WO2023192463A2 - Adeno-associated virus vectors for nucleic acid delivery to retinal cells - Google Patents
Adeno-associated virus vectors for nucleic acid delivery to retinal cells Download PDFInfo
- Publication number
- WO2023192463A2 WO2023192463A2 PCT/US2023/016871 US2023016871W WO2023192463A2 WO 2023192463 A2 WO2023192463 A2 WO 2023192463A2 US 2023016871 W US2023016871 W US 2023016871W WO 2023192463 A2 WO2023192463 A2 WO 2023192463A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- seq
- amino acid
- vector
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14145—Special targeting system for viral vectors
Definitions
- Patent Application Serial No.63/325,542 filed on March 30, 2022, of U.S. Patent Application Serial No. 63/325,544, filed on March 30, 2022, of U.S. Patent Application Serial No.63/325,548, filed on March 30, 2022, of U.S. Patent Application Serial No.63/325,550, filed on March 30, 2022, of U.S. Patent Application Serial No.63/325,551, filed on March 30, 2022, of U.S. Patent Application Serial No.63/325,555, filed on March 30, 2022, of U.S. Patent Application Serial No.63/325,558, filed on March 30, 2022, and of U.S. Patent Application Serial No.63/325,559, filed on March 30, 2022.
- this document provides methods and materials for making and using AAV vectors (e.g., AAV2 vectors) having (a) the ability to deliver nucleic acid to foveal cones, (b) an increased efficiency to deliver nucleic acid to retinal cells, (c) the ability to deliver nucleic acid to retinal cells and drive high expression levels of nucleic acid within retinal cells, (d) the ability to deliver nucleic acid to retinal cells across retinal regions (e.g., across at least two retinal regions), (e) the ability to deliver nucleic acid to retinal cells of the parafovea region of the eye, (f) the ability to deliver nucleic acid to two or more different retinal cell types within an eye, (g) the ability to deliver nucleic acid to retinal pigment epithelial (RPE) cells, (h) an increased efficiency to deliver nucleic acid to photoreceptor cells of the retina, (i) an increased efficiency to deliver nucleic acid to retinal ganglion cells of the retina, (j) an increased efficiency
- AAV vectors e.g., AAV2 vectors
- AAV vectors e.g., AAV2 vectors
- AAV vectors e.g., AAV2 vectors
- capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid.
- retinal cells e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells
- This document also provides methods and materials for making and using AAV vectors (e.g., AAV2 vectors) having the ability to deliver nucleic acid to retinal cells.
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- retinal cells e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) of a mammal (e.g., a human or a non- human primate) that is greater than (e.g., at least 2 percent greater than, at least 2.5 percent greater than, at least 5 percent greater than, at least 7.5 percent greater than, at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in retinal cells of a control mammal (e.g.,
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector e.g., an AAV2 vector
- Table 1 or a variant thereof
- Formula A can be used in place of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct.
- this document provides AAV vectors (e.g., AAV2 vectors).
- AAV vectors e.g., AAV2 vectors
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect foveal cones in vivo and deliver exogenous nucleic acid to the infected foveal cones such that the infected foveal cones express the exogenous nucleic acid.
- This document also provides methods and materials for making and using AAV vectors (e.g., AAV2 vectors) having the ability to deliver nucleic acid to foveal cones.
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- an AAV vector e.g., an AAV2 vector
- an AAV vector can have the ability to infect and drive mRNA expression of an exogenous nucleic acid in cone cells present in the fovea of a mammal (e.g., a human or a non-human primate).
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in foveal cones of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in foveal cones of a control mammal (e.g., a control human or a control non- human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid at high levels.
- retinal cells e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells
- AAV vectors e.g., AAV2 vectors
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid at high levels.
- an AAV vector e.g., an AAV2 vector
- retinal cells e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 2 percent greater than, at least 2.5 percent greater than, at least 5 percent greater than, at least 7.5 percent greater than, at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in retinal cells of a control mammal (e.g.,
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector e.g., an AAV2 vector
- Table 1 or a variant thereof
- Formula A can be used in place of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct.
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal cells (e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells) across retinal regions (e.g., across at least two retinal regions) in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid.
- retinal cells e.g., retinal ganglion cells, photoreceptor cells, and bipolar cells
- retinal regions e.g., across at least two retinal regions
- AAV vectors e.g., AAV2 vectors
- AAV vectors can deliver nucleic acid to at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the fovea region, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the parafovea region, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the vascular arcade region
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to infect and drive mRNA expression of an exogenous nucleic acid in at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the fovea region, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the parafovea region, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal cells in the vascular arcade region, and/or at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least at least about
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal cells of the fovea region, the parafovea region, the vascular arcade region, and/or the periphery region of an eye of a mammal (e.g., a human or a non-human primate) that is greater than the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild- type AAV2 vector) in retinal cells of those regions in a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector e.g., an AAV2 vector
- Table 1 or a variant thereof
- Formula A can be used in place of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct.
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal cells of the parafovea region of the eye in vivo and deliver exogenous nucleic acid to the infected retinal cells of the parafovea region such that the infected retinal cells express the exogenous nucleic acid.
- This document also provides methods and materials for making and using AAV vectors (e.g., AAV2 vectors) having the ability to deliver nucleic acid to retinal cells of the parafovea region of the eye.
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect retinal cells of the parafovea region of the eye in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- a mammal e.g., a human or a non-human primate
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal cells of the parafovea region of the eye of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in retinal cells of the parafovea region of the eye of a control mammal (e.g., a control human or a control non- human primate).
- a mammal e.g., a human or a non
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector e.g., an AAV2 vector
- Table 1 or a variant thereof
- Formula A can be used in place of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct.
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect two or more (e.g., two or more, three or more, four or more, five or more, six or more, or seven or more) different retinal cell types within an eye in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid.
- two or more e.g., two or more, three or more, four or more, five or more, six or more, or seven or more
- AAV vectors e.g., AAV2 vectors
- AAV vectors having the ability to deliver nucleic acid to two or more (e.g., two or more, three or more, four or more, five or more, six or more, or seven or more) different retinal cell types within an eye and drive expression of delivered nucleic acid within those retinal cells.
- the AAV vectors (e.g., AAV2 vectors) described herein can deliver nucleic acid to two, three, four, five, six, or seven of the following retinal cell types of an eye: retinal ganglion cells, amacrine cells, horizontal cells, bipolar cells, Muller glia cells, photoreceptor cells, and retinal pigment epithelial (RPE) cells.
- retinal ganglion cells e.g., AAV2 vectors
- amacrine cells e.g., amacrine cells
- horizontal cells e.g., amacrine cells
- bipolar cells e.g., Muller glia cells
- photoreceptor cells e.g., photoreceptor cells
- RPE retinal pigment epithelial
- an AAV vector (e.g., an AAV2 vector) described herein can deliver nucleic acid to at least some (e.g., at least 2 percent, at least 2.5 percent, at least 5 percent, at least 10 percent, or at least 25 percent) of the retinal ganglion cells, amacrine cells, horizontal cells, bipolar cells, Muller glia cells, photoreceptor cells, and RPE cells of an eye of a mammal (e.g., a human or a non-human primate) following an intravitreal administration.
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect two or more (e.g., two or more, three or more, four or more, five or more, six or more, or seven or more) different retinal cell types within an eye in vivo and deliver exogenous nucleic acid to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid.
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to infect and drive mRNA expression of an exogenous nucleic acid in at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the retinal ganglion cells, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the amacrine cells, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the horizontal cells, at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the bipolar cells, at least about 2 percent (e.g., at
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal ganglion cells, amacrine cells, horizontal cells, bipolar cells, Muller glia cells, photoreceptor cells, and/or RPE cells of an eye of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in those retinal cells in a control mammal (e.g., a control human or a control non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector e.g., an AAV2 vector
- Table 1 or a variant thereof
- Formula A can be used in place of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct.
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect RPE cells in vivo and deliver exogenous nucleic acid to the infected RPE cells such that the infected RPE cells express the exogenous nucleic acid.
- This document also provides methods and materials for making and using AAV vectors (e.g., AAV2 vectors) having the ability to deliver nucleic acid to RPE cells and drive expression of delivered nucleic acid within the RPE cells.
- the AAV vectors (e.g., AAV2 vectors) described herein can deliver nucleic acid to at least about 2 percent (e.g., at least about 2.5 percent, at least about 5 percent, at least about 7.5 percent, at least about 10 percent, or at least about 25 percent) of the RPE cells of an eye of a mammal after, for example, an intravitreal administration.
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect RPE cells in vivo and deliver exogenous nucleic acid to the infected RPE cells such that the infected RPE cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in RPE cells of an eye of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild type AAV2 vector) in RPE cells in a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect photoreceptor cells of the retina in vivo and deliver exogenous nucleic acid to the infected photoreceptor cells such that the infected photoreceptor cells express the exogenous nucleic acid.
- AAV vectors e.g., AAV2 vectors
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect photoreceptor cells of the retina in vivo and deliver exogenous nucleic acid to the infected photoreceptor cells such that the infected photoreceptor cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in photoreceptor cells of the retina of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in photoreceptor cells of the retina of a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal ganglion cells in vivo and deliver exogenous nucleic acid to the infected retinal ganglion cells such that the infected retinal ganglion cells express the exogenous nucleic acid.
- AAV vectors e.g., AAV2 vectors
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect retinal ganglion cells in vivo and deliver exogenous nucleic acid to the infected retinal ganglion cells such that the infected retinal ganglion cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in retinal ganglion cells of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in retinal ganglion cells of an eye of a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect bipolar cells of the retina in vivo and deliver exogenous nucleic acid to the infected bipolar cells such that the infected retinal bipolar cells express the exogenous nucleic acid.
- AAV vectors e.g., AAV2 vectors
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect bipolar cells of the retina in vivo and deliver exogenous nucleic acid to the infected bipolar cells such that the infected bipolar cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in bipolar cells of the retina of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in bipolar cells of the retina of a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect OFF-retinal ganglion cells in vivo and deliver exogenous nucleic acid to the infected OFF-retinal ganglion cells such that the infected OFF-retinal ganglion cells express the exogenous nucleic acid.
- AAV vectors e.g., AAV2 vectors
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- Formula A can have the ability to infect OFF-retinal ganglion cells in vivo and deliver exogenous nucleic acid to the infected OFF-retinal ganglion cells such that the infected OFF-retinal ganglion cells express the exogenous nucleic acid.
