Cell Isolation Kit (Miltenyi Biotec).
- CD8 and CD4 cells were stimulated with irradiated autologous feeders and 0.8 pg/ml PHA in 24-wells flat bottom culture plates (Costar). Two days after stimulation, T cells were transferred to 24-wells flat bottom suspension culture plates (Greiner Bio-One) for retroviral transduction as described previously (9, 12). Prior to addition of T cells, the plates were coated with 30 mg/mL retronectin (Takara, Clontech) and blocked with 2% human serum albumin (Sanquin).
- Retroviral supernatants were added and plates were centrifuged at 3000g for 20 min. at 4°C. T cells were added to the plates with viral supernatants at 300,000 cells per well. After overnight incubation, T cells were transferred to 24-wells flat bottom culture plates. At day 6 after transduction, TCR-transduced T cells were stained with an APC-conjugated antibody against mouse TCR-Cp for 15 min. at 4°C followed by MACS isolation using anti-APC MicroBeads (Miltenyi Biotec). TCR-transduced T cells were restimulated every 10-14 days with irradiated allogeneic PBMC and EBV-LCL and 0.8 pg/ml PHA. Prior to analysis, re-stimulated TCR-transduced T cells were enriched by MACS using antimouse TCR-Cp-APC and anti-APC MicroBeads as described above.
- HLA class I HLA class I surface molecules from 12 primary AML samples, eluted the peptides from the binding groove and analyzed the peptidome by mass spectrometry.
- Table I shows the HLA class I typing of the 12 AML samples as well as their mutational status for NPM1.
- the 4-bp frameshift insertion in exon 12 of the NPM1 gene is a recurrent mutation that occurs in 30% of primary AML.
- the presence of AN PM 1 was demonstrated by PCR fragment analysis.
- AN PM 1 protein which is 4 AA longer than its wild type counterpart with 11 AA (CLAVEEVSLRK (SEQ ID NO:27)) at the C-terminus translated in an alternative reading frame.
- CLAVEEVSLRK SEQ ID NO:27
- ANPM1 protein a protein region spanning 10 N-terminal residues in the normal reading frame followed by the 11 C-terminal AA in the alternative reading frame (MTDQEAIQDLCLAVEEVSLRK (SEQ ID NO:34) was searched for matching peptides in the HLA class I ligandomes as analyzed from the 12 primary AML.
- Table 2 Peptide binding affinity to HLA class I alleles as predicted by NetMHCpan3.0. a Lower limit of predicted binding affinity (nM) for all other HLA class I alleles that are expressed by primary AML samples from which the peptide is eluted.
- CLAVEEVSL (SEQ ID NO:1) is a neoantigen that can be targeted by immunotherapy
- the inventors searched for specific T-cells in patients with AML.
- PE-conjugated pMHC tetramers were produced for CLAVEEVSL (SEQ ID NO:1) (ANPM1-CLA) and its cysteinylated variant C*LAVEEVSL (cysteinylated form of SEQ ID NO:1) (ANPM1-C*LA) and a mix of these tetramers was used to isolate specific T cells from CLAVEEVSL (SEQ ID NO:1) (ANPM1-CLA) and its cysteinylated variant C*LAVEEVSL (cysteinylated form of SEQ ID NO:1) (ANPM1-C*LA) and a mix of these tetramers was used to isolate specific T cells from
- PBMC from 6 HLA-A*02:01 positive patients with ANPM1 AML who were in remission after chemotherapy. T cells binding to one or both pMHC tetramers were enriched by magnetic anti- PE beads and single tetramer positive CD8 cells were isolated by flow cytometry (Table 3). Table 3. T cell isolations from patients with HLA-A*02:01 positive ANPM1 AML. a Number of days after diagnosis. b PBMC, peripheral blood mononuclear cells. Indicated are the numbers of PBMC from HLA- A*02:01 positive patients with ANPM1 AML that are used for T cell isolation.
- c PBMC were stained with anti-CD8-ALX700 and a mix of PE-conjugated pMHC tetramers for CLAVEEVSL (SEQ ID NO:1) and its cysteinylated variant C*LAVEEVSL (cysteinylated form of SEQ ID NO:1). Indicated are the numbers of tetramer positive CD8 cells that are sorted. d Number of T cell clones that are positive for ANPM1-CLA or ANPM1-C*LA tetramers. A total number of 41 tetramer positive CD8 cells were isolated from 42*10 6 PBMC from 4 patients, of which 5 T cells from 3 patients clonally expanded.
- T cell clones None of the 5 T cell clones, however, could be stained with either the ANPM1-CLA tetramer or the ANPM1-C*LA tetramer, demonstrating that T cells for CLAVEEVSL (SEQ ID NO:1) do not exist or that frequencies are below the threshold of detection. Therefore, the same strategy was followed to search for specific ? cells in large numbers of PBMC from 6 HLA-A*02:01 positive healthy individuals (Table 4). A variable number of 8-55 tetramer positive CD8 cells were isolated from 460- 1970x10 6 total PBMC from each healthy individual. Of these cells, 31 T cells from 5 individuals clonally expanded and 13 T cell clones from 4 individuals were positive for the ANPM1-CLA tetramer. Of these 13 clones, 3 T cell clones could also be stained with the ANPM1-C*LA tetramer (Table 4 and Figure 3A).
- T cell isolation for ANPM1 from healthy individuals a PBMC, peripheral blood mononuclear cells. Indicated are the numbers of PBMC from HLA- A*02:01 positive healthy individuals that are used for T cell isolation.
- b PBMC were stained with anti-CD8-ALX700 and a mix of PE-conjugated pMHC tetramers for CLAVEEVSL (SEQ ID NO:1) and its cysteinylated variant C*LAVEEVSL (cysteinylated form of SEQ ID NO:1). Indicated are the numbers of tetramer positive CD8 cells that are sorted.
- T cell clones (1A2 and 4A8) showed specific reactivity against T2 cells loaded with CLAVEEVSL (SEQ ID NO:1), but not the control peptide NLVPMVATV (SEQ ID NO:31) ( Figure 3B).
- Clone 1A2 also showed recognition of T2 cells loaded with C*LAVEEVSL (cysteinylated from of SEQ ID NO:1).
- T cell clone 1A2 showed reactivity against all 3 AML with ANPM1 to different extents, whereas clone 4A8 showed relatively low reactivity against 2 of 3 samples with ANPM1 ( Figure 3C).
- Strong T cell reactivity against AML by clone 1A2 may be explained by its capacity to recognize cysteinylated ANPM1 as eluted from the cell surface of primary AML as well as uncysteinylated ANPM1.
- ANPM1 is a recurrent 4-bp insertion that occurs in 30% of primary AML and HLA-A*02:01 is expressed in 50% of the Caucasian population
- CLAVEEVSL SEQ ID NO:1
- primary AML were most strongly recognized by clone 1A2
- mRNA was isolated from this clone and cDNA was generated to sequence the variable regions of the TCR a and p chains for ANPM1.
- Codon-optimized gene sequences for TRAV12-2 and TRBV5-1 as expressed by T cell clone 1A2 were synthesized and cloned into a modified MP71-TCR-flex retroviral vector.
- variable regions of the TCR were cloned in-frame with murine constant regions linked by a P2A sequence.
