WO2023180549A1 - Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo - Google Patents

Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo Download PDF

Info

Publication number
WO2023180549A1
WO2023180549A1 PCT/EP2023/057684 EP2023057684W WO2023180549A1 WO 2023180549 A1 WO2023180549 A1 WO 2023180549A1 EP 2023057684 W EP2023057684 W EP 2023057684W WO 2023180549 A1 WO2023180549 A1 WO 2023180549A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
recombinant polypeptide
seq
human
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2023/057684
Other languages
English (en)
French (fr)
Inventor
Valentin BRUTTEL
Jörg WISCHHUSEN
Shriya Mamatha JAYARAM
Fadhil AHSAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Julius Maximilians Universitaet Wuerzburg
Original Assignee
Julius Maximilians Universitaet Wuerzburg
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2024556458A priority Critical patent/JP2025510786A/ja
Priority to EP23716418.1A priority patent/EP4499231A1/en
Priority to KR1020247034451A priority patent/KR20240164796A/ko
Priority to AU2023237632A priority patent/AU2023237632A1/en
Priority to CN202380029744.3A priority patent/CN119110810A/zh
Priority to MX2024011666A priority patent/MX2024011666A/es
Priority to IL314754A priority patent/IL314754A/en
Priority to US18/849,075 priority patent/US20250205322A1/en
Priority to CA3250911A priority patent/CA3250911A1/en
Application filed by Julius Maximilians Universitaet Wuerzburg filed Critical Julius Maximilians Universitaet Wuerzburg
Publication of WO2023180549A1 publication Critical patent/WO2023180549A1/en
Priority to CONC2024/0012332A priority patent/CO2024012332A2/es
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70539MHC-molecules, e.g. HLA-molecules
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/577Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/605MHC molecules or ligands thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • the present invention relates to therapeutical uses of non-classical human major histocompatibility complex (MHC) molecules (also named MHC class lb molecules) in combination with peptide antigens for the treatment of neuromyelitis optica (NMO).
  • MHC human major histocompatibility complex
  • NMO neuromyelitis optica
  • the invention more specifically relates to recombinant polypeptides comprising peptide antigens and one or more domains of a non-classical MHC class lb molecule.
  • the invention also relates to methods of producing such recombinant polypeptides, pharmaceutical compositions comprising the same, as well as their uses for treating neuromyelitis optica (NMO).
  • NMO Neuromyelitis optica
  • CNS central nervous system
  • Acute relapses are usually treated with immunosuppressive therapeutics such as glucocorticoids or plasmapheresis to remove autoreactive antibodies. More recently, therapeutic antibodies that inhibit the complement system (eculizumab) or block inflammatory cytokines (satralizumab) have also been approved.
  • immunosuppressive therapeutics such as glucocorticoids or plasmapheresis to remove autoreactive antibodies. More recently, therapeutic antibodies that inhibit the complement system (eculizumab) or block inflammatory cytokines (satralizumab) have also been approved.
  • NMO neuromyelitis optica
  • MHO class lb molecules such as HLA-G possess the ability to induce antigen-specific tolerance towards presented peptide antigens.
  • MHO class lb molecules can advantageously be used according to the invention to suppress immune responses in an antigen-specific manner.
  • molecules other than naturally occurring MHC class lb molecules and in particular polypeptides which only comprise at least one domain of an MHC class lb molecule, preferably at least an [alpha]3 domain of an MHC class lb molecule, can be used:
  • the [alpha]1 and [alpha]2 domains of variable class I a molecules can be combined with the [alpha]3 domain of a human MHC class lb molecule in order to suppress immune responses towards peptides presented by these antigens.
  • Antigen-loaded HLA-G molecules can be unstable.
  • the inventors designed soluble recombinant polypeptides comprising a peptide antigen, an MHC class lb molecule such as HLA-G and p2-microglobulin (b2m), and connected these three components covalently (e.g., via covalent linkers).
  • the antigen-binding a1 and a2 domains of an MHC class lb molecule such as HLA-G were exchanged by the respective domains of other MHC molecules to enhance the flexibility and versatility of these recombinant polypeptides (see, for instance, Figure 2).
  • These alternative recombinant polypeptides can be designed with antigen-binding domains of other human HLA molecules.