- an AAV vector e.g., an AAV2 vector
- a mammal e.g., a human or a non- human primate
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of mRNA expression of an exogenous nucleic acid in OFF- retinal ganglion cells of a mammal (e.g., a human or a non-human primate) that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the level of mRNA expression of an exogenous nucleic acid driven by a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild-type AAV2 vector) in OFF-retinal ganglion cells of a control mammal (e.g., a control human or a control non-human primate).
- a mammal e.g., a human or a non-human primate
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- 7m8 AAV2 vector Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)
- K912 AAV2 vector ⁇ ztk et al., eLife, 10:e64175 (2021)
- this document provides AAV vectors (e.g., AAV2 vectors) containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- the AAV vectors (e.g., AAV2 vectors) described herein containing a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have increased packaging efficiency, the ability to infect cells (e.g., retinal cells) in vivo or in vitro, and the ability to deliver exogenous nucleic acid to the infected cells such that the infected cells express the exogenous nucleic acid.
- AAV vectors e.g., AAV2 vectors
- AAV vectors having increased packaging efficiency, the ability to deliver nucleic acid to cells (e.g., retinal cells) in vivo or in vitro, and the ability to drive expression of delivered nucleic acid within the cells.
- the AAV vectors (e.g., AAV2 vectors) described herein can have a packaging efficiency greater than that of a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild type AAV2 vector).
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- packaging efficiency e.g., package efficiency greater than that of a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1 (e.g., a wild type AAV2 vector)
- the ability to infect cells e.g., retinal cells
- the ability to drive exogenous nucleic acid to the infected cells such that the infected cells express the exogenous nucleic acid.
- an AAV vector (e.g., an AAV2 vector) provided herein can have a packaging efficiency that is greater than (e.g., at least 10 percent greater than, at least 25 percent greater than, at least 50 percent greater than, at least 75 percent greater than, or at least 100 percent greater than) the packaging efficiency of a comparable AAV vector having an AAV capsid polypeptide that consists of the amino acid sequence of SEQ ID NO:1(e.g., a wild-type AAV2 vector).
- an AAV vector e.g., an AAV2 vector
- an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A
- a packaging efficiency greater than that of the 7m8 AAV2 vector (Dalkara et al., Sci. Transl. Med., 5(189):189ra76 (2013) and Bennett et al., J. Struct. Biol., 209(2):107433 (2020)) or the K912 AAV2 vector ( ⁇ ztk et al., eLife, 10:e64175 (2021)).
- AAV vector e.g., an AAV2 vector
- AAV capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the vector can be an AAV2 vector.
- the vector can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- the vector can comprise an exogenous nucleic acid encoding an RNA or a polypeptide.
- the exogenous nucleic acid can encode an RNA.
- the RNA can be an siRNA or microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, or an NR2E3 polypeptide.
- the vector can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- this document features an AAV capsid polypeptide comprising the amino acid sequence of any one of SEQ ID NOs:2-5.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence, e.g., SEQ ID NO:10) are replaced with the amino acid sequence of SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-26.
- An AAV vector comprising the polypeptide can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- An AAV vector comprising the polypeptide can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- this document features a nucleic acid molecule encoding an adeno- associated virus (AAV) vector comprising an AAV capsid polypeptide, wherein the capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5.
- AAV adeno- associated virus
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence, e.g., SEQ ID NO:10).
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-26.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:27-42.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the vector can be an AAV2 vector.
- the vector can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- the vector can comprise an exogenous nucleic acid encoding an RNA or a polypeptide.
- the exogenous nucleic acid can encode an RNA.
- the RNA can be an siRNA or microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, or an NR2E3 polypeptide.
- the vector can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the nucleic acid molecule can be DNA.
- this document features a nucleic acid molecule encoding an AAV capsid polypeptide comprising the amino acid sequence of any one of SEQ ID NOs:2-5.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-42.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- An AAV vector comprising the polypeptide can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- An AAV vector comprising the polypeptide can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the nucleic acid molecule can be DNA.
- this document features a host cell comprising a nucleic acid molecule of either of the two preceding paragraphs. The host cell can express the vector. The host cell can express the polypeptide.
- this document features a host cell comprising an AAV vector comprising an AAV capsid polypeptide, wherein the capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-42.
- the vector can be an AAV2 vector.
- the vector can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- the vector can comprise an exogenous nucleic acid encoding an RNA or a polypeptide.
- the exogenous nucleic acid can encode an RNA.
- the RNA can be an siRNA or microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, or an NR2E3 polypeptide.
- the vector can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the host cell can be a retinal cell.
- this document features a host cell comprising an AAV capsid polypeptide comprising the amino acid sequence of any one of SEQ ID NOs:2-5.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-42.
- An AAV vector comprising the polypeptide can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- An AAV vector comprising the polypeptide can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the host cell can be a retinal cell.
- this document features a composition comprising an AAV vector comprising an AAV capsid polypeptide, wherein the capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11-42.
- the vector can be an AAV2 vector.
- the vector can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- the vector can comprise an exogenous nucleic acid encoding an RNA or a polypeptide.
- the exogenous nucleic acid can encode an RNA.
- the RNA can be an siRNA or microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, or an NR2E3 polypeptide.
- the vector can express more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the composition can comprise from about 1 x 10 7 to about 1 x 10 14 of the vector.
- the composition can comprise phosphate buffered saline, Hank’s Balanced Salt Solution, or Pluronic F68.
- this document features a method for delivering an exogenous nucleic acid sequence to a retinal cell within a mammal.
- the method comprises (or consists essentially of, or consists of) contacting the retinal cell with an AAV vector comprising an AAV capsid polypeptide and the exogenous nucleic acid sequence, wherein the capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5, wherein the AAV vector infects the retinal cell, thereby delivering the exogenous nucleic acid sequence to the retinal cell.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11- 42.
- the mammal can be a human (or a non-human primate).
- the vector can be an AAV2 vector.
- the vector can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vector is administered intravitreally to an eye of a human (or a non-human primate).
- the exogenous nucleic acid sequence can encode an RNA or a polypeptide.
- the exogenous nucleic acid can encode an RNA.
- the RNA can be an siRNA or microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, or an NR2E3 polypeptide.
- the vector can express more of the exogenous nucleic acid sequence in the retinal cell than the level of expression in a retinal cell from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the method can comprise intravitreally administering a composition comprising the vector to the mammal, thereby contacting the retinal cell with the vector.
- the composition can comprise from about 1 x 10 7 to about 1 x 10 14 of the vector.
- this document features a method for treating a retinal condition.
- the method comprises (or consists essentially of, or consists of) contacting retinal cells of a mammal having the retinal condition with AAV vectors comprising an AAV capsid polypeptide and an exogenous nucleic acid sequence, wherein the capsid polypeptide comprises the amino acid sequence of any one of SEQ ID NOs:2-5, wherein the AAV vectors infect the retinal cells and drive expression of the exogenous nucleic acid sequence within the retinal cells, thereby treating the retinal condition.
- the mammal can be a human (or a non- human primate).
- the retinal condition can be selected from the group consisting of LCA, OCA1, retinitis pigmentosa, rod/cone dystrophy, cone dystrophy, Stargardt Disease, Usher syndrome, XLRP, and XLRS.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence of any one of SEQ ID NOs:2-5.
- the capsid polypeptide can comprise the amino acid sequence of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acids from position 585 to 590 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence SEQ ID NO:2.
- the capsid polypeptide can comprise or consist of the amino acid sequence of any of SEQ ID NOs:11- 42.
- the vectors can be AAV2 vectors.
- the vectors can infect greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of the vectors is administered intravitreally to an eye of the mammal.
- the exogenous nucleic acid sequence can encode an RNA.
- the RNA can be an siRNA or a microRNA.
- the exogenous nucleic acid can encode a polypeptide.
- the polypeptide can be an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, and an NR2E3 polypeptide.
- the vectors can express more of the exogenous nucleic acid sequence in the retinal cells than the level of expression in retinal cells from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- the method can comprise intravitreally administering a composition comprising the vectors to the mammal, thereby contacting the retinal cells with the vectors.
- the composition can comprise from about 1 x 10 7 to about 1 x 10 14 of the vectors.
- Figure 2 is a diagram of AAV vectors that include a wild type AAV2 Rep polypeptide and an indicated AAV2 capsid polypeptide engineered to include an insert sequence (e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A) located between positions 587 and 588 (using SEQ ID NO:1 numbering), according to some embodiments.
- an insert sequence e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A located between positions 587 and 588 (using SEQ ID NO:1 numbering
- Figure 3 is a diagram of AAV vectors that include a mutant AAV2 Rep polypeptide (AAV2-M1T-REP) and an indicated AAV2 capsid polypeptide engineered to include an insert sequence (e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A) located between positions 587 and 588 (using SEQ ID NO:1 numbering), according to some embodiments.
- AAV2-M1T-REP mutant AAV2 Rep polypeptide
- AAV2 capsid polypeptide engineered to include an insert sequence (e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A) located between positions 587 and 588 (using SEQ ID NO:1 numbering), according to some embodiments.
- Figure 4 is a diagram of AAV vectors that include a wild type AAV2 Rep polypeptide and an indicated AAV2 capsid polypeptide engineered to include an insert sequence (e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A) as a replacement of amino acid residues at positions 585 to 590 (using SEQ ID NO:1 numbering), according to some embodiments.
- an insert sequence e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A
- FIG. 5 is a diagram of AAV vectors that include a mutant AAV2 Rep polypeptide (AAV2-M1T-REP) and an indicated AAV2 capsid polypeptide engineered to include an insert sequence (e.g., any one of SEQ ID NOs:2-5 or a sequence of Formula A) as a replacement of amino acid residues at positions 585 to 590 (using SEQ ID NO:1 numbering), according to some embodiments.
- AAV vectors e.g., AAV2 vectors.
- AAV vectors e.g., AAV2 vectors
- AAV vectors e.g., AAV2 vectors
- AAV vector can be designed to include a capsid polypeptide described herein (e.g., a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A).