- the TCR for ANPM1 and, as a control, the TCR for the HLA-A*02:01-restricted CMV peptide NLVPMVATV (SEQ ID NO:31) were introduced into CD8 and CD4 cells that were isolated from PBMC from healthy HLA-A*02:01 positive individuals (donor 1 and 2).
- TCR-transduced CD8 and CD4 cells were purified using an APC-conjugated antibody against mouse TCR-Cp and magnetic anti-APC beads.
- TCR-transduced CD4 cells (CD40NPM1 and CD40CMV)
- results were similar as for CD8 cells, indicating that binding of the ANPM1- CLA tetramer to TCR-transduced T cells occurs independent of the CD8 co-receptor.
- TCR- transduced CD8 and CD4 cells could also be stained with an antibody against mouse TCR-Cp and CD8 and CD4 cells transduced with the TCR for AN PM 1 also showed specific binding to an antibody against human TCR-VP5.1 (data not shown).
- the inventors then analyzed the functionality of CD8 and CD4 cells transduced with the TCR for ANPM1 and demonstrated specific release of IFN-y upon co-incubation with HLA-A*02:01 positive T2 cells loaded with CLAVEEVSL (SEQ ID NO:1), but not upon co-incubation with the CMV peptide NLVPMVATV (SEQ ID NO:31) (Figure 4B). Specific release of IFN-y was also observed upon co-incubation with AML cell line OCI-AML3 with ANPM1 , but not upon stimulation with AML cell line OCI-AML2 with wtNPMI ( Figure 4C).
- TCR-transduced CD8 and CD4 cells were subsequently tested for reactivity against a panel of 13 HLA-A*02:01 positive primary AML including 9 samples with ANPM1 and 4 samples with wtNPMI .
- CD8 and CD4 cells both showed recognition of all 9 primary AML with ANPM1 , whereas no specific recognition of AML with wtNPMI was observed (Figure 5).
- CD8 and CD4 cells transduced with the TCR for ANPM1 also lacked reactivity against HLA-A*02:01 negative AML with ANPM1 and mature DC with wtNPMI (Figure 6).
- transduced T cells were tested for reactivity against monocyte-derived mature DC from donor 1 and 2 and a panel of 40 HLA-A*02:01 positive third-party EBV-LCL as non- malignant cell types with strong antigen processing and presentation capacity.
- CD8 and CD4 cells transduced with the TCR for ANPM1 failed to recognize mature DC or EBV-LCL, indicating that alternative translation of the wtNPMI gene does not occur and that this gene does not produce a peptide resembling CLAVEEVSL (SEQ ID NO:1).
- the data show that the TCR for ANPM1 upon gene transfer to CD8 and CD4 cells results in specific recognition of CLAVEEVSL (SEQ ID NO:1) as endogenous neoantigen presented by HLA-A*02:01 on primary AML with ANPM1.
- CLAVEEVSL SEQ ID NO:1
- the inventors tested the cytolytic capacity of TCR-transduced CD8 and CD4 cells against primary AML.
- TCR-transduced T cells were tested against a panel of 6 HLA-A*02:01 positive primary AML including 4 samples with ANPM1 and 2 samples with wtNPMI in a 9 hrs 51 chromium release assay.
- the inventors have identified an HLA-A*02:01 -restricted 9-mer peptide encoded by ANPM1 (CLAVEEVSL (SEQ ID NO:1)) in the HLA class I ligandome of primary AML.
- T cell clones with a TCR specific for this peptide were isolated from healthy individuals and the TCR from one of the clones was shown to mediate specific recognition and lysis of primary AML with ANPM1 upon retroviral introduction in CD8 and CD4 cells, indicating that CLAVEEVSL (SEQ ID NO:1) is a therapeutic neoantigen on AML that can be targeted by TCR gene transfer in a co-receptor independent fashion.
- C*LAVEEVSL (cysteinylated form of SEQ ID NO:1) as a peptide that is endogenously processed and presented on AML with ANPM1. Although no match was found between the eluted and synthetic peptide in the absence of cysteinylation, the data provide strong evidence that also the uncysteinylated CLAVEEVSL (SEQ ID NO:1) peptide is presented on AML.
- Clone 1A2 which was selected for TCR cloning and gene transfer, was shown to recognize both synthetic C*LAVEEVSL (cysteinylated form of SEQ ID NO:1) and CLAVEEVSL (SEQ ID NO:1) peptides.
- the clone could also be stained with both pMHC tetramers, although binding to the tetramer with the cysteinylated peptide was weaker.
- Experiments in which synthetic peptides with serine substitutions were tested confirmed that the first residue of the epitope is not essential for reactivity of clone 1A2.
- results were different.
- Clone 4A8 recognized CLAVEEVSL (SEQ ID NO:1), but not C*LAVEEVSL (cysteinylated form of SEQ ID NO:1), and only the pMHC tetramer with the uncysteinylated peptide could bind to the T cell clone.
- AML arises from a single founding clone harboring hundreds of somatic mutations with only a few driver mutations. Subclones can emerge from the founding clone through accumulation of additional mutations that confer survival advantage to the cell. As a result, the majority of mutations in subclones are shared with the founding clone and a minority is clone-specific. This heterogeneous composition of AML increases the chance for clonal evolution in persistent or relapsed disease after induction or consolidation therapy. Targeting neoantigens arising from Ill shared mutations is an attractive immunotherapeutic strategy to eradicate the founding clone as well as subclones.
- Neoantigens arising from passenger mutations can be easily lost as a result of immune editing of the tumor by T cells, resulting in tumor immune evasion. Immune escape is less likely to occur when neoantigens produced by driver mutations are targeted, since these are essential for malignant transformation and present in all tumor cells. 16 Thus far, only a few neoantigens arising from driver mutations have been identified of which mutant KRAS leads to an antigen that is expressed in 45% of pancreatic cancers and 13% of colorectal cancers. 17 Although immune evasion for neoantigens arising from driver mutations is less likely, Tran et al.
- ANPM1 as clonal driver mutation occurring early in leukemogenesis remains an attractive target for immunotherapy.
- ANPM1 is also an ideal target based on its high mutation frequency in 30% of primary AML. 6
- the characteristic 4 bp frameshift insertion occurs at a restricted number of positions in the coding sequence (859, 860 and 861) and although the exact 4-bp sequence can differ, the majority of mutations encode the same 11 amino acids alternative reading frame (CLAVEEVSLRK (SEQ ID NO:27)).
- CLAVEEVSLRK SEQ ID NO:27
- This TCR can be used for future gene therapy to treat patients with AML with ANPM1.
- Clinical studies will show efficacy and potential toxicity of AN PM 1 TCR gene therapy and whether immune evasion by loss of HLA-A*02:01 is of any significance in hampering long-term remission of AML.
- the TCR isolated from clone 1A2 was shown to mediate specific recognition and lysis of HLA- A*02:01 positive AML cells with ANPM1 upon transfer to CD8 as well as CD4 cells, demonstrating that the TCR is able to redirect immune reactivity to AML in a co-receptor independent manner.
- the key role of CD4 cells in anti-tumor immunity has become more apparent over the last few decades. Traditionally, CD4 cells are known to provide help to CD8 cells, resulting in improved tumor clearance and induction of immunological memory. However, growing evidence suggests that CD4 cells can also mediate tumor rejection in the absence of CD8 cells.