  • constructs comprising the a1 and a2 domains of murine H2-K b can present the ovalbumin-derived peptide SIINFEKL to OT-1 T cells.
  • OT-1 T cells express a transgenic T cell receptor that specifically recognizes this antigen) (WO 2018/215340).
  • neuromyelitis optica NMO
  • NMO neuromyelitis optica
  • the recombinant polypeptides of the invention do not only modulate T- cell responses but also prevent the formation of aquaporin 4 (AQP4)-specific autoantibodies. It is expected that this advantage will translate into a clinical improvement in human patients having neuromyelitis optica (NMO), because aquaporin 4 (AQP4)-specific autoantibodies are involved in the pathology of neuromyelitis optica (NMO).
  • the invention relates to the following preferred embodiments:
  • a recombinant polypeptide capable of presenting a peptide antigen comprising, in an N- to C-terminal order,
  • a peptide antigen presented by said recombinant polypeptide wherein the peptide antigen is a peptide of human aquaporin 4; ii) optionally a linker sequence; ill) optionally a sequence of a human polypeptide domain comprising a sequence of a human p2 microglobulin, or an amino acid sequence at least 90% identical to the amino acid sequence of human p2 microglobulin represented by SEQ ID NO: 5; iv) optionally a linker sequence; v) optionally an [alpha] 1 domain of an MHC molecule; vi) optionally an [alpha] 2 domain of an MHC molecule; vii) an [alpha] 3 domain of an MHC class lb molecule or a derivative of an [alpha] 3 domain of an MHC class lb molecule, said derivative being capable of binding to ILT2 or ILT4; viii) optionally a protease cleavage site; lx) optionally a spacer
  • I) consists of an amino acid sequence selected from the group consisting of the amino acid sequences of SEC ID NOs: 2, 22, 23 and 24.
  • the recombinant polypeptide according to item 8 wherein said [alpha] 1 domain according to (v) and said [alpha]2 domain according to (vi) are from a human HLA-A2 molecule.
  • the recombinant polypeptide according to item 7 wherein said [alpha] 1 domain according to (v) and said [alpha]2 domain according to (vi) are from a human MHC class lb molecule.
  • the recombinant polypeptide according to item 10 wherein said [alpha] 1 domain according to (v) and said [alpha]2 domain according to (vi) are from a human HLA-G molecule.
  • the recombinant polypeptide according to item 14 wherein the [alpha]3 domain according to (vii) is identical to the [alpha]3 domain having the amino acid sequence of SEQ ID NO: 9 or SEQ ID NO: 21.
  • the recombinant polypeptide according to any one of the preceding items wherein said sequence of a human polypeptide domain according to (ill) is at least 95% identical to the amino acid sequence of SEQ ID NO: 5, preferably at least 98% identical to the amino acid sequence of SEQ ID NO: 5 and more preferably identical to the amino acid sequence of SEQ ID NO: 5.
  • a pharmaceutical composition or kit comprising at least one nucleic acid according to items 32 or 33.
  • composition or kit comprising at least one recombinant polypeptide according to any one of items 1-31.
  • composition or kit according to item 35, wherein the pharmaceutical composition or kit comprises at least two different recombinant polypeptides according to any one of items 1-31, and wherein each of the different polypeptides comprises a different peptide antigen as defined in any one of items 3 to 6.
  • a recombinant host cell comprising a nucleic acid or a vector according to item 32 or 33 and expressing the recombinant polypeptide according to any one of items 1-31.
  • a method for obtaining pharmaceutical composition comprising a polypeptide according to any one of items 1-31, the method comprising the steps of (a) culturing the recombinant host cell of item 43 under conditions allowing expression of the recombinant polypeptide from the nucleic acid molecule, (b) recovering the recombinant polypeptide, (c) purifying the recombinant polypeptide, and (d) formulating the recombinant polypeptide into a pharmaceutical composition.
  • Figure 1 Depiction of a peptide-loaded soluble MHO lb molecule suitable to achieve therapeutic antigenspecific immunomodulation.
  • the presented peptide antigen is depicted in dotted spheres, the HLA-G alpha1-3 domains are sketched in light-grey, and the beta2microglobulin domain is shown in dark grey.