- AAV2, AAV8, and AAV9 can be designed to include a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV2 having an ACG start codon for the AAV Rep polypeptides can be designed to include a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- Any appropriate AAV capsid polypeptide can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- AAV2, AAV6, AAV8 and AAV9 capsid polypeptides can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV2 capsid polypeptide can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV2 capsid polypeptide having the following amino acid sequence can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A: MAADGYLPDWLEDTLSEGIRQWWKLKPGPPPPKPAERHKDD SRGLVLPGYKYLGPFNGLDKGEPVNEADAAALEHDKAYDRQLDSGDNPYLKYNHA DAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTAPGKKRPVEHSPVEP DSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPSGLGTNTMATGSGA PMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALPTYNNHLYKQISSQS GASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQV KEVTQNDGTTTIANNLTSTVQVFTDSEYQLPYVLGSAHQGCLPPF
- an AAV capsid polypeptide having the following amino acid sequence can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A: MAADGYLPDWLEDTLSEGIRQWWKLKPG PPPPKPAERHKDDSRGLVLPGYKYLGPFNGLDKGEPVNX1ADAAALEHDKAYDRQL DSGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRVLEPLGLVEEPVKTA PGKKRPVEHSPVEPDSSSGTGKAGQQPARKRLNFGQTGDADSVPDPQPLGQPPAAPS GLGTNTMATGSGAPMADNNEGADGVGNSSGNWHCDSTWMGDRVITTSTRTWALP TYNNHLYKQISSQSGASNDNHYFGYS
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV capsid polypeptide that is at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1
- SEQ ID NO:1 can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- certain AAV2 sequences contemplated herein can include modifications or mutations of SEQ ID NO:1 such as a V708I and/or E67A substitution.
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A that included amino acid sequence can be located at any appropriate location along the AAV capsid polypeptide (e.g., the AAV2 capsid polypeptide).
- an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A such as any one of SEQ ID NOs:2-5 can be located between the naturally-occurring amino acid residues at positions 587 and 588 of an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide), can be located between the naturally-occurring amino acid residues at positions 452 and 453 of an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide), or can be located between the naturally-occurring amino acid residues at positions 453 and 454 of an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide).
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV vector can be designed to have an AAV capsid polypeptide that includes an amino acid sequence insert of Formula A.
- an AAV vector can be designed to have an AAV capsid polypeptide of SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) that includes an amino acid sequence insert of Formula A located between amino acid positions 587 and 588 of SEQ ID NO:1 (or the appropriate amino acid positions of the alternative sequence).
- Formula A can be as follows: -L1-EGSGRN (SEQ ID NO:2)-L2-, wherein L1 and L2 are each independently optional amino acid linkers having one, two, or three amino acids.
- L1, L2, or both L1 and L2 can be absent.
- L1 can be one amino acid X1, two amino acids X2-X1, or three amino acids X3-X2-X1.
- X1 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- X2 When X2 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- X3 When X3 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- L2 can be one amino acid Z1, two amino acids Z1-Z2, or three amino acids Z1-Z2-Z3.
- Z1 When Z1 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- Z2 When Z2 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- Z3 When Z3 is present, it can be an amino acid residue selected from the group consisting of A, V, I, and L.
- L1 linkers examples include, without limitation, A, V, I, L, AA, AV, AI, AL, VA, VV, VI, VL, IA, IV, II, IL, LA, LV, LI, LL, AAA, AAV, AAI, AAL, AVA, AVV, AVI, AVL, AIA, AIV, AII, AIL, ALA, ALV, ALI, ALL, VAA, VAV, VAI, VAL, VVA, VVV, VVI, VVL, VIA, VIV, VII, VIL, VLA, VLV, VLI, VLL, IAA, IAV, IAI, IAL, IVA, IVV, IVI, IVL, IIA, IIV, III, IIL, ILA, ILV, ILI, ILL, LAA, LAV, LAI, LAL, LVA, LVV, LVI, LVL, LIA, LIV, LII, LIL, LLA, LLV, LLI, and LLL.
- L2 linkers examples include, without limitation, A, V, I, L, AA, AV, AI, AL, VA, VV, VI, VL, IA, IV, II, IL, LA, LV, LI, LL, AAA, AAV, AAI, AAL, AVA, AVV, AVI, AVL, AIA, AIV, AII, AIL, ALA, ALV, ALI, ALL, VAA, VAV, VAI, VAL, VVA, VVV, VVI, VVL, VIA, VIV, VII, VIL, VLA, VLV, VLI, VLL, IAA, IAV, IAI, IAL, IVA, IVV, IVI, IVL, IIA, IIV, III, IIL, ILA, ILV, ILI, ILL, LAA, LAV, LAI, LAL, LVA, LVV, LVI, LVL, LIA, LIV, LII, LIL, LLA, LLV, LLI, and LLL.
- an AAV2 capsid polypeptide provided herein can have the sequence set forth in SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) with an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A inserted between asparagine-587 and arginine-588 (or the appropriate amino acid positions of the alternative sequence) (see, e.g., Figures 2-3).
- an AAV2 capsid polypeptide provided herein can have the sequence set forth in SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) with an amino acid sequence set forth in any one of SEQ ID NOs:2-5 (or a variant thereof) inserted between asparagine-587 and arginine-588 (or the appropriate amino acid positions of the alternative sequence).
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A that included amino acid sequence can be used to replace one or more naturally- occurring amino acid residues located at any appropriate location along the AAV capsid polypeptide (e.g., the AAV2 capsid polypeptide).
- an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A such as any one of SEQ ID NOs:2-5 can be used to replace the naturally-occurring amino acid residues at positions 585 to 590 of an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) (see, e.g., Figures 4-5).
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV2 capsid polypeptide provided herein can have the sequence set forth in SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) except that the amino acid residues at positions 585 to 590 (or the appropriate amino acid positions of the alternative sequence) are replaced with an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV2 capsid polypeptide provided herein can have the sequence set forth in SEQ ID NO:1 (or an alternative sequence that is the amino acid sequence set forth in SEQ ID NO:10 or that is an amino acid sequence at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence set forth in SEQ ID NO:1) with the exception that amino acid residues 585 to 590 (or the appropriate amino acid positions of the alternative sequence) are replaced with the amino acid sequence set forth in any one of SEQ ID NOs:2-5 (or a variant thereof).
- an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) can be designed to include two or more amino acid sequences set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV capsid polypeptide can be designed to include two or three amino acid sequences set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) can be designed to include an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- a variant of an amino acid sequence set forth in Table 1 refers to an amino acid sequence that is identical to that amino acid sequence set forth in Table 1 except that it has one, two, or three amino acid additions, deletions, substitutions, or combinations thereof.
- a variant of SEQ ID NO:2 can be SEQ ID NO:2 except that it has one, two, or three amino acid additions, deletions, substitutions, or combinations thereof.
- a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains one, two, or three amino acid additions.
- a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains one, two, or three amino acid deletions. In some cases, a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains one, two, or three amino acid substitutions. In some cases, a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains one amino acid addition, deletion, or substitution. In some cases, a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains two amino acid additions, deletions, substitutions, or a combination thereof.
- a variant provided herein can be the amino acid sequence set forth in any one of SEQ ID NOs:2-5 except that it contains three amino acid additions, deletions, substitutions, or a combination thereof.
- an amino acid substitution present in a variant can be a conservative amino acid substitution.
- conservative amino acid substitutions can be made by substituting one amino acid residue for another amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains can include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), non-polar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glut
- an amino acid substitution present in a variant can be a non- conservative amino acid substitution.
- Non-conservative amino acid substitutions can be made by substituting one amino acid residue for another amino acid residue having a dissimilar side chain.
- Examples of non-conservative substitutions include, without limitation, substituting (a) a hydrophilic residue (e.g., serine or threonine) for a hydrophobic residue (e.g., leucine, isoleucine, phenylalanine, valine, or alanine); (b) a cysteine or proline for any other residue; (c) a residue having a basic side chain (e.g., lysine, arginine, or histidine) for a residue having an acidic side chain (e.g., aspartic acid or glutamic acid); and (d) a residue having a bulky side chain (e.g., phenylalanine) for glycine or other residue having a small side chain.
- the percent sequence identity between a particular amino acid sequence and an amino acid sequence referenced by a particular sequence identification number is determined as follows. First, an amino acid sequence is compared to the sequence set forth in a particular sequence identification number using the BLAST 2 Sequences (Bl2seq) program from the stand-alone version of BLASTZ containing BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained from Fish & Richardson’s web site (e.g., www.fr.com/blast/) or the U.S. government’s National Center for Biotechnology Information web site (www.ncbi.nlm.nih.gov). Instructions explaining how to use the Bl2seq program can be found in the readme file accompanying BLASTZ.
- Bl2seq BLAST 2 Sequences
- Bl2seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
- BLASTN is used to compare nucleic acid sequences
- BLASTP is used to compare amino acid sequences.
- the options of Bl2seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C: ⁇ seq1.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C: ⁇ seq2.txt); -p is set to blastp; -o is set to any desired file name (e.g., C: ⁇ output.txt); and all other options are left at their default setting.
- the following command can be used to generate an output file containing a comparison between two amino acid sequences: C: ⁇ Bl2seq -i c: ⁇ seq1.txt -j c: ⁇ seq2.txt -p blastp -o c: ⁇ output.txt. If the two compared sequences share homology, then the designated output file will present those regions of homology as aligned sequences. If the two compared sequences do not share homology, then the designated output file will not present aligned sequences. Once aligned, the number of matches is determined by counting the number of positions where an identical amino acid residue is presented in both sequences.
- a matched position refers to a position in which an identical amino acid residue occurs at the same position in aligned sequences.
- 78.11, 78.12, 78.13, and 78.14 is rounded down to 78.1, while 78.15, 78.16, 78.17, 78.18, and 78.19 is rounded up to 78.2. It also is noted that the length value will always be an integer.
- Methods for generating an amino acid sequence variant can include site-specific mutagenesis or random mutagenesis (e.g., by PCR) of a nucleic acid encoding an AAV capsid polypeptide. See, for example, Zoller, Curr. Opin. Biotechnol. 3: 348-354 (1992).
- the AAV vectors can be designed to include one or more exogenous nucleic acid sequences.
- an AAV vector e.g., an AAV2 vector
- an exogenous nucleic acid sequence that encodes an RNA of interest and/or a polypeptide of interest.
- An exogenous nucleic acid sequence can be designed to encode any appropriate RNA of interest. Examples of RNAs of interest that can be encoded by an exogenous nucleic acid sequence designed to be included within an AAV vector provided herein include, without limitation, siRNAs, RNA components for gene editing, and microRNAs.
- an RNA of interest that can be encoded by an exogenous nucleic acid sequence included within an AAV vector provided herein can be SIRNA-027 to treat, e.g., sub-foveal CNVM secondary to age-related macular degeneration (see, e.g., NCT00363714), Cand5/Bevasiranib to treat, e.g., diabetic macular edema (see, e.g., NCT00306904), PF-04523655 to treat, e.g., diabetic macular edema (see, e.g., NCT01445899), QPI-1007 to treat, e.g., optic nerve atrophy in NAION (see, e.g., NCT01064505), Aganirsen to treat, e.g., ischemic CRVO to prevent neovascular glaucoma (see, e.g., NCT02947867), QR-421a to treat,
- An exogenous nucleic acid sequence can be designed to encode any appropriate polypeptide of interest.