- ANPM1 has been described as reliable marker for measuring minimal residual disease in patients with AML. 21 Persistence of AN PM 1 transcripts as detected by quantitative RT-PCR in peripheral blood of patients after chemotherapy was associated with disease relapse within 3 years of follow-up. The prognostic value of ANPM1 was shown to be independent of other risk factors such as presence of FLT3-ITD or mutated DNA methyltransferase 3 alpha (D/V/WT3A).
- ANPM1 as marker for disease status can be used to select patients eligible for alloSCT and allows optimal timing and selection of patients for ANPM1 TCR gene therapy to treat persistent or relapsed disease after chemotherapy.
- Healthy individuals were screened for T cell clones recognizing AVEEVSLRK (SEQ ID NO:26) or CLAVEEVSLRK (SEQ ID NO:27) in HLA-A*03:01 or HLA-A*11 :01 following the same strategy as described for T cell clone 1A2 recognizing CLAVEEVSL (SEQ ID NO:1) in HLA- A*02:01.
- PE-labelled pHLA-tetramers were produced for AVEEVSLRK (SEQ ID NO:26) in HLA-A*03:01, CLAVEEVSLRK (SEQ ID NO:27) in HLA-A*03:01 , AVEEVSLRK (SEQ ID NO:26) in HLA-A*11:01 and CLAVEEVSLRK (SEQ ID NO:27) in HLA-A*11:01.
- Peripheral blood mononuclear cells from healthy individuals were incubated with a mix of the four PE-labelled pHLA-tetramers, and pHLA-tetramer positive T cells were isolated using magnetic anti-PE beads.
- single pHLA-tetramer positive CD8+ T cells were isolated by flow cytometry, expanded and analyzed for reactivity by IFN-y ELISA against AML cell lines OCI- AML2 (wildtype NPM1) and OCI-AML3 (mutant NPM1) either non-transduced or transduced with HLA-A*03:01 or HLA-A*11:01.
- T cell clones selectively recognizing OCI-AML3 transduced with HLA-A*03:01 or HLA-A*11:01 were analyzed for pHLA-tetramer staining by flow cytometry and re-analyzed for reactivity by IFN-y ELISA against the same panel of AML cell lines and T2 cells transduced with the relevant HLA restriction allele and pulsed with titrated concentrations of the peptide of interest.
- a total of 42 healthy individuals were screened who were positive for HLA-A*03:01 and/or HLA- A*11 :01.
- Three pHLA-tetramer positive T cell clones were isolated that were able to specifically react against OCI-AML3 transduced with HLA-A*03:01 or HLA-A*11 :01 and peptide-pulsed T2 cells transduced with HLA-A*03:01 or HLA-A*11:01. T cell clone 31.3.
- F1 is specific for AVEEVSLRK (SEQ ID NO:26) in HLA-A*03:01 ( Figure 40A) and T cell clones 6F11 and 26.2.D6 are specific for AVEEVSLRK (SEQ ID NO:26) in HLA-A*11:01 ( Figure 40B). All three T cell clones were able to react against primary AML with mutant NPM1 expressing the relevant HLA restriction allele, but not against AML cases with wildtype N PM 1. T cell clones 31.3. F1 and 6F11 were isolated from individuals who were positive for the relevant HLA-A*03:01 and HLA- A*11:01 restriction alleles, respectively, whereas T cell clone 26.2. D6 was isolated from an HLA-A*11 :01 negative individual.
- T cell clone 1A2 Similar as for T cell clone 1A2, the TCRs of T cell clones 6F11 , 31.3.F1 and 26.2. D6 were sequenced, cloned and tested for reactivity against AML by IFN-y ELISA. The human TCR alpha and beta variable regions were sequenced and cloned in MP71-flex, which contains precloned murine TCR alpha and beta constant genes.
- CD8+ cells were isolated from HLA- A*03:01 or HLA-A*11:01 positive healthy individuals and stimulated with PHA, IL-2 and autologous irradiated peripheral blood mononuclear cells as feeder cells. On day 2, CD8+ cells were transduced with the TCRs for mutant NPM1.
- TCR-T TCR-transduced T cells
- TCR-T cells Two weeks after restimulation, TCR-T cells were analyzed for pHLA-tetramer staining by flow cytometry and reactivity against OCI-AML2 (wildtype NPM1) and OCI-AML3 (mutant NPM1) cell lines transduced with HLA-A*03:01 or HLA-A*11 :01 by IFN-y ELISA.
- the TCR of clone 31.3.F1 showed specific binding to the pHLA-A*03:01-AVEEVSLRK (SEQ ID NO:26) tetramer and specific reactivity against OCI-AML3 transduced with HLA-A*03:01 ( Figure 41 A).
- the TCRs of clones 6F11 and 26.2. D6 showed specific binding to the pHLA-A*11 :01- AVEEVSLRK tetramer and specific reactivity against OCI-AML3 transduced with HLA-A*11 :01 ( Figure 41 B and 41 C).
- T cell clones 26.2. D6 and 6F11 as well as the corresponding TCR-T cells have been compared for in vitro reactivity against primary human AML samples as well as in vivo reactivity against AML cell line OCI-AML3 in NSG mice.
- the T cell clone and TCR of clone 26.2. D6 is particularly advantageous. This has been most clearly demonstrated in NSG mice, where 26.2. D6 TCR-T cells induced a similar anti-tumor effect against OCI-AML3 as the NPM1 specific HLA-A*02:01 restricted TCR-T cells, which is superior to that observed for 6F11 TCR-T cells.
- T cell clone 31.3.F1 is also particularly advantageous due to its specificity for AVEEVSLRK in A*03:01. Clone 31 .3.F1 also clearly reacts against primary human AML samples in vitro.
- SEQ ID NO: 35 to 50 relate to a novel dNPM1-A*11 :01 TCR (clone 26.2. D6) (TCR alpha chain - TRAV5*01 , TRAJ26*01 ; TCR beta chain - TRBV19*03, TRBJ2-7*01):
- SEQ ID NO: 36 nucleic acid sequence encoding CDR3 (TCR a chain, clone 26.2. D6): TGTGCAGAGAGTAAAGGTCAGAATTTTGTCTTT
- SEQ ID NO: 37 amino acid sequence of a chain variable region, clone 26.2.