  • An optional linker connecting the antigenic peptide with the beta2microglobulin molecule is displayed in grey stick style, and an optional disulfide trap is depicted in black spheres.
  • This figure was generated using Pymol and is adapted from structures published in Clements et al., Proc Natl Acad Sci U S A. 2005 Mar 1; 102 (9): 3360-5 and Hansen et al., Trends Immunol. 2010 Oct;31 (10): 363-9.
  • Figure 2 Example for a vector-based construct encoding a single chain MHC lb molecule suitable for therapeutic peptide-specific immunomodulation.
  • HLA-G 1 and HLA-G5 each consist of 3 [alpha] domains (here in black), a non-covalently associated beta 2- microglobulin subunit (here in dark grey) and the antigenic peptide presented on HLA-G (short black arrow).
  • HLA-G1 further contains a transmembrane domain and a short intracellular chain (not shown here).
  • the [alpha]-3 domain is capable of binding to the receptors ILT2 (see Shiroishi et al., Proc Natl Acad Sci U S A. 2003 July 22; 100(15):8856-8861 ) and ILT4 (see Shiroishi et al., Proc Natl Acad Sci U S A.
  • Figure 3 Surrogates of recombinant polypeptides of the invention induce IL10 secreting Treg in mice.
  • lOOpig of surrogate molecules consisting of a viral (Gp34) or Ovalbumin (Ova) model peptide antigen, murine H2-K b alphal and 2 domains, and human HLA-G alpha 3 domain and beta-2- microglobulin were injected i.p. into 12 week old C57BL/6 mice. After 14 days, mice were sacrificed and splenocytes were rechallenged with 5pig/ml of either Gp34 or Ova peptide in an 48h standard murine IL-10 ELIspot assay (Mabtech mouse IL-10 HRP ELISpot kit, cells cultured in RPM1 10% FCS 10ng/ml IL2).
  • Gp34 viral
  • Ova Ovalbumin
  • Figure 4 Surrogates of recombinant polypeptides of the invention prevent CD8+ T-cell driven EAE in mice.
  • OVA ovalbumin
  • MBP myelin basic protein
  • OT-I mice express a T cell receptor (OT-I) on their CD8+ T cells, which recognizes exactly this peptide-MHC combination.
  • EAE autoimmune encephalomyelitis
  • Figure 5 Some surrogates of recombinant polypeptides of the invention selectively prevent CD4 + T cell driven EAE in mice.
  • jg/mouse of surrogate molecules consisting of a viral (Gp34) or two Mog peptide antigens (Mog37 or Mog44), murine H2-D b alphal and 2 domains, and human HLA-G alpha 3 domain and beta-2-microglobulin or just PBS were injected the first day.
  • the Mog44 peptide containing surrogate molecule significantly reduced EAE symptoms and weight loss.
  • FIG. 6 Mog44 surrogates of recombinant polypeptides of the invention prevented inflammation and CD8 T cell infiltration in the spinal cord.
  • FIG. 7 Detection of anti-MOG35-55 antibodies in Mog-EAE mice treated with surrogates of recombinant polypeptides of the invention ("AIM Bio”)
  • Murine serum was collected from heart puncture after mice were sacrificed. 1 Opig/ml Mog35-55 were used for coating over night, wells were blocked using 1 %BSA, and anti-Mog35-55 antibodies were detected using the indicated secondary HRP coupled antibodies.
  • Mog35-55 induced EAE correlated with high levels of Mog35-55 specific IgG autoantibodies, which which were not detectable in animals treated with 10Opig MOG44_Db_G surrogate molecule.
  • Figure 8 List of the human NMO recombinant polypeptide candidates.
  • the peptide antigen sequences of the NMO recombinant polypeptide candidates shown in the Figure are as follows:
  • Figure 9 Upregulation of CD8 Treg in healthy blood donors by a recombinant polypeptide of the invention containing the KPLPVDMVL antigen ("AQP_64”)
  • Treg induction mediated by peptide-HLA-G containing constructs was carried out as follows: PBMCs from healthy donors were purified via density centrifugation performed on white blood cells from a leukocyte reduction chamber using Ficoll. Cells were centrifuged for 20 min at 1200 x g without brake followed by collection of the interphase ring that was washed with 1x PBS (5 min, 300 x g). PBMC were frozen till further use.