- polypeptides of interest that can be encoded by an exogenous nucleic acid sequence designed to be included within an AAV vector provided herein include, without limitation, therapeutic polypeptides, trophic factor polypeptides, gene editing polypeptides (e.g., a Cas9 polypeptide, a TALEN polypeptide, or a zinc finger polypeptide), enzymes, optogenetic tool polypeptides (e.g., a ChR polypeptide, an NhpR polypeptide, or a ReachR polypeptide), antibodies, antibody domains (e.g., VH domains), cytokines, anti-angiogenic polypeptides, and neuroprotective polypeptides.
- therapeutic polypeptides e.g., trophic factor polypeptides, gene editing polypeptides (e.g., a Cas9 polypeptide, a TALEN polypeptide, or a
- polypeptides of interest that can be encoded by an exogenous nucleic acid sequence designed to be included within an AAV vector provided herein include, without limitation, an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, an NR2E3 polypeptide, a PDE6A polypeptide, a PDE6B polypeptide, a PDE6C polypeptide, a PRPF31 polypeptide, a RPE65 polypeptide, a RPGR polypeptide, a RS1 polypeptide, a TYR polypeptide, a USH2A polypeptide, a MYO7A polypeptide, an REP1 polypeptide, an OPN1LW polypeptide, an OPN1MW polypeptide, a CNGA3 polypeptide, a CNGB3 polypeptide, a GUCY2D polypeptide, a GACA1A polypeptide, a GNAT2 polypeptide, a PDE6H
- one or more AAV vectors provided herein can be designed to carry out gene editing within one or more cells (e.g., retinal cells). Such gene editing can result in a genomic modification of one or more cells. Examples of such genomic modifications include, without limitation, a targeted insertion of a nucleic acid encoding an RNA and/or polypeptide of interest into one or more cells, a targeted modification (e.g., targeted inactivation or knock-out) of a genomic sequence of one or more cells, and a targeted replacement of nucleic acid (e.g., nucleic acid encoding an RNA, a regulatory nucleic acid sequence, and/or nucleic acid encoding a polypeptide of interest) within one or more cells.
- a targeted insertion of a nucleic acid encoding an RNA and/or polypeptide of interest into one or more cells
- a targeted modification e.g., targeted inactivation or knock-out
- nucleic acid e.g., nucleic acid encoding an
- any appropriate gene editing components can be engineered into one or more AAV vectors provided herein such that those one or more AAV vectors can be used to deliver the gene editing components to target cells (e.g., one or more retinal cells) within a mammal (e.g., a human or a non-human primate) in a manner effective to edit the genome of those cells.
- the gene editing components include, without limitation, a component that is capable of cleaving genomic nucleic acid at a desired location and an optional donor nucleic acid designed to be inserted into that desired location once it is cleaved. Any appropriate rare-cutting endonuclease can be used to cleave genomic nucleic acid at a desired location.
- rare-cutting endonucleases include, without limitation, meganucleases, transcription activator-like effector (TALE) nucleases (TALENsTM; Cellectis, Paris, France), zinc-finger-nucleases (ZFNs), and endonucleases of a clustered regularly interspaced short palindromic repeats (CRISPR)/Cas system (e.g., endonucleases of a CRISPR/Cas 9 system).
- TALE transcription activator-like effector
- ZFNs zinc-finger-nucleases
- CRISPR clustered regularly interspaced short palindromic repeats
- CRISPR clustered regularly interspaced short palindromic repeats
- Patent No.8,586,363 Porteus and Carroll, Nature Biotechnol., 23:967- 973 (2005); Jinek et al., Science, 337:816-821 (2012); Mali et al., Science, 339:823-826 (2013); Li et al., Nature Biotechnology, 31(8):688-691 (2013); and Makarova et al., Nat. Rev. Microbiol., 9(6):467-477 (2011)).
- two sequences in genomic nucleic acid of a cell e.g., a retinal cell
- one on either side of a sequence to be removed – can be targeted for endonuclease cleavage.
- a first target sequence adjacent to the 5’ end of a sequence to be removed and a second target sequence adjacent to the 3’ end of the sequence to be removed can be targeted by guide RNAs to enable Cas9 cleavage or can be targeted by TALENs designed to specifically recognize those targets.
- Delivery using one or more AAV vectors provided herein of (a) endonucleases targeted to the genomic DNA and (b) a donor nucleic acid construct can allow cleavage at both genomic targets, removal of the sequence between the genomic targets, and insertion of the donor sequence into the location of the deletion.
- An AAV vector (e.g., an AAV2 vector) provided herein can include any appropriate promoter and/or other regulatory sequence (e.g., enhancers, transcription initiation sites, translation initiation sites, and termination signals) operably linked an exogenous nucleic acid sequence designed to be expressed.
- a promoter used to drive expression can be a constitutive promotor, a regulatable promotor, a tissue-specific promoter, or a viral promotor.
- constitutive promotors that can be used as described herein include, without limitation, SV40 promotors, CMV promotors, and E1ALPHA promotors.
- Examples of regulatable promoters that can be used as described herein include, without limitation, inducible promotors and repressible promotors.
- tissue-specific promotors examples include, without limitation, rhodopsin promotors, cone arrestin promotors, and synapsin promotors.
- viral promotors examples include, without limitation, adenoviral promotors, vaccinia virus promotors, CMV promotors (e.g., immediate early CMV promotors), and AAV promoters.
- an AAV vector e.g., an AAV2 vector provided herein can include a total number of nucleotides up to about 5 kb.
- an AAV vector (e.g., an AAV2 vector) provided herein can include a total number of nucleotides that is from about 1 kb to about 5 kb, from about 1 kb to about 4 kb, from about 1 kb to about 3 kb, from about 2 kb to about 5 kb, from about 2 kb to about 4 kb, from about 2 kb to about 3 kb, from about 3 kb to about 5 kb, from about 3 kb to about 4 kb, or from about 4 kb to about 5 kb.
- An AAV vector e.g., an AAV2 vector described herein containing an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A can have the ability to infect retinal cells (e.g., retinal ganglion cells) in vivo and deliver exogenous nucleic acid sequence to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid sequence.
- retinal cells e.g., retinal ganglion cells
- an AAV vector e.g., an AAV2 vector
- a mammal e.g., a human or a non-human primate
- an AAV vector (e.g., an AAV2 vector) provided herein can have the ability to drive a level of RNA expression of an exogenous nucleic acid sequence in retinal cells of a mammal (e.g., a human or a non-human primate) that is greater than the level of RNA expression of an exogenous nucleic acid sequence driven by a control AAV vector (e.g., wild-type AAV2) having an AAV capsid polypeptide that consists of the amino acid sequence set forth in SEQ ID NO:1 in retinal cells of a control mammal (e.g., a control human or a control non-human primate).
- a control AAV vector e.g., wild-type AAV2 having an AAV capsid polypeptide that consists of the amino acid sequence set forth in SEQ ID NO:1 in retinal cells of a control mammal (e.g., a control human or a control non-human primate).
- retinal cells that can be infected by an AAV vector (e.g., an AAV2 vector) described herein containing an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A include, without limitation, retinal ganglion cells, retinal pigment epithelium cells, photoreceptor cells, bipolar cells, amacrine cells, Muller glia, and horizontal cells.
- This document also provides compositions containing one or more AAV vectors provided herein (e.g., one or more AAV2 vectors provided herein).
- one or more AAV vectors provided herein can be formulated as a pharmaceutical composition for administration to a mammal (e.g., a human or a non-human primate) to treat that mammal.
- a mammal e.g., a human or a non-human primate
- one or more AAV vectors provided herein can be formulated as a pharmaceutical composition for administration to a mammal (e.g., a human or a non-human primate) to deliver an exogenous nucleic acid sequence to retinal cells (e.g., retinal ganglion cells) for expression within retinal cells.
- an AAV vector e.g., an AAV2 vector
- a pharmaceutical composition for administration to a mammal (e.g. a human or a non-human primate).
- a pharmaceutical composition provided herein can include a pharmaceutically acceptable carrier such as a buffer, a salt, a surfactant, a sugar, a tonicity modifier, or combinations thereof as, for example, described elsewhere (Gervasi et al., Eur. J. Pharmaceutics and Biopharmaceutics, 131:8-24 (2018)).
- Examples of pharmaceutically acceptable carriers that can be used to make a pharmaceutical composition provided herein include, without limitation, water, lactic acid, citric acid, sodium chloride, sodium citrate, sodium succinate, sodium phosphate, a surfactant (e.g., polysorbate 20, polysorbate 80, or poloxamer 188), dextran 40, or a sugar (e.g., sorbitol, mannitol, sucrose, dextrose, or trehalose), or combinations thereof.
- a surfactant e.g., polysorbate 20, polysorbate 80, or poloxamer 188
- dextran 40 e.g., sorbitol, mannitol, sucrose, dextrose, or trehalose
- a pharmaceutical composition designed to include an AAV vector can be formulated to include a buffer (e.g., an acetate, citrate, histidine, succinate, phosphate, or hydroxymethyl-aminomethane (Tris) buffer), a surfactant (e.g., polysorbate 20, polysorbate 80, or poloxamer 188), and a sugar such as sucrose.
- a buffer e.g., an acetate, citrate, histidine, succinate, phosphate, or hydroxymethyl-aminomethane (Tris) buffer
- a surfactant e.g., polysorbate 20, polysorbate 80, or poloxamer 188
- sugar such as sucrose.
- Other ingredients that can be included within a pharmaceutical composition provided herein include, without limitation, amino acids such as glycine or arginine, antioxidants such as ascorbic acid, methionine, or ethylenediaminetetraacetic acid (EDTA), or combinations thereof.
- EDTA
- a pharmaceutical composition when formulated to include one or more AAV vectors (e.g., one or more AAV2 vectors) provided herein, any appropriate titer of the AAV vectors can be used.
- a pharmaceutical composition provided herein can be formulated to have AAV vectors (e.g., AAV2 vectors) provided herein at a titer that is greater than 1x10 7 (e.g., greater than 1 x 10 8 , greater than 1 x 10 9 , greater than 1 x 10 10 , greater than 1 x 10 11 , greater than 1 x 10 12 , greater than 1 x 10 13 , or greater than 1 x 10 14 ).