- D6 GEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTV LLNKKDKHLSLRIADTQTGDSAIYFCAESKGQNFVFGPGTRLSVLP
- SEQ ID NO: 38 nucleic acid sequence encoding a chain variable region, clone 26.2. D6: GGAGAGGATGTGGAGCAGAGTCTTTTCCTGAGTGTCCGAGAGGGAGACAGCTCCGTTATA AACTGCACTTACACAGACAGCTCCTCCACCTACTTATACTGGTATAAGCAAGAACCTGGAG CAGGTCTCCAGTTGCTGACGTATATTTTTTCAAATATGGACATGAAACAAGACCAAAGACTC ACTGTTCTATTGAATAAAAAGGATAAACATCTGTCTCTGCGCATTGCAGACACCCAGACTG
- SEQ ID NO: 40 nucleic acid sequence encoding CDR1 (TOR a chain, clone 26.2. D6): GACAGCTCCTCCACCTAC
- SEQ ID NO: 42 nucleic acid sequence encoding CDR2 (TOR a chain, clone 26.2. D6): ATTTTTTCAAATATGGACATG
- SEQ ID NO: 44 nucleic acid sequence encoding CDR3 (TOR chain, clone 26.2. D6):
- SEQ ID NO: 46 nucleic acid sequence encoding p chain variable region, clone 26.2. D6: GATGGTGGAATCACTCAGTCCCCAAAGTACCTGTTCAGAAAGGAAGGACAGAATGTGACC
- SEQ ID NO: 48 nucleic acid sequence encoding CDR1 (TOR p chain, clone 26.2. D6): TTGAACCACGATGCC
- SEQ ID NO: 49 amino acid sequence of CDR2 (TOR p chain, clone 26.2. D6): SHIVND
- SEQ ID NO: 50 nucleic acid sequence encoding CDR2 (TOR chain, clone 26.2. D6): TCACACATAGTAAATGAC
- SEQ ID NO: 51 to 66 relate to a novel dNPM1-A*11:01 TOR (clone 6F11) (TOR alpha chain - TRAV8-6*02, TRAJ49*01 ; TOR beta chain - TRBV7-6*01, TRBJ 1-5*01):
- SEQ ID NO: 52 nucleic acid sequence encoding CDR3 (TOR a chain, clone 6F11):
- SEQ ID NO: 54 nucleic acid sequence encoding a chain variable region, clone 6F11 :
- SEQ ID NO: 55 amino acid sequence of CDR1 (TOR a chain, clone 6F11): SSVSVY
- SEQ ID NO: 56 nucleic acid sequence encoding CDR1 (TOR a chain, clone 6F11): TCGTCTGTTTCAGTGTAT
- SEQ ID NO: 58 nucleic acid sequence encoding CDR2 (TOR a chain, clone 6F11): TATTTATCAGGATCCACCCTGGTT
- SEQ ID NO: 59 amino acid sequence of CDR3 (TOR p chain, clone 6F11): CASSLGSNQPQHF
- SEQ ID NO: 60 nucleic acid sequence encoding CDR3 (TOR chain, clone 6F11):
- SEQ ID NO: 62 nucleic acid sequence encoding p chain variable region, clone 6F11 :
- SEQ ID NO: 66 nucleic acid sequence encoding CDR2 (TCR p chain, clone 6F11): TTCAATTATGAAGCCCAA
- SEQ ID NO: 67 to 82 relate to a novel dNPM1-A*03:01 TCR (clone 31.3.F1) (TCR alpha chain - TRAV12-2*02, TRAJ26*01; TCR beta chain - TRBV14*01, TRBJ 1-5*01):
- SEQ ID NO: 68 nucleic acid sequence encoding CDR3 (TCR a chain, clone 31.3.F1):
- SEQ ID NO: 70 nucleic acid sequence encoding a chain variable region, clone 31.3.F1 : CAGAAGGAGGTGGAGCAGAATTCTGGACCCCTCAGTGTTCCAGAGGGAGCCATTGCCTCT
- SEQ ID NO: 72 nucleic acid sequence encoding CDR1 (TCR a chain, clone 31.3.F1): GACCGAGGTTCCCAGTCC
- SEQ ID NO: 74 nucleic acid sequence encoding CDR2 (TCR a chain, clone 31.3.F1): ATATACTCCAATGGTGAC
- SEQ ID NO: 76 nucleic acid sequence encoding CDR3 (TCR chain, clone 31.3.F1):
- SEQ ID NO: 80 nucleic acid sequence encoding CDR1 (TOR chain, clone 31.3.F1): TCTGGACATGATAAT
- a polypeptide comprising a CDR3 of a TCR chain polypeptide that specifically binds to a peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- Paragraph 2 The isolated nucleic acid sequence of paragraph 1 , wherein the nucleic acid sequence encodes both (a) and (b), wherein (a) and (b) together specifically bind to the peptide selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28) and AVEEVSLR (SEQ ID NO:29).
- CLAVEEVSL SEQ ID NO:1
- AVEEVSLRK SEQ ID NO:26
- CLAVEEVSLRK SEQ ID NO:27
- VEEVSLRK SEQ ID NO:28
- AVEEVSLR SEQ ID NO:29
- Paragraph 3 The isolated nucleic acid sequence of any preceding paragraph, wherein the encoded polypeptide(s) specifically bind to CLAVEEVSL (SEQ ID NO:1).
- Paragraph 4 The isolated nucleic acid sequence of paragraph 3, wherein the CDR3 of (a) has an amino acid sequence having at least 90% sequence identity to CAVTGARLMF (SEQ ID NO:2).
- Paragraph 5 The isolated nucleic acid sequence of paragraph 4, wherein the CDR3 of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 3 or SEQ ID NO:4.
- Paragraph 6 The isolated nucleic acid sequence of any one of paragraphs 3 to 5, wherein the CDR3 of (b) has an amino acid sequence having at least 90% sequence identity to CASSPGGLSNEQF (SEQ ID NO:5).
- Paragraph 7 The isolated nucleic acid sequence of paragraph 6, wherein the CDR3 of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 6 or SEQ ID NO:7.
- Paragraph 8 The isolated nucleic acid sequence of any one of paragraphs 3 to 7, wherein the CDR3 of (a) is within a TCR a chain variable region that specifically binds to SEQ ID NO:1 , optionally wherein (a) further comprises a TCR a chain constant region.
- Paragraph 9 The isolated nucleic acid sequence of paragraph 8, wherein the TCR a chain variable region has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:8.
- Paragraph 10 The isolated nucleic acid sequence of paragraph 9, wherein the TCR a chain variable region of (a) is encoded by the nucleic acid sequence of SEQ ID NO: 9 or SEQ ID NQ:10.
- Paragraph 11 The isolated nucleic acid sequence of any one of paragraphs 3 to 10, wherein the CDR3 of (b) is within a TCR p chain variable region that specifically binds to SEQ ID NO:1 , optionally wherein (b) further comprises a TCR chain constant region.
- Paragraph 12 The isolated nucleic acid sequence of paragraph 11 , wherein the TCR p chain variable region has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:11.
- Paragraph 13 The isolated nucleic acid sequence of paragraph 12, wherein the TCR p chain variable region of (b) is encoded by the nucleic acid sequence of SEQ ID NO: 12 or SEQ ID NO:13.
- Paragraph 14 The isolated nucleic acid sequence of any one of paragraphs 3 to 13, wherein the CDR3 of (a) is within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:8, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 2; and optionally wherein (a) comprises a TCR a chain constant region.
- Paragraph 15 The isolated nucleic acid sequence of paragraph 14, wherein the TCR a chain variable region CDR1 has an amino acid sequence of SEQ ID NO:14 and the TCR a chain variable region CDR2 has an amino acid sequence of SEQ ID NO:15.
- Paragraph 16 The isolated nucleic acid sequence of any one of paragraphs 3 to 15, wherein the CDR3 of (b) is within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:11 , wherein the CDR3 has an amino acid sequence of SEQ ID NO: 5; and optionally wherein (b) comprises a TCR chain constant region.