  • PBMCs were thawed 1 day prior to PBMC pulsing (d-1) and kept over night in 5 ml X-VIVO 15 medium containing 5% human AB serum in a well of a 6 well plate at 37°C.
  • X-VIVO 15 complete medium 5% hAB serum & cytokine cocktail: 20 ng/ml hlL-2, 20 ng/ml hGM-CSF, 10 ng/ml hlL-4 & 10 ng/ml hTGF-b1
  • 3x10 6 cells were seeded in the respective wells of a 12-well plate with a final volume of 1000 pl X-VIVO complete medium with cytokine cocktail and 5 pg/ml of an AIM Bio molecule or the respective controls.
  • ELISpot plate PVDF membrane was activated with 50 pl/well EtOH (35% v/v) for 1 min followed by 5x washing with 200 pl distilled sterile water. Plate was coated with 100 pl/well anti-hlL10 (clone 9D-7, 1:500 dilution in PBS, sterile filtered) at 4°C over night. On the next day, unbound coating antibody was removed, 5 washing steps were performed with 200 pl PBS and 200 pl blocking buffer (X-VIVO 15 5% hAB serum) was added and the plate incubated for 30 min - 2 h at room temperature. Day 14, 200,000 cells were seeded per well on the ELISpot plates in duplicates, including negative controls (cells plus PBS) and a positive control (e.g.
  • AQP4_64_G_Spt induced at least 30% more IL-10 secreting T reg in 65% of of all healthy blood donors.
  • Figure 9 continued: % increase in IL10 spots in PBMCs shown for HLA-A2 + abd HLA-A2’ donorsr (in response to treatment with AQP4_64_G_Spt).
  • Figure 10 Control experiment on the samples shown in Figure 7 shows that total IgG is not reduced by MOG47_Db_G surrogate molecule treatment.
  • Easy-TiterTM Human IgG (gamma chain) Assay Kit (Thermo Fisher) was used to quantify total IgG according to the manjufacturers instructions. This experiments in conjunction with Figure 7 indicates that selective antibody responses can be suppressed using single-chain MHC lb molecules.
  • Figure 11 Stability of purified single-chain MHC lb molecules. After purification of the single chain MHC lb molecules, their stability was analysed after 1 and 3 freeze-thawing cycles, storage for 5 days at room temperature and heating up to a temperature of 50°C for 30 min. For this, A) a Coomassie gel staining of a 12% polyacrylamide gel using 2 pg AIM Bio and B) an aHLA-G Western blot using the 2A12aHLA-G antibody (1 :1000) blot using 1 pg protein was performed under non-reducing conditions. Both monomers and dimers are detectable.
  • FIG. 12 Single-chain MHC lb molecules are thermally stable.
  • TSA Thermal Shift Assay
  • 3 pg of the respective single chain MHC lb molecule or Motavizumab as control molecule were diluted with PBS and 5x SYPRO Orange dye (stock 5000x, final concentration: 5x) to a volume of 25 pl.
  • a melting curve program was set up on a StepOnePlus Instrument using the StepOnePlus Software 2.3. The start temperature was 25°C for one minute followed by a temperature increase of 1 °C per minute to a final temperature of 95°C for 2 min, thereby measuring the autofluorescence as arbitrary unit. Data were exported and graphs were drawn in Prism V7.04. For determination of the melting temperature (Tm), the Boltzman sigmoidal function was used.
  • FIG. 13 Single-chain MHC lb molecules induce Treg in a dose-dependent manner.
  • OT-I mice were injected i.p. with indicated amounts of single-chain H2_K b alphal +2 and HLA-G alpha3 domain constructs with human beta-2-microglobulin and the indicated peptide or carrier (PBS).
  • PBS indicated peptide or carrier
  • Ova is the cognate peptide for the OT-I TOR in these mice
  • Gp34 is an irrelevant, virus derived control peptide.
  • mice were sacrificed and splenocytes tested for IL10 secreting cells in a recall mouse IL-10 ELISpot (200,000 cells per well, MabTech mouse IL-10 ELISpot kit, 5 pg/ml of the indicated peptide or only PBS were added, 48h).