- a pharmaceutical composition provided herein can be formulated to have AAV vectors (e.g., AAV2 vectors) provided herein at a titer that is from about 1x10 7 to about 1x10 14 (e.g., from about 1 x 10 7 to about 1 x 10 13 , from about 1 x 10 7 to about 1 x 10 12 , from about 1 x 10 7 to about 1 x 10 11 , from about 1 x 10 7 to about 1 x 10 10 , from about 1 x 10 8 to about 1 x 10 14 , from about 1 x 10 9 to about 1 x 10 14 , from about 1 x 10 10 to about 1 x 10 14 , from about 1 x 10 8 to about 1 x 10 12 , or from about 1 x 10 9 to about 1 x 10 11 ).
- AAV vectors e.g., AAV2 vectors
- a pharmaceutical composition provided herein can be in any appropriate form.
- a pharmaceutical composition provided herein can be designed to be a liquid, a semi-solid, or a solid.
- a pharmaceutical composition provided herein can be a liquid solution (e.g., an injectable and/or infusible solution), a dispersion, a suspension, a tablet, a pill, a powder, a microemulsion, a liposome, or a suppository.
- a pharmaceutical composition provided herein can be lyophilized.
- a pharmaceutical composition provided herein e.g., a pharmaceutical composition that includes one or more AAV vectors provided herein such as one or more AAV2 vectors provided herein
- a pharmaceutical composition provided herein can be formulated with a carrier or coating designed to protect against rapid release.
- a pharmaceutical composition provided herein can be formulated as a controlled release formulation or as a regulated release formulation as described elsewhere (U.S. Patent Application Publication Nos.2019/0241667; 2019/0233522; and 2019/0233498).
- This document also provides nucleic acid molecules encoding an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- a nucleic acid molecule can be designed to encode an AAV capsid polypeptide that includes an amino acid sequence that is encoded by a DNA sequence set forth in Table 1 (e.g., any one of SEQ ID NOs:6-9).
- This document also provides nucleic acid molecules encoding an AAV vector (e.g., an AAV2 vector) described herein.
- an isolated nucleic acid molecule can be designed to encode one or more AAV vectors provided herein (e.g., an AAV having an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A).
- a nucleic acid molecule can be designed to encode an AAV vector having an AAV capsid polypeptide that includes an amino acid sequence that is encoded by a DNA sequence set forth in Table 1 (e.g., any one of SEQ ID NOs:6-9).
- This document also provides host cells containing a nucleic acid molecule provided herein.
- a host cell can be designed to include a nucleic acid molecule encoding an AAV capsid polypeptide described herein and/or a nucleic acid molecule encoding an AAV vector described herein.
- a host cell can be designed to include a nucleic acid molecule encoding an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A. In some cases, a host cell can be designed to include a nucleic acid molecule encoding an AAV vector having an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- Examples of host cells that can be designed to include a nucleic acid molecule encoding an AAV capsid polypeptide described herein and/or a nucleic acid molecule encoding an AAV vector described herein include, without limitation, HEK293T cells (ATCC), 293AAV cells (Cell Biolabs), NEB 5-alpha cells, TakaraBio Stellar cells, and MegaX cells. Any appropriate method can be used to introduce a nucleic acid molecule provided herein (e.g., a nucleic acid molecule encoding an AAV capsid polypeptide described herein and/or an AAV vector described herein) into a cell.
- viral transfection, electroporation, transient transfection, and gene gun techniques can be used to introduce a nucleic acid molecule provided herein into a cell.
- This document also provides methods and materials for making an AAV vector (e.g., an AAV2 vector) provided herein.
- AAV vectors e.g., AAV2 vectors
- an AAV vector can be constructed to include an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV vector having an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- a capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- molecular cloning and AAV vector production techniques such as those described elsewhere can be used to construct and produce an AAV vector having an AAV capsid polypeptide (e.g., an AAV2 capsid polypeptide) provided herein (see, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd edition, Cold Spring Harbor Laboratory, NY (1989); Ausubel et al., Current Protocols in Molecular Biology, Green Publishing Associates and John Wiley & Sons, New York, N.Y. (1994); Grieger et al., Nat. Protoc., 1(3):1412-28 (2006); and Flannery et al., Methods Mol. Biol., 935:351-69 (2013)).
- an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- AAV vectors can be produced in HEK293T cells (ATCC) or 293AAV cells (Cell Biolabs) using a double or triple transfection method (see, e.g., Grieger et al., Nat. Protoc., 1(3):1412-28 (2006); and Flannery et al., Methods Mol. Biol., 935:351-69 (2013)).
- AAV vector e.g., an AAV2 vector
- this document provides methods and materials for using AAV vectors (e.g., AAV2 vectors) containing an AAV capsid polypeptide that includes an amino acid sequence set forth in Table 1 (or a variant thereof) or Formula A.
- an AAV vector provided herein can be used to infect retinal cells (e.g., retinal ganglion cells) in vivo and to deliver an exogenous nucleic acid sequence to the infected retinal cells such that the infected retinal cells express the exogenous nucleic acid sequence.
- an AAV vector e.g., an AAV2 vector
- a retinal condition e.g., a retinal disease
- an AAV vector e.g., an AAV2 vector
- an AAV vector provided herein that is designed to contain and drive expression of an exogenous nucleic acid sequence encoding an RNA and/or polypeptide capable of treating a retinal condition (e.g., a retinal disease)
- a mammal e.g., a human or a non-human primate
- the AAV vector (a) infects retinal cells (e.g., retinal ganglion cells) and (b) drives expression of the delivered exogenous nucleic acid in the infected retinal cells, thereby reducing the severity of one or more symptoms of the retinal condition and/or slowing the progression of the retinal condition.
- an AAV vector e.g., an AAV2 vector
- an AAV vector provided herein can be designed to include and drive expression of an exogenous nucleic acid sequence encoding any appropriate RNA of interest and/or polypeptide of interest.
- an AAV vector provided herein is designed to treat a retinal condition (e.g., a retinal disease)
- an exogenous nucleic acid sequence that encodes an RNA and/or polypeptide capable of treating the retinal condition can be included within the AAV vector.
- polypeptides that can be encoded by an exogenous nucleic acid sequence designed to treat a retinal condition (e.g., a retinal disease) and designed to be included within an AAV vector provided herein include, without limitation, an ABCA4 polypeptide, a CRB1 polypeptide, an NPHP5 polypeptide, an NR2E3 polypeptide, a PDE6A polypeptide, a PDE6B polypeptide, a PDE6C polypeptide, a PRPF31 polypeptide, a RPE65 polypeptide, a RPGR polypeptide, a RS1 polypeptide, a TYR polypeptide, a USH2A polypeptide, a MYO7A polypeptide, an REP1 polypeptide, an OPN1LW polypeptide, an OPN1MW polypeptide, a CNGA3 polypeptide, a CNGB3 polypeptide, a GUCY2D polypeptide, a GACA1A
- Any appropriate retinal condition e.g., a retinal disease
- an AAV vector e.g., an AAV2 vector
- retinal conditions include, without limitation, Leber congenital amaurosis (LCA), Leber hereditary optic neuropathy (LHON), oculocutaneous albinism type 1 (OCA1), retinitis pigmentosa, rod/cone dystrophy, cone dystrophy, rod dystrophy, Stargardt Disease, Usher syndrome, X-linked retinitis pigmentosa (XLRP), X- linked retinoschisis (XLRS), choroideremia, achromatopsia, blue cone monochromacy, color blindness, glaucoma, optic atrophy, Batten disease, congenital stationary night blindness (CSNB), macular degeneration, CRB1-related retinal dystrophy, and foveal cone dystrophy.
- LCA Leber congenital amaurosis
- LHON Leber hereditary optic neuropathy
- OCA1 oculocutaneous albinism type 1
- retinitis pigmentosa rod/cone dystrophy, cone
- Examples of therapeutic RNAs and polypeptides that can be delivered using an AAV vector provided herein to treat particular retinal conditions are set forth in Tables 2 and 3.
- Examples of genomic nucleic acids that can be inactivated and/or knocked out to treat particular retinal conditions using one or more AAV vectors provided herein that are designed to deliver gene editing components are set forth in Table 3.
- Examples of genomic nucleic acids of disease causing alleles that can be replaced with healthy alleles to treat particular retinal conditions using one or more AAV vectors provided herein that are designed to deliver gene editing components are set forth in Table 3.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides having the ability to inhibit vascular angiogenesis.
- polypeptides having the ability to inhibit vascular angiogenesis that can be used as described herein include, without limitation, monoclonal anti-VEGF antibody polypeptides, angiostatin polypeptides, siRNA polypeptides, and endostatin polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a monoclonal anti-VEGF antibody polypeptide, an angiostatin polypeptide, an siRNA, and/or endostatin polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a monoclonal anti-VEGF antibody polypeptide, an angiostatin polypeptide, an siRNA, and/or an endostatin polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a monoclonal anti-VEGF antibody polypeptide, an angiostatin polypeptide, an siRNA, and/or an endostatin polypeptide.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides with neuroprotective capabilities.
- polypeptides having the ability to provide neuroprotective activity include, without limitation, GDNF polypeptides, CNTF polypeptides, IGF-1 polypeptides, VEGF polypeptides, and BDNF polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a GDNF polypeptide, a CNTF polypeptide, an IGF-1 polypeptide, a VEGF polypeptide, and/or a BDNF polypeptide.
- dry AMD can be treated using an AAV vector provided herein that is designed to express a GDNF polypeptide, a CNTF polypeptide, an IGF-1 polypeptide, a VEGF polypeptide, and/or a BDNF polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a GDNF polypeptide, a CNTF polypeptide, an IGF-1 polypeptide, a VEGF polypeptide, and/or a BDNF polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a GDNF polypeptide, a CNTF polypeptide, an IGF-1 polypeptide, a VEGF polypeptide, and/or a BDNF polypeptide.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides having the ability to provide optogenetic capabilities.
- polypeptides having the ability to provide optogenetic capabilities include, without limitation, ChR polypeptides, ChR2 polypeptides, ArchT polypeptides, NpHR polypeptides, and ChrimsonR polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a ChR polypeptide, a ChR2 polypeptide, an ArchT polypeptide, a NpHR polypeptide, and/or a ChrimsonR polypeptide.
- dry AMD can be treated using an AAV vector provided herein that is designed to express a ChR polypeptide, a ChR2 polypeptide, an ArchT polypeptide, a NpHR polypeptide, and/or a ChrimsonR polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a ChR polypeptide, a ChR2 polypeptide, an ArchT polypeptide, a NpHR polypeptide, and/or a ChrimsonR polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a ChR polypeptide, a ChR2 polypeptide, an ArchT polypeptide, a NpHR polypeptide, and/or a ChrimsonR polypeptide.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides having the ability to inhibit apoptosis.