- Paragraph 17 The isolated nucleic acid sequence of paragraph 16, wherein the TCR p chain variable region CDR1 has an amino acid sequence of SEQ ID NO: 16 and the TCR p chain variable region CDR2 has an amino acid sequence of SEQ ID NO:17.
- Paragraph 18 The isolated nucleic acid sequence of any preceding paragraph, wherein the peptide CLAVEEVSL (SEQ ID NO:1) is cysteinylated.
- Paragraph 19 The isolated nucleic acid sequence of any preceding paragraph, wherein the nucleic acid sequence encodes a T cell receptor.
- Paragraph 20 A vector comprising a nucleic acid sequence according to any one of paragraphs 1 to 19.
- Paragraph 21 The vector of paragraph 20, wherein the vector is a plasmid or a viral vector, optionally wherein the vector is selected from the group consisting of a retrovirus, lentivirus, adeno-associated virus, adenovirus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or RNA.
- the vector is selected from the group consisting of a retrovirus, lentivirus, adeno-associated virus, adenovirus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or RNA.
- Paragraph 22 A modified cell transfected or transduced with a nucleic acid sequence according to any of paragraphs 1 to 19, or a vector according to paragraph 20 or 21.
- Paragraph 23 The modified cell of paragraph 22, wherein the modified cell is selected from the group consisting of a CD8 T cell, a CD4 T cell, an NK cell, an NKT cell, a gamma-delta T cell, a hematopoietic stem cell, a progenitor cell, a T cell line or a NK-92 cell line.
- Paragraph 24 The modified cell of paragraph 22 or 23, wherein the modified cell is a human cell.
- Paragraph 25 An isolated peptide comprising an amino acid sequence selected from:
- VEEVSLRK (SEQ ID NO:28);
- Paragraph 26 The peptide of paragraph 25, wherein the cysteine amino acid of CLAVEEVSLRK (SEQ ID NO:27) is cysteinylated.
- Paragraph 27 The peptide of paragraph 25 or 26, wherein the peptide has no more than 20 amino acids.
- Paragraph 28 The peptide of paragraph 27, wherein the peptide consists of a sequence selected from:
- VEEVSLRK (SEQ ID NO:28);
- Paragraph 29 An isolated nucleic acid sequence encoding the peptide of any one of paragraphs 25 to 28.
- Paragraph 30 A vector comprising the nucleic acid sequence of paragraph 29.
- Paragraph 31 A pharmaceutical composition comprising a nucleic acid sequence according to any of paragraphs 1 to 19, or paragraph 29, a vector according to paragraph 20, 21 or 30, a modified cell according to any of paragraphs 22 to 24, or an isolated peptide according to any of paragraphs 25 to 28, and a pharmaceutically acceptable excipient, adjuvant, diluent and/or carrier.
- Paragraph 32 The pharmaceutical composition of paragraph 31, wherein the composition comprises an isolated peptide according to any of paragraphs 25 to 28, a nucleic acid according to paragraph 29, or a vector according to paragraph 30, wherein the pharmaceutical composition is formulated as a vaccine.
- Paragraph 33 A method of treating or preventing a ANPM1 positive haematological malignancy in a human subject, the method comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition according to paragraph 31 or 32.
- Paragraph 34 The method of paragraph 33, wherein the haematological malignancy is a myeloid malignancy.
- Paragraph 35 The method of paragraph 34, wherein the myeloid malignancy is acute myeloid leukemia.
- Paragraph 36 The method of any of paragraphs 33 to 35, wherein the method induces or enhances a cell mediated immune response in the subject.
- Paragraph 37 A pharmaceutical composition according to paragraph 31 or 32 for use in treating or preventing a ANPM1 positive haematological malignancy in a human subject.
- Paragraph 38 The pharmaceutical composition for use according to paragraph 37, wherein the haematological malignancy is a myeloid malignancy.
- Paragraph 39 The pharmaceutical composition for use according to paragraph 37 or 38, wherein the myeloid malignancy is acute myeloid leukemia.
- Paragraph 40 The pharmaceutical composition for use according to any of paragraphs 37 to 39, wherein the pharmaceutical composition is for use in inducing or enhancing a cell mediated immune response in the subject.
- Paragraph 41 Use of a pharmaceutical composition according to paragraph 31 or 32 in the manufacture of a medicament for treating or preventing a ANPM1 positive haematological malignancy in a human subject.
- Paragraph 42 The use of paragraph 41 , wherein the haematological malignancy is a myeloid malignancy.
- Paragraph 43 The use of paragraph 42, wherein the myeloid malignancy is acute myeloid leukemia.
- Paragraph 44 A method of generating a T cell receptor, comprising contacting a nucleic acid sequence according to any of paragraphs 1 to 19 with a cell under conditions in which the nucleic acid sequence is incorporated and expressed by the cell to generate the T cell receptor that specifically binds to a peptide selected from SEQ ID NO:1 , SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, or SEQ ID NO: 29.
- Paragraph 45 The method of paragraph 44, wherein the method is ex vivo.
- Paragraph 46 Use of a peptide as a biomarker for a ANPM1 positive haematological malignancy in a human subject, wherein the peptide is selected from:
- VEEVSLRK (SEQ ID NO:28);
- Paragraph 47 A method of diagnosing a ANPM1 positive haematological malignancy in a human subject comprising: determining the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from: (i) CLAVEEVSL (SEQ ID NO:1); (ii) AVEEVSLRK (SEQ ID NO:26); (iii) CLAVEEVSLRK (SEQ ID NO:27); (iv) VEEVSLRK (SEQ ID NO:28); and (v) AVEEVSLR (SEQ ID NO:29), wherein the presence of the peptide in the sample identifies the subject as having a ANPM1 positive haematological malignancy and wherein the absence of the peptide in the sample identifies the subject as not having a ANPM1 positive haematological malignancy.
- Paragraph 48 A method of treating or preventing a AN PM 1 positive haematological malignancy in a human subject, the method comprising:
- determining the presence of a peptide in a sample isolated from the subject wherein the peptide is selected from CLAVEEVSL (SEQ ID NO:1), AVEEVSLRK (SEQ ID NO:26), CLAVEEVSLRK (SEQ ID NO:27), VEEVSLRK (SEQ ID NO:28), and AVEEVSLR (SEQ ID NO:29); and
- Paragraph 49 A pharmaceutical composition according to paragraph 31 or 32 for use in treating or preventing a ANPM1 positive haematological malignancy in a human subject, wherein the subject has been identified as having a ANPM1 positive haematological malignancy by the presence of a peptide in a sample isolated from the subject, wherein the peptide is selected from:
- VEEVSLRK (SEQ ID NO:28);
- Paragraph 50 An isolated nucleic acid sequence comprising a promoter operably linked to a nucleic acid sequence encoding:
- Paragraph 51 The isolated nucleic acid sequence of paragraph 50, wherein the nucleic acid sequence encodes both (a) and (b), wherein (a) and (b) together specifically bind to the peptide AVEEVSLRK (SEQ ID NO:26).