  • a clear induction of IL-10 secreting cells reactive to Ova peptide was observed when 50 and 500 pig mouse adapted Ova_KbG were injected.
  • FIG. 14 Single-chain MHO lb molecules inhibit T cell lysis in a dose-dependent manner.
  • OT1/BL6 Mice were sacrificed and splenocytes were collected and washed once in RPMI 5% FCS. Red blood cells were removed with 2ml 1x sterile RBC lysis buffer for 3 min.
  • Cells were cultured in high density culture (Wrnio cells/ml) for 72h in RPMI 10% FCS medium with GMCSF 20 ng/mL, IL-2 20ng/ml and IL-4 10 ng/ml and increasing doses of Ova_KbG. Cells are then scraped from the plates, CD8+ cells are then purified via magnetic beads. Sterile 96-well white plates were used.
  • Luciferase expressing Panc02 target cells were loaded with 20pig/ml Ova peptide (SIINFEKL) for 60 min at 37°C with 500 rpm shaking.
  • CD8+ effector T cells were added in a 50:1 ratio, as well as luciferin. Luminescence was measured after 24h and 48h.
  • FIG. 15 Serum cytokines from EAE-ODC Ova mice. Serum cytokines from EAE-ODC Ova mice were measured with Th1/Th2 10plex Flowcytomix Kit (eBioscience) according to the manufacturer's instruction. The kit was used for the simultaneous detection of mouse granulocyte-macrophage colony-stimulating factor (GMCSF), interleukin 1 alpha (IL-1 a), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-6 (IL-6), interleukin- 10 (IL-10), t interleukin-17 (IL-17), and tumor necrosis factor (TNF) in a single sample.
  • GMCSF mouse granulocyte-macrophage colony-stimulating factor
  • IL-1 a interleukin-1 alpha
  • IL-2 interleukin-2
  • IL-4 interleukin-4
  • IL-6 interleukin-6
  • IL-10 interleukin- 10
  • TNF tumor nec
  • This array kit provides a mixture of eight capture beads with distinct fluorescent intensities that have been coated with capture antibodies specific for each cytokine. Beads coated with ten specific capture antibodies were mixed. Subsequently, 25 pL of the mixed captured beads, 25 pL of the unknown serum sample or standard dilutions, and 25 pL of phycoerythrin (PE) detection reagent were added consecutively to each well in 96-V bottom well plates and incubated for 2 h at room temperature in the dark. The samples were washed with 1 mL of wash buffer for 5 min and centrifuged. The bead pellet was resuspended in 200 pL buffer after discarding the supernatant. Samples were measured on the AttuneTM NxT Flow Cytometer and analyzed Attune Cytometric Software (Thermo Fisher Scientific).
  • Figure 16 Map of molecular composition of most-preferred mouse-adapted AIM Bio.
  • a corresponding exemplary amino acid sequence is:
  • Figure 17 Coomassie gel of purified, stability tested NMO surrogate single-chain MHC lb molecules. After purification of the single chain MHC lb molecules, their stability was analysed after 1 and 3 freeze-thawing cycles, storage for 5 days at room temperature and heating up to a temperature of 50°C for 30 min. Methods see Figure 11.
  • Figure 18 Western blot (2A12 HLA-G5 antibody 1 :5000) of purified and stability tested NMO surrogate single-chain MHC lb molecules. Both experiments indicated that these molecules are very stable, but AQP203_H2KbG tends to multimerize much more.
  • TSA Thermal Shift Assay
  • FIG 20 EAE Score. AQP147_KbG conferred complete protection from EAE in treated 2D2 mice. Mice were injected with treatment or control AIM Bios on DO, D15 and D30. They were evaluated daily based on EAE scoring system of 0-10 described in table 1. Untreated mice developed severe EAE symptoms during the course of experiment. 1 untreated mouse reached a score of 6 on D14 and was sacrificed. Its score was assumed as 6 for the remaining days during evaluation. Control treatment with gp34_KbG did not confer desirable protection. (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001)
  • FIG. 21 Immune cell infiltration in optic nerve of wildtype and 2D2 mice.
  • AQP147_KbG treatment inhibited immune cell infiltration in optic nerve.
  • CD3 + and CD8 + fluorescence signals obtained from each treatment group are shown in panels A (optic nerve) and B, (spinal cord) DAPI images depict total nuclei present in each section.