- polypeptides having the ability to inhibit apoptosis examples include, without limitation, XIAP polypeptides, cIAP1 polypeptides, C-IAP2 polypeptides, Livin polypeptides, and Survivin polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a XIAP polypeptide, a cIAP1 polypeptide, a C-IAP2 polypeptide, a Livin polypeptide, and/or a Survivin polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a XIAP polypeptide, a cIAP1 polypeptide, a C-IAP2 polypeptide, a Livin polypeptide, and/or a Survivin polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a XIAP polypeptide, a cIAP1 polypeptide, a C-IAP2 polypeptide, a Livin polypeptide, and/or a Survivin polypeptide.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides having the ability to inhibit complement.
- polypeptides having the ability to inhibit complement that can be used as described herein include, without limitation, Complement Factor I polypeptides, Complement factor H polypeptides, and sCD59 polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a Complement Factor I polypeptide, a Complement factor H polypeptide, and/or a sCD59 polypeptide.
- dry AMD can be treated using an AAV vector provided herein that is designed to express a Complement Factor I polypeptide, a Complement factor H polypeptide, and/or a sCD59 polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a Complement Factor I polypeptide, a Complement factor H polypeptide, and/or a sCD59 polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a Complement Factor I polypeptide, a Complement factor H polypeptide, and/or a sCD59 polypeptide.
- a retinal condition can be treated using an AAV vector provided herein that is designed to express one or more polypeptides having the ability to induce survival factors.
- polypeptides having the ability to induce survival factors that can be used as described herein include, without limitation, RdCVF polypeptides, RdCVFL polypeptides, HIF-1 polypeptides, IAP family polypeptides, and BCL-2 family polypeptides.
- wet AMD can be treated using an AAV vector provided herein that is designed to express a RdCVF polypeptide, a RdCVFL polypeptide, an HIF-1 polypeptide, an IAP family polypeptide, and/or a BCL-2 family polypeptide.
- dry AMD can be treated using an AAV vector provided herein that is designed to express a RdCVF polypeptide, a RdCVFL polypeptide, an HIF-1 polypeptide, an IAP family polypeptide, and/or a BCL-2 family polypeptide.
- diabetic retinopathy can be treated using an AAV vector provided herein that is designed to express a RdCVF polypeptide, a RdCVFL polypeptide, an HIF-1 polypeptide, an IAP family polypeptide, and/or a BCL-2 family polypeptide.
- diabetic macular edema can be treated using an AAV vector provided herein that is designed to express a RdCVF polypeptide, a RdCVFL polypeptide, an HIF-1 polypeptide, an IAP family polypeptide, and/or a BCL-2 family polypeptide.
- Any appropriate method can be used to administer an AAV vector provided herein or composition (e.g., a pharmaceutical composition) provided herein to a mammal (e.g., a human or a non-human primate).
- a composition provided herein e.g., a pharmaceutical composition containing one or more AAV vectors provided herein
- a mammal e.g., a human or a non-human primate
- intravitreally intravenously (e.g., via an intravenous injection or infusion), subcutaneously (e.g., via a subcutaneous injection), intraperitoneally (e.g., via an intraperitoneal injection), orally, via inhalation, intramuscularly (e.g., via intramuscular injection), subretinally, intravitreally, systemically, or suprachoroidally.
- the route and/or mode of administration of a composition can be adjusted for the mammal being treated.
- an effective amount of a composition containing an AAV vector provided herein (e.g., a pharmaceutical composition provided herein) to treat a retinal condition can be an amount that reduces the severity of one or more symptoms of the retinal condition and/or slows the progression of the retinal condition without producing significant toxicity to the mammal.
- an effective amount of an AAV vector provided herein can be from about 1x10 7 viral genomes to about 1x10 14 viral genomes (e.g., from about 1 x 10 7 viral genomes to about 1 x 10 13 viral genomes, from about 1 x 10 7 viral genomes to about 1 x 10 12 viral genomes, from about 1 x 10 7 viral genomes to about 1 x 10 11 viral genomes, from about 1 x 10 7 viral genomes to about 1 x 10 10 viral genomes, from about 1 x 10 8 viral genomes to about 1 x 10 14 viral genomes, from about 1 x 10 9 viral genomes to about 1 x 10 14 viral genomes, from about 1 x 10 10 viral genomes to about 1 x 10 14 viral genomes, from about 1 x 10 8 viral genomes to about 1 x 10 12 viral genomes, or from about 1 x 10 9 viral genomes to about 1 x 10 11 viral genomes).
- an effective amount of an AAV vector provided herein can be from about 1 x 10 10 viral genomes/kg of body weight to about 1 x 10 14 viral genomes/kg of body weight (e.g., from about 1 x 10 10 viral genomes/kg of body weight to about 1 x 10 13 viral genomes/kg of body weight, from about 1 x 10 10 viral genomes/kg of body weight to about 1 x 10 12 viral genomes/kg of body weight, from about 1 x 10 10 viral genomes/kg of body weight to about 1 x 10 11 viral genomes/kg of body weight).
- the effective amount can remain constant or can be adjusted as a sliding scale or variable dose depending on the mammal’s response to treatment. Various factors can influence the actual effective amount used for a particular application.
- an effective frequency of administration of a composition containing an AAV vector provided herein can be a frequency that reduces the severity of one or more symptoms of the retinal condition and/or slows the progression of the retinal condition without producing significant toxicity to the mammal.
- an effective duration of administration of a composition containing an AAV vector provided herein can be a duration that reduces the severity of one or more symptoms of the retinal condition and/or slows the progression of the retinal condition without producing significant toxicity to the mammal.
- an effective duration of administration of a pharmaceutical composition provided herein can vary from a single time point of administration to several weeks to several months (e.g., 4 to 12 weeks). In some cases, the duration can be for as long as the mammal is alive. Multiple factors can influence the actual effective duration used for a particular application. For example, the severity of a retinal condition, the route of administration, the age and general health condition of the mammal, excipient usage, the possibility of co-usage with other therapeutic or prophylactic treatments such as use of other retinal drugs, and the judgment of the treating physician may require an increase or decrease in the actual effective duration of administration of a composition provided herein (e.g., a pharmaceutical composition containing an AAV vector provided herein).
- a composition provided herein e.g., a pharmaceutical composition containing an AAV vector provided herein.
- an effective amount of a composition containing an AAV vector provided herein (e.g., a pharmaceutical composition provided herein) to treat a retinal condition can be administered once or twice to a mammal (e.g., a human or a non-human primate) to treat that mammal.
- a mammal e.g., a human or a non-human primate
- the invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
- EXAMPLES Example 1 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- AAV vectors having capsid polypeptides that included SEQ ID NO:14 (SEQ ID NO:5 located between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) exhibited the ability to infect and drive mRNA expression within retinal cells in a manner similar to that of 7m8 AAV vector.
- the AAV vector having capsid polypeptide that included SEQ ID NO:14 has the ability to exhibit more infectivity of retinal cells than a wild- type AAV2 vector containing an AAV2 capsid polypeptide that consists of SEQ ID NO:1.
- AAV vectors that include an AAV capsid polypeptide can have the ability to mediate transgene expression in retinal cells.
- Example 2 – Treating a retinal condition using an AAV vector An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 3 Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting foveal cones in the retina.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in foveal cells.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+.” No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (or Formula A) can have the ability to mediate transgene expression in foveal cones following intravitreal injection.
- Example 4 Treating a retinal condition using an AAV vector
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 5 Construction of AAV vectors containing mutated capsid polypeptides
- a high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells. See, e.g., ⁇ ztk et al., bioRxiv, 2020.10.01.323196 (2020) and ⁇ ztk et al., eLife, 10:e64175 (2021). Briefly, highly complex libraries of AAV mutants were created and injected into the eyes of primates (cynolmolgus macaques or rhesus macaques).
- each AAV vector in the library contained a unique DNA barcode, which allowed for tracking of a mutated AAV capsid polypeptide.
- successfully packaged AAV vectors were polymerase chain reaction (PCR) amplified and repackaged, resulting in a “repack” library.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells. Computational analysis was performed to identify optimal vectors, according to cell specificities, expression levels, and/or other desirable characteristics, based on the presence and quantity of DNA barcodes in transcriptomes from thousands of different cells of multiple cell types in parallel.
- AAV capsid polypeptides were evaluated on the basis of mRNA transcription levels rather than the presence of DNA, reflecting the ability of the AAV vectors to drive expression of the AAV vector nucleic acid as opposed to simply having the ability to enter a cell.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in retinal cells.
- SEQ ID NO:14 SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+++” once, “++” four times, and “+” once. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV vector having an amino acid sequence set forth in Table 1 (or Formula A)
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 7 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression across retinal regions.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “++” twice. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (or Formula A) can have the ability to deliver nucleic acid to and express nucleic acid in retinal cells in at least two different retinal regions.
- Example 8 Treating a retinal condition using an AAV vector
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 9 Construction of AAV vectors containing mutated capsid polypeptides
- a high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells of the parafovea region of the eye. See, e.g., ⁇ ztk et al., bioRxiv, 2020.10.01.323196 (2020). Briefly, highly complex libraries of AAV mutants were created and injected into the eyes of primates (cynolmolgus macaques or rhesus macaques).
- each AAV vector in the library contained a unique DNA barcode, which allowed for tracking of a mutated AAV capsid polypeptide.
- successfully packaged AAV vectors were polymerase chain reaction (PCR) amplified and repackaged, resulting in a “repack” library.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells. Computational analysis was performed to identify optimal vectors, according to cell specificities, expression levels, and/or other desirable characteristics, based on the presence and quantity of DNA barcodes in transcriptomes from thousands of different cells of multiple cell types in parallel.
- AAV capsid polypeptides were evaluated on the basis of mRNA transcription levels rather than the presence of DNA, reflecting the ability of the AAV vectors to drive expression of the AAV vector nucleic acid as opposed to simply having the ability to enter a cell.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in the parafoveal region of the retina.
- SEQ ID NO:14 SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “++” once and “+” once. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- an AAV vector having an amino acid sequence set forth in Table 1 (or Formula A)
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 11 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression across cell types.
- SEQ ID NO:14 SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+.” No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide can have the ability to mediate transgene expression in multiple different retinal cells types within an eye following intravitreal injection.
- Example 12 – Treating a retinal condition using an AAV vector An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 13 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- AAV capsid polypeptides were evaluated on the basis of mRNA transcription levels rather than the presence of DNA, reflecting the ability of the AAV vectors to drive expression of the AAV vector nucleic acid as opposed to simply having the ability to enter a cell.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+.” These were determined in terms of total levels of gene expression in RPE cells. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide can have the ability to mediate transgene expression in RPE cells following intravitreal injection.