- Paragraph 52 The isolated nucleic acid sequence of paragraph 50, wherein:
- the CDR3 of (a) has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:35, SEQ ID NO: 51 or SEQ ID NO:67;
- the CDR3 of (b) has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:43, SEQ ID NO:59, or SEQ ID NO:75;
- the CDR3 of (a) is within a TCR a chain variable region that specifically binds to SEQ ID NO:26, optionally wherein (a) further comprises a TCR a chain constant region; optionally wherein the TCR a chain variable region has an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 37, SEQ ID NO:53 or SEQ ID NO: 69;
- the CDR3 of (b) is within a TCR p chain variable region that specifically binds to SEQ ID NO:26, optionally wherein (b) further comprises a TCR chain constant region, optionally wherein the TCR p chain variable region has an amino acid sequence having at least 90% sequence identity to SEQ ID NO:45, SEQ ID NO: 61 or SEQ IS NO: 77;
- the CDR3 of (a) is within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:37, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 35; and optionally wherein (a) comprises a TCR a chain constant region, and optionally wherein the TCR a chain variable region CDR1 has an amino acid sequence of SEQ ID NO:39 and the TCR a chain variable region CDR2 has an amino acid sequence of SEQ ID NO:41 ;
- the CDR3 of (a) is within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:53, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 51; and optionally wherein (a) comprises a TCR a chain constant region, and optionally wherein the TCR a chain variable region CDR1 has an amino acid sequence of SEQ ID NO:55 and the TCR a chain variable region CDR2 has an amino acid sequence of SEQ ID NO:57;
- the CDR3 of (a) is within a TCR a chain variable region having at least 90% sequence identity to SEQ ID NO:69, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 67; and optionally wherein (a) comprises a TCR a chain constant region, and optionally wherein the TCR a chain variable region CDR1 has an amino acid sequence of SEQ ID NO:71 and the TCR a chain variable region CDR2 has an amino acid sequence of SEQ ID NO:73;
- the CDR3 of (b) is within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:45, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 43; and optionally wherein (b) comprises a TCR p chain constant region, and optionally wherein the TCR p chain variable region CDR1 has an amino acid sequence of SEQ ID NO:47 and the TCR P chain variable region CDR2 has an amino acid sequence of SEQ ID NO:49;
- the CDR3 of (b) is within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:61 , wherein the CDR3 has an amino acid sequence of SEQ ID NO: 59; and optionally wherein (b) comprises a TCR p chain constant region, and optionally wherein the TCR p chain variable region CDR1 has an amino acid sequence of SEQ ID NO:63 and the TCR P chain variable region CDR2 has an amino acid sequence of SEQ ID NO:65; and/or (x1) the CDR3 of (b) is within a TCR p chain variable region having at least 90% sequence identity to SEQ ID NO:77, wherein the CDR3 has an amino acid sequence of SEQ ID NO: 75; and optionally wherein (b) comprises a TCR chain constant region, and optionally wherein the TCR p chain variable region CDR1 has an amino acid sequence of SEQ ID NO:79 and the TCR P chain variable region CDR2 has an amino acid sequence of SEQ ID NO:81
- Paragraph 53 The isolated nucleic acid sequence of paragraph 50, wherein the nucleic acid sequence encodes a T cell receptor.
- Paragraph 54 A vector comprising the nucleic acid sequence of paragraph 50.
- Paragraph 55 The vector of paragraph 54, wherein the vector is a plasmid or a viral vector, optionally wherein the vector is selected from the group consisting of a retrovirus, lentivirus, adeno-associated virus, adenovirus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or RNA.
- the vector is selected from the group consisting of a retrovirus, lentivirus, adeno-associated virus, adenovirus, vaccinia virus, canary poxvirus, herpes virus, minicircle vector and synthetic DNA or RNA.
- Paragraph 56 A modified cell transfected or transduced with the nucleic acid sequence of paragraph 50 or a vector comprising the nucleic acid sequence of paragraph 50.
- Paragraph 57 The modified cell of paragraph 56, wherein the modified cell is selected from the group consisting of a CD8 T cell, a CD4 T cell, an NK cell, an NKT cell, a gamma-delta T cell, a hematopoietic stem cell, a progenitor cell, a T cell line or a NK-92 cell line, and optionally wherein the modified cell is a human cell.
- a pharmaceutical composition for treating or preventing a AN PM 1 positive haematological malignancy comprising
- nucleic acid sequence of paragraph 50 (a) the nucleic acid sequence of paragraph 50, a vector comprising the nucleic acid sequence of paragraph 50, or a modified cell comprising the nucleic acid sequence of paragraph 50, and
- Paragraph 59 A method of treating or preventing a AN PM 1 positive haematological malignancy in a human subject, the method comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition of paragraph 58. paragraph 60.
- the method of paragraph 59, wherein the haematological malignancy is a myeloid malignancy, and optionally wherein the myeloid malignancy is acute myeloid leukemia.
- paragraph 61. The method of paragraph 59, wherein the method induces or enhances a cell mediated immune response in the subject. paragraph 62.
- a method of generating a T cell receptor comprising contacting a nucleic acid sequence of paragraph 50 with a cell under conditions in which the nucleic acid sequence is incorporated and expressed by the cell to generate the T cell receptor that specifically binds to the peptide of SEQ ID NO:26. paragraph 63. The method of paragraph 62, wherein the method is ex vivo.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23727701.7A EP4522282A1 (en) | 2022-05-13 | 2023-05-15 | Treatment of haematological malignancies |
| KR1020247040550A KR20250010024A (ko) | 2022-05-13 | 2023-05-15 | 혈액학적 악성 종양의 치료 |
| US18/865,485 US20250304651A1 (en) | 2022-05-13 | 2023-05-15 | Treatment of haematological malignancies |
| JP2024561686A JP2025516465A (ja) | 2022-05-13 | 2023-05-15 | 血液悪性腫瘍の治療 |
| CA3250741A CA3250741A1 (en) | 2022-05-13 | 2023-05-15 | TREATMENT OF HEMATOLOGICAL MALIGNITIES |