  • the number of CD3 + and CD8 + T cells were significantly higher in the optic nerve (panel C) and spinal cord (panel D) of control and untreated mice.
  • AQP203_KbG inhibited immune infiltration better than control and untreated groups. Data is represented as mean +/-SEM. Scale bar 25 pirn. 1 -tailed t-test.
  • Figure 22 Cleaved-Caspase-3 quantification in optic nerve, spinal cord and retina of wildtype and 2D2 mice.
  • AQP147_KbG completely inhibits apoptosis in optic nerve, spinal cord and retina.
  • Fluorescent signals obtained from cleaved-caspase-3 (apoptosis marker) staining in optic nerve (panels A, B) spinal cord (panels C, D) and retina (panels E, F) are shown.
  • Untreated and control treated mice had highest levels of cleaved- casp-3 and thus in turn, highest level of apoptosis. Data is represented as mean +/-SEM. Scale bar 25 pirn. 1- tailed t-test
  • FIG. 23 CD8 + CD122 + and CD4 + FoxP3 + regulatory T cells in optic nerve.
  • the Figure shows that while there are less CD8 T cells in AIM treated mice, there are few, but clearly more regulatory T cells in the optic nerve (one-tailed T Test used)
  • Figure 24 Quantification of inner retinal thickness in wildtype and 2D2 mice.
  • AQP147_KbG completely rescues IRL cells from degradation.
  • Hematoxylin-eosin staining results show that the thickness of inner retinal layer of AQP147_KbG was preserved whereas untreated and control treated mice had thinner IRL.
  • Data is represented as mean +/-SEM.
  • Scale bar 25 pirn. 2-tailed t-test DETAILED DESCRIPTION OF THE INVENTION
  • All proteins in accordance with the invention including the recombinant polypeptides of the invention, can be obtained by methods known in the art. Such methods include methods for the production of recombinant polypeptides.
  • the recombinant polypeptides of the invention can be expressed in recombinant host cells according to the invention.
  • Recombinant host cells of the invention are preferably mammalian cells such as CHO and HEK cells.
  • the recombinant polypeptides of the invention are meant to optionally include a secretion signal peptide sequence.
  • the recombinant polypeptides of the invention are meant to also optionally include affinity tags, e.g. in order to facilitate purification, and optional protease cleavage sites between the tag and the polypeptide, e.g. in order to facilitate removal of the tags by protease cleavage.
  • any reference to amino acid sequences referred to herein is meant to encompass not only the unmodified amino acid sequence but also typical posttranslational modifications of these amino acid sequences (e.g., glycosylation or deamidation of amino acids, the clipping of particular amino acids or other posttranslational modifications) occurring in cellular expression systems known in the art, including mammalian cells such as CHO and HEK cells.
  • polypeptides of the invention are meant to optionally include the respective pro-peptides.
  • the recombinant polypeptides of the invention can be in form of their soluble or their membrane-bound form. Whether a recombinant polypeptide is "soluble” under these conditions can be determined by methods known in the art, e.g., by measuring the turbidity of the recombinant polypeptide under the above-indicated reference conditions. As used herein, soluble means that at least 95% of the recombinant polypeptide is determined to be soluble under these reference conditions.
  • Single chain MHC molecules can be stored, for instance, in PBS at -80°C (with or without 0.1% human albumin as carrier, depending on the protein concentration) or in 50% glycerol at -20°C.
  • MHC molecules are preferably human MHC molecules.
  • the recombinant polypeptides of the invention are preferably isolated recombinant polypeptides. It will be understood how a recombinant polypeptide capable of binding and presenting an peptide antigen according to the invention can be prepared.
  • peptide antigen-binding domains such as [alpha] 1 and [alpha]2 domains are well-known, and modifications of these domains can be made.
  • a peptide antigen to bind to the polypeptides and MHC molecules according to the invention can be determined by techniques known in the art, including but not limited to explorative methods such as MHC peptide elution followed by Mass spectrometry and bio-informatic prediction in silico, and confirmative methods such as MHC peptide multimere binding methods and stimulation assays.
  • the recombinant polypeptides, pharmaceutical compositions and kits of the invention are preferably suitable for use in a human patient.