- Example 14 – Treating a retinal condition using an AAV vector An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 15 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in retinal cells.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+++” once, “++” once, and “+” once. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- Table 1 or Formula A
- Example 16 Treating a retinal condition using an AAV vector
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 17 Construction of AAV vectors containing mutated capsid polypeptides
- a high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells. See, e.g., ⁇ ztk et al., bioRxiv, 2020.10.01.323196 (2020) and ⁇ ztk et al., eLife, 10:e64175 (2021). Briefly, highly complex libraries of AAV mutants were created and injected into the eyes of primates (cynolmolgus macaques or rhesus macaques).
- each AAV vector in the library contained a unique DNA barcode, which allowed for tracking of a mutated AAV capsid polypeptide.
- successfully packaged AAV vectors were polymerase chain reaction (PCR) amplified and repackaged, resulting in a “repack” library.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells. Computational analysis was performed to identify optimal vectors, according to cell specificities, expression levels, and/or other desirable characteristics, based on the presence and quantity of DNA barcodes in transcriptomes from thousands of different cells of multiple cell types in parallel.
- AAV capsid polypeptides were evaluated on the basis of mRNA transcription levels rather than the presence of DNA, reflecting the ability of the AAV vectors to drive expression of the AAV vector nucleic acid as opposed to simply having the ability to enter a cell.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in retinal cells.
- SEQ ID NO:14 SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+++” once, “++” twice, and “+” once. No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide can have the ability to mediate transgene expression preferentially in retinal ganglion cells following intravitreal injection.
- Example 18 – Treating a retinal condition using an AAV vector An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 19 Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in retinal cells.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+.” No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (or Formula A) can have the ability to mediate transgene expression preferentially in bipolar cells following intravitreal injection.
- Example 20 Treating a retinal condition using an AAV vector
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 21 Construction of AAV vectors containing mutated capsid polypeptides
- a high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells. See, e.g., ⁇ ztk et al., bioRxiv, 2020.10.01.323196 (2020) and ⁇ ztk et al., eLife, 10:e64175 (2021). Briefly, highly complex libraries of AAV mutants were created and injected into the eyes of primates (cynolmolgus macaques or rhesus macaques).
- each AAV vector in the library contained a unique DNA barcode, which allowed for tracking of a mutated AAV capsid polypeptide.
- successfully packaged AAV vectors were polymerase chain reaction (PCR) amplified and repackaged, resulting in a “repack” library.
- AAV vectors were injected into primate retinas, and nucleic acid encoding the AAV capsid polypeptides were then amplified from the nuclei of foveal cells, resulting in an “enriched” library.
- Each iteration of the AAV library e.g., the original library, the repack library, and the enriched library
- the AAV vectors competed with each other in vivo. Infection of successful AAV vectors led to expression of the DNA barcodes.
- Single cell suspensions were created from isolated retinal tissue, and single cell microfluidic technology (10X Genomics) was used to create cDNA libraries of individual cells. Computational analysis was performed to identify optimal vectors, according to cell specificities, expression levels, and/or other desirable characteristics, based on the presence and quantity of DNA barcodes in transcriptomes from thousands of different cells of multiple cell types in parallel.
- AAV capsid polypeptides were evaluated on the basis of mRNA transcription levels rather than the presence of DNA, reflecting the ability of the AAV vectors to drive expression of the AAV vector nucleic acid as opposed to simply having the ability to enter a cell.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested. These were determined in terms of total levels of gene expression in retinal cells.
- SEQ ID NO:14 SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+++.” No expression was detected within the limits of detection when the wild-type AAV2 vector was used.
- AAV vectors that include an AAV capsid polypeptide can have the ability to mediate transgene expression preferentially in OFF-retinal ganglion cells following intravitreal injection.
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 23 – Construction of AAV vectors containing mutated capsid polypeptides A high-throughput method was used to create AAV vectors with mutated capsid polypeptides and to screen those created AAV vectors for particular AAV vectors having the ability to exhibit high efficiency and/or specificity for infecting retinal cells.
- AAV capsid polypeptides for packaging was evaluated on the basis of successful packaging in the original and the “repack” library, reflecting the ability of the AAV vectors to package.
- the AAV vectors were ranked based on overall rankings with +++ indicating those that performed in the top 1/3 of vectors tested, with ++ indicating those that performed in middle 1/3 of vectors tested, and with + indicating those that performed in the bottom 1/3 of vectors tested.
- SEQ ID NO:14 (SEQ ID NO:5 inserted between amino acid residues 587 and 588 of SEQ ID NO:1; see, e.g., Figure 1) resulted in “+++.”
- AAV vectors that include an AAV capsid polypeptide e.g., an AAV2 capsid polypeptide
- Table 1 or Formula A
- Example 24 Treating a retinal condition using an AAV vector
- An AAV vector is constructed to include an AAV2 capsid polypeptide having an amino acid sequence set forth in Table 1 (e.g., SEQ ID NO:2 or 5) (or Formula A) and an exogenous nucleic acid sequence encoding a therapeutic polypeptide.
- the constructed AAV vector is administered intravitreally to a human identified as having a retinal condition in an amount that is from about 1 x 10 7 to about 1 x 10 14 AAV vectors. After the administration, the severity of one or more symptoms of the retinal condition is reduced and/or the progression of the retinal condition is slowed.
- Example 25 AAV vectors containing mutated capsid polypeptides
- the AAVs were packaged with a ubiquitous CMV promoter driving expression of a GFP transgene. Barcodes identifying unique AAV variants were included following the GFP transgene.
- the variant with SEQ ID NO:5 emerged as a top performer from this screen in four non-human primates. Performance was quantified according to the number of cells expressing the transgene.
- RNA-Seq was used to quantify the expression of GFP as a metric of the performance of variants in the pool.
- AAV2 Stemific name: Adeno-associated virus 2 (isolate Srivastava/1982); UniProt Taxon ID No.648242) was included in the mixture as a benchmarking control in the screen.
- the performance of each variant was quantified according to the number of cells expressing the transgene.
- the variant containing SEQ ID NO:66 outperformed the naturally occurring serotype controls across all cell types in all non-human primates, and performed similarly to engineered serotypes.
- polypeptide of Embodiment 1 wherein said polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 except that said amino acid sequence of any one of SEQ ID NOs:2-5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 or SEQ ID NO:10.
- Embodiment 3 The polypeptide of Embodiment 1, wherein said polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 except that said amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 or SEQ ID NO:10.
- Embodiment 4 wherein said polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 except that said amino acid sequence of SEQ ID NO:5 is located between amino acid positions 587 and 588 of SEQ ID NO:1 or SEQ ID NO:10.
- polypeptide of Embodiment 1 wherein said polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 except that the amino acids from position 585 to 590 of SEQ ID NO:1 or SEQ ID NO:10 are replaced with said amino acid sequence of any one of SEQ ID NOs:2-5.
- Embodiment 5 The polypeptide of Embodiment 1, wherein said polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 except that the amino acids from position 585 to 590 of SEQ ID NO:1 or SEQ ID NO:10 are replaced with said amino acid sequence of SEQ ID NO:2.
- Embodiment 6
- an AAV vector comprising said polypeptide infects greater than 2.5 percent of retinal cells when a titer of at least 1 x 10 7 of said vector is administered intravitreally to an eye of a human.
- Embodiment 7 The polypeptide of any one of Embodiments 1-6, wherein an AAV vector comprising said polypeptide expresses more nucleic acid in retinal cells than the level of expression from a comparable AAV vector comprising a capsid polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:1.
- Embodiment 8. A nucleic acid molecule encoding a polypeptide of any one of Embodiments 1-7.
- the nucleic acid molecule of Embodiment 8, wherein said nucleic acid molecule is DNA.
- Embodiment 10. A host cell comprising a nucleic acid molecule of any one of Embodiments 8-9. Embodiment 11. The host cell of Embodiment 10, wherein said host cell expresses a vector comprising said polypeptide. Embodiment 12. The host cell of Embodiment 10, wherein said host cell expresses said polypeptide.
- Embodiment 13 A host cell comprising a polypeptide of any one of Embodiments 1-7.
- Embodiment 14. The host cell of any one of Embodiments 10-13, wherein said host cell is a retinal cell.
- a non-naturally occurring AAV capsid polypeptide wherein said capsid polypeptide comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:10 comprising an amino acid sequence insert of Formula A located between amino acid positions 587 and 588 of SEQ ID NO:1 or SEQ ID NO:10, wherein said Formula A is: -L1-EGSGRN (SEQ ID NO:2)-L2-, wherein said L1 and said L2 are each independently optional amino acid linkers having one, two, or three amino acids.
- Embodiment 16 The capsid polypeptide of Embodiment 15, wherein said L1 is one amino acid X1.
- the capsid polypeptide of Embodiment 17, wherein said X1 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 18 The capsid polypeptide of Embodiment 17, wherein said X1 is A.
- Embodiment 19 The capsid polypeptide of Embodiment 15, wherein said L1 is two amino acids X2-X1.
- Embodiment 20 The capsid polypeptide of Embodiment 19, wherein said X1 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 21 The capsid polypeptide of Embodiment 19, wherein said X1 is A.
- Embodiment 22 The capsid polypeptide of Embodiment 19, wherein said X1 is A.
- the capsid polypeptide of Embodiment 15, wherein said L1 is three amino acids X3-X2-X1.
- Embodiment 26 The capsid polypeptide of Embodiment 25, wherein said X1 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 27 The capsid polypeptide of Embodiment 26, wherein said X1 is A.
- Embodiment 28. The capsid polypeptide of any one of Embodiments 25-27, wherein said X2 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 29. The capsid polypeptide of Embodiment 28, wherein said X2 is L.
- Embodiment 30 The capsid polypeptide of Embodiment 25, wherein said X2-X1 is LA.
- Embodiment 31. The capsid polypeptide of any one of Embodiments 25-30, wherein said X3 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 32 The capsid polypeptide of Embodiment 15, wherein said L1 is absent.
- Embodiment 33. The capsid polypeptide of any one of Embodiments 15-32, wherein said L2 is one amino acid Z1.
- Embodiment 34. The capsid polypeptide of Embodiment 33, wherein said Z1 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 35 The capsid polypeptide of Embodiment 34, wherein said Z1 is A.
- Embodiment 36. The capsid polypeptide of any one of Embodiments 15-32, wherein said L2 is two amino acids Z1-Z2.
- the capsid polypeptide of Embodiment 36, wherein said Z1 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 39. The capsid polypeptide of any one of Embodiments 36-38, wherein said Z2 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 40. The capsid polypeptide of Embodiment 39, wherein said Z2 is L.