| CN202380040121.6A CN119256084A (zh) | 2022-05-13 | 2023-05-15 | 血液系统恶性肿瘤的治疗 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/744,568 US20220305102A1 (en) | 2017-06-30 | 2022-05-13 | Treatment of haematological malignancies |
| US17/744,568 | 2022-05-13 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023219510A1 true WO2023219510A1 (en) | 2023-11-16 |
Family
ID=86609466
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/NL2023/050268 Ceased WO2023219510A1 (en) | 2022-05-13 | 2023-05-15 | Treatment of haematological malignancies |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20250304651A1 (OSRAM) |
| EP (1) | EP4522282A1 (OSRAM) |
| JP (1) | JP2025516465A (OSRAM) |
| KR (1) | KR20250010024A (OSRAM) |
| CN (1) | CN119256084A (OSRAM) |
| CA (1) | CA3250741A1 (OSRAM) |
| WO (1) | WO2023219510A1 (OSRAM) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6750325B1 (en) | 1989-12-21 | 2004-06-15 | Celltech R&D Limited | CD3 specific recombinant antibody |
| US20040202657A1 (en) | 1992-03-24 | 2004-10-14 | Btg International Limited | Humanized anti-CD3 specific antibodies |
| WO2004106380A2 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Human-anti-human cd3 binding molecules |
| WO2016071758A1 (en) | 2014-11-03 | 2016-05-12 | Leiden University Medical Center | T cell receptors directed against bob1 and uses thereof |
| US20200123200A1 (en) * | 2017-06-30 | 2020-04-23 | Academisch Ziekenhuis Leiden (H.O.D.N. Leids Universitair Medisch Centrum) | Treatment of haematological malignancies |
| WO2021183675A2 (en) * | 2020-03-10 | 2021-09-16 | Massachusetts Institute Of Technology | Methods for generating engineered memory-like nk cells and compositions thereof |
| US20220305102A1 (en) * | 2017-06-30 | 2022-09-29 | Academisch Ziekenhuis Leiden (H.O.D.N. Leids Universitair Medisch Centrum) | Treatment of haematological malignancies |
-
2023
- 2023-05-15 US US18/865,485 patent/US20250304651A1/en active Pending
- 2023-05-15 JP JP2024561686A patent/JP2025516465A/ja active Pending
- 2023-05-15 EP EP23727701.7A patent/EP4522282A1/en active Pending
- 2023-05-15 KR KR1020247040550A patent/KR20250010024A/ko active Pending
- 2023-05-15 CA CA3250741A patent/CA3250741A1/en active Pending
- 2023-05-15 WO PCT/NL2023/050268 patent/WO2023219510A1/en not_active Ceased
- 2023-05-15 CN CN202380040121.6A patent/CN119256084A/zh active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6750325B1 (en) | 1989-12-21 | 2004-06-15 | Celltech R&D Limited | CD3 specific recombinant antibody |
| US20040202657A1 (en) | 1992-03-24 | 2004-10-14 | Btg International Limited | Humanized anti-CD3 specific antibodies |
| WO2004106380A2 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Human-anti-human cd3 binding molecules |
| WO2016071758A1 (en) | 2014-11-03 | 2016-05-12 | Leiden University Medical Center | T cell receptors directed against bob1 and uses thereof |
| US20200123200A1 (en) * | 2017-06-30 | 2020-04-23 | Academisch Ziekenhuis Leiden (H.O.D.N. Leids Universitair Medisch Centrum) | Treatment of haematological malignancies |
| US20220305102A1 (en) * | 2017-06-30 | 2022-09-29 | Academisch Ziekenhuis Leiden (H.O.D.N. Leids Universitair Medisch Centrum) | Treatment of haematological malignancies |
| WO2021183675A2 (en) * | 2020-03-10 | 2021-09-16 | Massachusetts Institute Of Technology | Methods for generating engineered memory-like nk cells and compositions thereof |
Non-Patent Citations (37)
| Title |
|---|
| "UniProt Homo Sapiens database", Database accession no. UP000005640 |
| A.L. SZYMCZAK ET AL., NATURE BIOTECHNOLOGY, vol. 22, 2004, pages 589 - 594 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCL. ACIDS RES, vol. 25, 1997, pages 3389 - 3402 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, JOHN WILEY AND SONS, INC. |
| BLANKENSTEIN TLEISEGANG MUCKERT WSCHREIBER H: "Targeting cancer-specific mutations by T cell receptor gene therapy", CURR OPIN IMMUNOL, vol. 33, April 2015 (2015-04-01), pages 112 - 9, XP055211893, DOI: 10.1016/j.coi.2015.02.005 |
| BURROWS SRKIENZLE NWINTERHALTER ABHARADWAJ MALTMAN JD: "Brooks A. Peptide-MHC class I tetrameric complexes display exquisite ligand specificity", J IMMUNOL., vol. 165, no. 11, 1 December 2000 (2000-12-01), pages 6229 - 34 |
| COREN ET AL., BIOTECHNIQUES, 2015 |
| DOHNER H, ESTEY EH, AMADORI S, APPELBAUM FR, BUCHNER T, BURNETT AK: " European LeukemiaNet. Diagnosis and management of acute myeloid leukemia in adults: recommendations from an international expert panel, on behalf of the European LeukemiaNet.", BLOOD, vol. 115, no. 3, 21 January 2010 (2010-01-21), pages 453 - 74 |
| DOHNER HWEISDORF DJ: "Bloomfield CD. Acute Myeloid Leukemia", N ENGL J MED, vol. 373, no. 12, 17 September 2015 (2015-09-17), pages 1136 - 52 |
| FALINI BMECUCCI CTIACCI EALCALAY MROSATI RPASQUALUCCI LET: "Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype", N ENGL J MED, vol. 352, no. 3, 20 January 2005 (2005-01-20), pages 254 - 66, XP009064966, DOI: 10.1056/NEJMoa041974 |
| GREINER JONO YHOFMANN SSCHMITT AMEHRING EGDTZ M ET AL.: "Mutated regions of nucleophosmin 1 elicit both CD4(+) and CD8(+) T-cell responses in patients with acute myeloid leukemia", BLOOD, vol. 120, no. 6, 9 August 2012 (2012-08-09), pages 1282 - 9, XP055426172, DOI: 10.1182/blood-2011-11-394395 |
| GREINER JSCHNEIDER VSCHMITT MGÖTZ MDOHNER KWIESNETH M ET AL.: "Immune responses against the mutated region of cytoplasmatic NPM1 might contribute to the favorable clinical outcome of AML patients with NPM1 mutations (NPM1mut", BLOOD, vol. 122, no. 6, 8 August 2013 (2013-08-08), pages 1 087 - 8 |
| H. D. MEIRING, E. VAN DER HEEFT, G. J. TEN HOVE, A. P. J. M. DE JONG: "Nanoscale LC MS(n):technical design and applications to peptide and protein analysis. ", J SEP SCI, vol. 25, 2002, pages 557 - 568 |
| HEEMSKERK MHHOOGEBOOM MPAUS RAKESTER MGVAN DER HOORN MAGOULMY E ET AL.: "Redirection of antileukemic reactivity of peripheral T lymphocytes using gene transfer of minor histocompatibility antigen HA-2-specific T-cell receptor complexes expressing a conserved alpha joining region", BLOOD, vol. 102, no. 10, 15 November 2003 (2003-11-15), pages 3530 - 40, XP055070635, DOI: 10.1182/blood-2003-05-1524 |
| IVEY AHILLS RKSIMPSON MAJOVANOVIC JVGILKES AGRECH A ET AL.: "UK National Cancer Research Institute AML Working Group. Assessment of Minimal Residual Disease in Standard-Risk AML", N ENGL J MED, vol. 374, no. 5, 4 February 2016 (2016-02-04), pages 422 - 33 |