- the capsid polypeptide of Embodiment 36, wherein said Z1-Z2 is AL.
- Embodiment 45. The capsid polypeptide of any one of Embodiments 42-44, wherein said Z2 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 47 The capsid polypeptide of Embodiment 42, wherein said Z1-Z2 is AL.
- Embodiment 48 The capsid polypeptide of any one of Embodiments 42-47, wherein said Z3 is selected from the group of amino acid residues consisting of A, V, I, and L.
- Embodiment 49 The capsid polypeptide of any one of Embodiments 15-32, wherein said L2 is absent.
- Embodiment 50 The capsid polypeptide of Embodiment 15, wherein said amino acid sequence insert comprises any one of SEQ ID NOs:2-5.
- Embodiment 51 A viral particle comprising a capsid polypeptide of any one of Embodiments 15-51.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Virology (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Ophthalmology & Optometry (AREA)
- Physics & Mathematics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2024557528A JP2025510975A (ja) | 2022-03-30 | 2023-03-30 | 網膜細胞に核酸を送達するためのアデノ随伴ウイルスベクター |
| CN202380040951.9A CN119213136A (zh) | 2022-03-30 | 2023-03-30 | 用于将核酸递送至视网膜细胞的腺相关病毒载体 |
| AU2023243048A AU2023243048A1 (en) | 2022-03-30 | 2023-03-30 | Adeno-associated virus vectors for nucleic acid delivery to retinal cells |
| EP23781800.0A EP4499848A4 (en) | 2022-03-30 | 2023-03-30 | Adeno-associated viral vectors for the delivery of nucleic acids to retinal cells |
| IL316014A IL316014A (en) | 2022-03-30 | 2023-03-30 | Adeno-associated virus vectors for delivering nucleic acids to retinal cells |
| US18/851,534 US20250327092A1 (en) | 2022-03-30 | 2023-03-30 | Adeno-associated virus vectors for nucleic acid delivery to retinal cells |
| CA3255255A CA3255255A1 (en) | 2022-03-30 | 2023-03-30 | Adeno-associated viral vectors for the delivery of nucleic acids to retinal cells |
| KR1020247036295A KR20250006360A (ko) | 2022-03-30 | 2023-03-30 | 망막 세포에 핵산을 전달하기 위한 아데노 관련 바이러스 벡터 |
| MX2024011963A MX2024011963A (es) | 2022-03-30 | 2024-09-27 | Vectores de virus adenoasociados para la entrega de acido nucleico a las celulas retinianas |
Applications Claiming Priority (26)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263325559P | 2022-03-30 | 2022-03-30 | |
| US202263325542P | 2022-03-30 | 2022-03-30 | |
| US202263325548P | 2022-03-30 | 2022-03-30 | |
| US202263325550P | 2022-03-30 | 2022-03-30 | |
| US202263325553P | 2022-03-30 | 2022-03-30 | |
| US202263325543P | 2022-03-30 | 2022-03-30 | |
| US202263325544P | 2022-03-30 | 2022-03-30 | |
| US202263325558P | 2022-03-30 | 2022-03-30 | |
| US202263325562P | 2022-03-30 | 2022-03-30 | |
| US202263325551P | 2022-03-30 | 2022-03-30 | |
| US202263325540P | 2022-03-30 | 2022-03-30 | |
| US202263325541P | 2022-03-30 | 2022-03-30 | |
| US202263325555P | 2022-03-30 | 2022-03-30 | |
| US63/325,550 | 2022-03-30 | ||
| US63/325,555 | 2022-03-30 | ||
| US63/325,544 | 2022-03-30 | ||
| US63/325,553 | 2022-03-30 | ||
| US63/325,562 | 2022-03-30 | ||
| US63/325,542 | 2022-03-30 | ||
| US63/325,551 | 2022-03-30 | ||
| US63/325,543 | 2022-03-30 | ||
| US63/325,559 | 2022-03-30 | ||
| US63/325,541 | 2022-03-30 | ||
| US63/325,540 | 2022-03-30 | ||
| US63/325,558 | 2022-03-30 | ||
| US63/325,548 | 2022-03-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023192463A2 true WO2023192463A2 (en) | 2023-10-05 |
| WO2023192463A3 WO2023192463A3 (en) | 2023-12-21 |
Family
ID=88203541
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/016871 Ceased WO2023192463A2 (en) | 2022-03-30 | 2023-03-30 | Adeno-associated virus vectors for nucleic acid delivery to retinal cells |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20250327092A1 (https=) |
| EP (1) | EP4499848A4 (https=) |
| JP (1) | JP2025510975A (https=) |
| KR (1) | KR20250006360A (https=) |
| CN (1) | CN119213136A (https=) |
| AU (1) | AU2023243048A1 (https=) |
| CA (1) | CA3255255A1 (https=) |
| IL (1) | IL316014A (https=) |
| MX (1) | MX2024011963A (https=) |
| TW (1) | TW202405180A (https=) |
| WO (1) | WO2023192463A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025072688A3 (en) * | 2023-09-27 | 2025-06-12 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Adeno-associated virus vectors for nucleic acid delivery to retinal cells |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105755044A (zh) * | 2011-04-22 | 2016-07-13 | 加利福尼亚大学董事会 | 具有变异衣壳的腺相关病毒病毒体及其使用方法 |
| CN110612353A (zh) * | 2017-03-03 | 2019-12-24 | 加利福尼亚大学董事会 | 经由抑制性tRNAs和脱氨酶对突变进行RNA靶向 |
| CA3053154A1 (en) * | 2017-06-30 | 2019-01-03 | The Regents Of The University Of California | Adeno-associated virus virions with variant capsids and methods of use thereof |
| AU2019227910B2 (en) * | 2018-02-28 | 2025-07-17 | The Regents Of The University Of California | A modular system for gene and protein delivery based on AAV |
| US20220348613A1 (en) * | 2019-08-28 | 2022-11-03 | University of Pittsburgh - of the Commonwealath System of Higher Ecucation | Adeno-associated viruses and methods and materials for making and using adeno-associated viruses |
| US20220313722A1 (en) * | 2019-09-09 | 2022-10-06 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Methods of restoring lysosomal function of retinal pigment epithelial cells by activation of tfeb |
-
2023
- 2023-03-30 IL IL316014A patent/IL316014A/en unknown
- 2023-03-30 CN CN202380040951.9A patent/CN119213136A/zh active Pending
- 2023-03-30 CA CA3255255A patent/CA3255255A1/en active Pending
- 2023-03-30 TW TW112112171A patent/TW202405180A/zh unknown
- 2023-03-30 US US18/851,534 patent/US20250327092A1/en active Pending
- 2023-03-30 WO PCT/US2023/016871 patent/WO2023192463A2/en not_active Ceased
- 2023-03-30 AU AU2023243048A patent/AU2023243048A1/en active Pending
- 2023-03-30 KR KR1020247036295A patent/KR20250006360A/ko active Pending
- 2023-03-30 JP JP2024557528A patent/JP2025510975A/ja active Pending
- 2023-03-30 EP EP23781800.0A patent/EP4499848A4/en active Pending
-
2024
- 2024-09-27 MX MX2024011963A patent/MX2024011963A/es unknown
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025072688A3 (en) * | 2023-09-27 | 2025-06-12 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Adeno-associated virus vectors for nucleic acid delivery to retinal cells |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023192463A3 (en) | 2023-12-21 |
| MX2024011963A (es) | 2024-11-08 |
| CA3255255A1 (en) | 2023-10-05 |
| TW202405180A (zh) | 2024-02-01 |
| KR20250006360A (ko) | 2025-01-10 |
| CN119213136A (zh) | 2024-12-27 |
| EP4499848A4 (en) | 2026-03-25 |
| AU2023243048A1 (en) | 2024-10-03 |
| US20250327092A1 (en) | 2025-10-23 |
| IL316014A (en) | 2024-11-01 |
| JP2025510975A (ja) | 2025-04-15 |
| EP4499848A2 (en) | 2025-02-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20190038724A1 (en) | Adeno-Associated Virus-Mediated CRISPR-Cas9 Treatment of Ocular Disease | |
| WO2023284879A1 (en) | Modified aav capsid for gene therapy and methods thereof | |
| WO2015196179A1 (en) | Methods of packaging multiple adeno-associated virus vectors | |
| US20250213722A1 (en) | Adeno-associated virus vectors for nucleic acid delivery to retinal ganglion cells and/or retinal pigment epithelium cells | |
| JP7702949B2 (ja) | ヒトmecp2遺伝子を発現するように設計されたトランスジーンカセット | |
| CN111876432B (zh) | 一组肝靶向新型腺相关病毒的获得及其应用 | |
| US20230091932A1 (en) | Closed-end dna production with inverted terminal repeat sequences | |
| US20250084436A1 (en) | Adeno-associated virus vectors | |
| US20250327092A1 (en) | Adeno-associated virus vectors for nucleic acid delivery to retinal cells | |
| WO2025072688A2 (en) | Adeno-associated virus vectors for nucleic acid delivery to retinal cells, for nucleic acid delivery across retinal regions, or for nucleic acid delivery to retinal ganglion cells and/or retinal pigment epithelium cells | |
| US20250222135A1 (en) | Adeno-associated virus vectors for nucleic acid delivery across retinal regions | |
| JP7624727B2 (ja) | 合理的設計により増強された新規なaavウイルスによる網膜における高効率の形質導入および側方への広がり | |
| WO2025231336A1 (en) | Adeno-associated virus vectors | |
| WO2024102739A2 (en) | Adeno-associated virus (aav) production | |
| WO2026039585A2 (en) | Adeno-associated virus vectors | |
| WO2026050107A1 (en) | Adeno-associated virus vectors | |
| WO2025072698A2 (en) | Aav9 vectors and capsid polypeptides for use in treating cns disorders | |
| US20230390367A1 (en) | Genetic approach to suppress coronaviruses |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23781800 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 814623 Country of ref document: NZ Ref document number: AU2023243048 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024557528 Country of ref document: JP Ref document number: MX/A/2024/011963 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 316014 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2023243048 Country of ref document: AU Date of ref document: 20230330 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024020065 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202406745P Country of ref document: SG Ref document number: 2024132391 Country of ref document: RU Ref document number: 2023781800 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023781800 Country of ref document: EP Effective date: 20241030 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380040951.9 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23781800 Country of ref document: EP Kind code of ref document: A2 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380040951.9 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112024020065 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240927 |
|
| WWP | Wipo information: published in national office |
Ref document number: 2024132391 Country of ref document: RU |
|
| WWP | Wipo information: published in national office |
Ref document number: 18851534 Country of ref document: US |