| JAHN LHOMBRINK PHAGEDOORN RSKESTER MGVAN DER STEEN DMRODRIGUEZ T ET AL.: "TCR-based therapy for multiple myeloma and other B-cell malignancies targeting intracellular transcription factor BOB1", BLOOD, 4 January 2017 (2017-01-04) |
| LEFRANC MPGIUDICELLI VGINESTOUX CBODMER JMULLER WBONTROP R ET AL.: "IMGT, the international ImMunoGeneTics database", NUCLEIC ACIDS RES., vol. 27, no. 1, 1 January 1999 (1999-01-01), pages 209 - 12, XP002637025, DOI: 10.1093/nar/27.1.209 |
| LINNEMANN CHEEMSKERK BKVISTBORG PKLUIN RJBOLOTIN DACHEN X ET AL.: "High-throughput identification of antigen-specific TCRs by TCR gene capture", NAT MED., vol. 19, no. 11, November 2013 (2013-11-01), pages 1534 - 41, XP055190765, DOI: 10.1038/nm.3359 |
| LUCHANSKY ET AL., MOL. MICROBIOL., vol. 69, 1988, pages 2110 - 646 |
| MEYERS ET AL., CABIOS, vol. 4, 1989, pages 11 - 17 |
| MICHAL BASSANI-STERNBERGGEORGE COUKOS: "Mass spectrometry-based antigen discovery for cancer immunotherapy", CURRENT OPINION IN IMMUNOLOGY, vol. 41, 2016, pages 9 - 17, XP029688138, DOI: 10.1016/j.coi.2016.04.005 |
| NEEDLEMAN ET AL., J. MOL. BIOL., vol. 48, 1970, pages 444 - 453 |
| PAPAEMMANUIL EGERSTUNG MBULLINGER LGAIDZIK VLPASCHKA PROBERTS ND ET AL.: "Genomic Classification and Prognosis in Acute Myeloid Leukemia", N ENGL J MED, vol. 374, no. 23, 9 June 2016 (2016-06-09), pages 2209 - 21 |
| R MONJEZIC MISKEYT GOGISHVILIM SCHLEEFM SCHMEERH EINSELEZ LVICSM HUDECEK, LEUKEMIA, 2016 |
| RA WILLEMSEN ET AL., GENE THERAPY, 2000 |
| RODENKO BTOEBES MHADRUP SRESCH WJMOLENAAR AMSCHUMACHER TNOVAA H: "Generation of peptide-MHC class I complexes through UV-mediated ligand exchange", NAT PROTOC, vol. 1, no. 3, 2006, pages 1120 - 32, XP003027415, DOI: 10.1038/nprot.2006.121 |
| S JONES ET AL., HUMAN GENE THER, 2009 |
| SCHUMACHER TNSCHREIBER RD: "Neoantigens in cancer immunotherapy", SCIENCE, vol. 348, no. 6230, 3 April 2015 (2015-04-03), pages 69 - 74, XP055866872, DOI: 10.1126/science.aaa4971 |
| SINGLETONSAINSBURY: "Dictionary of Microbiology and Molecular Biology", vol. 1, 1991, JOHN WILEY AND SONS, pages: 94 |
| TRAN EROBBINS PF: "Rosenberg SA. 'Final common pathway' of human cancer immunotherapy: targeting random somatic mutations", NAT IMMUNOL, vol. 18, no. 3, 15 February 2017 (2017-02-15), pages 255 - 262, XP055524111, DOI: 10.1038/ni.3682 |
| TRAN EROBBINS PFLU YCPRICKETT TDGARTNER JJJIA L ET AL.: "T-Cell Transfer Therapy Targeting Mutant KRAS in Cancer", N ENGL J MED, vol. 375, no. 23, 8 December 2016 (2016-12-08), pages 2255 - 2262, XP055414549, DOI: 10.1056/NEJMoa1609279 |
| TRAN ETURCOTTE SGROS AROBBINS PFLU YCDUDLEY ME ET AL.: "Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer", SCIENCE, vol. 344, no. 6184, 9 May 2014 (2014-05-09), pages 641 - 5, XP055547527, DOI: 10.1126/science.1251102 |
| TURTLE CJHANAFI LABERGER CGOOLEY TACHERIAN SHUDECEK M ET AL.: "CD19 CAR-T cells of defined CD4+:CD8+ composition in adult B cell ALL patients", J CLIN INVEST, vol. 126, no. 6, 1 June 2016 (2016-06-01), pages 2123 - 38, XP055402477, DOI: 10.1172/JCI85309 |
| TURTLE CJHANAFI LABERGER CHUDECEK MPENDER BROBINSON E ET AL.: "Immunotherapy of non-Hodgkin's lymphoma with a defined ratio of CD8+ and CD4+ CD19- specific chimeric antigen receptor-modified T cells", SCI TRANSL MED, vol. 8, no. 355, 7 September 2016 (2016-09-07), pages 355ra116, XP055538573, DOI: 10.1126/scitranslmed.aaf8621 |
| VAN DER LEE DYANTHA ET AL: "An HLA-A*11:01-Binding Neoantigen from Mutated NPM1 as Target for TCR Gene Therapy in AML", CANCERS, vol. 13, no. 21, 27 October 2021 (2021-10-27), pages 5390, XP093030944, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8582585/pdf/cancers-13-05390.pdf> DOI: 10.3390/cancers13215390 * |
| VERSLUIS JIN'T HOUT FEDEVILLIER RVAN PUTTEN WLMANZ MGVEKEMANS MC ET AL.: "Comparative value of post-remission treatment in cytogenetically normal AML subclassified by NPM1 and FLT3-ITD allelic ratio", LEUKEMIA, vol. 31, no. 1, January 2017 (2017-01-01), pages 26 - 33, XP037653756, DOI: 10.1038/leu.2016.183 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3250741A1 (en) | 2023-11-16 |
| US20250304651A1 (en) | 2025-10-02 |
| CN119256084A (zh) | 2025-01-03 |
| EP4522282A1 (en) | 2025-03-19 |
| KR20250010024A (ko) | 2025-01-20 |
| JP2025516465A (ja) | 2025-05-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3645560B1 (en) | Treatment of haematological malignancies | |
| RU2752528C2 (ru) | Композиции и библиотеки, содержащие рекомбинантные полинуклеотиды, кодирующие Т-клеточные рецепторы, и способы применения рекомбинантных Т-клеточных рецепторов | |
| TWI722658B (zh) | 用於多種癌症之免疫治療的新穎胜肽、胜肽的組合物及支架 | |
| EP3469362A1 (en) | Human leukocyte antigen restricted gamma delta t cell receptors and methods of use thereof | |
| IL309003A (en) | Novel peptides, combination of peptides and scaffolds for use in immunothera-peutic treatment of various cancers | |
| US20220305102A1 (en) | Treatment of haematological malignancies | |
| NL2026614B1 (en) | T cell receptors directed against bob1 and uses thereof | |
| US20250304651A1 (en) | Treatment of haematological malignancies | |
| NL2032130B1 (en) | T cell receptors directed against melanoma-associated antigen and uses thereof | |
| NL2031118B1 (en) | T cell receptors directed against transcription factor wt1 and uses thereof | |
| NL2019156B1 (en) | Treatment of haematological malignancies | |
| NL2036853B1 (en) | Haematopoietic-restricted minor histocompatibility antigens and uses thereof | |
| US20260132183A1 (en) | T cell receptors directed against melanoma-associated antigen and uses thereof | |
| KR20250108105A (ko) | 암 관련 항원에 대해 지시된 t 세포 수용체 및 이의 용도 | |
| WO2025159638A1 (en) | Haematopoietic-restricted minor histocompatibility antigens and uses thereof | |
| HK1261191B (en) | Modified chimeric receptors and related compositions and methods |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23727701 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024561686 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380040121.6 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18865485 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 20247040550 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247040550 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023727701 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023727701 Country of ref document: EP Effective date: 20241213 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380040121.6 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 18865485 Country of ref document: US |