  • the recombinant polypeptides, pharmaceutical compositions and kits of the invention are preferably suitable for use in the treatment of neuromyelitis optica in a human patient.
  • the recombinant polypeptides, pharmaceutical compositions and kits of the invention are preferably suitable for inducing immunological tolerance against human aquaporin 4, e.g., in a human patient.
  • any lenghts of these peptide antigens referred to herein are meant to refer to the length of the peptide antigens themselves.
  • the lenghts of peptide antigens referred to herein do not include the length conferred by additional amino acids which are not part of the peptide antigens such as additional amino acids from possible linker sequences etc.
  • each occurrence of the term “comprising” may optionally be substituted with the term “consisting of'.
  • the methods used in the present invention are performed in accordance with procedures known in the art, e.g. the procedures described in Sambrook et al. ("Molecular Cloning: A Laboratory Manual.”, 2 nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York 1989), Ausubel et al. ("Current Protocols in Molecular Biology.” Greene Publishing Associates and Wiley Interscience; New York 1992), and Harlow and Lane (“Antibodies: A Laboratory Manual” Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York 1988), all of which are incorporated herein by reference.
  • Protein-protein binding such as binding of antibodies to their respective target proteins, can be assessed by methods known in the art. Protein-protein binding is preferably assessed by surface plasmon resonance spectroscopy measurements.
  • binding of MHC class lb molecules or recombinant polypeptides according to the invention to their receptors, including ILT2 and ILT4, is preferably assessed by surface plasmon resonance spectroscopy measurements. More preferably, binding of MHC class lb molecules or recombinant polypeptides according to the invention to their receptors is assessed by surface plasmon resonance measurements at 25°C. Appropriate conditions for such surface plasmon resonance measurements have been described by Shiroishi et al., Proc Natl Acad Sci U S A. 2003 July 22; 100(15):8856-8861 .
  • Sequence Alignments of sequences according to the invention are performed by using the BLAST algorithm (see Altschul et al. (1990) "Basic local alignment search tool.” Journal of Molecular Biology 215. p. 403-410.; Altschul et al.: (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res. 25:3389-3402.).
  • Appropriate parameters for sequence alignments of short peptides by the BLAST algorithm which are suitable for peptide antigens in accordance with the invention, are known in the art. Most software tools using the BLAST algorithm automatically adjust the parameters for sequence alignments for a short input sequence.
  • the following parameters are used: Max target sequences 10; Word size 3; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment.
  • identity or “identical” preferably refer to the identity value obtained by using the BLAST algorithm.
  • compositions of the present invention are prepared in accordance with known standards for the preparation of pharmaceutical compositions.
  • compositions are prepared in a way that they can be stored and administered appropriately.
  • the pharmaceutical compositions of the invention may therefore comprise pharmaceutically acceptable components such as carriers, excipients and/or stabilizers.
  • Such pharmaceutically acceptable components are not toxic in the amounts used when administering the pharmaceutical composition to a human patient.
  • the pharmaceutical acceptable components added to the pharmaceutical compositions may depend on the chemical nature of the active ingredients present in the composition, the particular intended use of the pharmaceutical compositions and the route of administration.
  • the pharmaceutically acceptable components used in connection with the present invention are used in accordance with knowledge available in the art, e.g. from Remington's Pharmaceutical Sciences, Ed. AR Gennaro, 20th edition, 2000, Williams & Wilkins, PA, USA.
  • Pharmaceutical compositions comprising the nucleic acids of the invention e.g., RNAs
  • peptide antigens which can be used in accordance with the invention are not particularly limited other than by their ability to be presented on MHC molecules. It is understood that a "peptide antigen presented by said recombinant polypeptide” as referred to in relation to the invention is a peptide antigen that is presented by said recombinant polypeptide to human T cells, if such T cells are present, in a way that it binds to a T cell receptor on the human T-cells.
  • MHC molecules which are able to be presented on MHC molecules can be generated as known in the art (see, for instance, Rammensee, Bachmann, Emmerich, Bachor, Stevanovic. SYFPEITHI: database for MHC ligands and peptide motifs. Immunogenetics. 1999 Nov;50(3-4):213-9; Pearson et al. MHC class l-associated peptides derive from selective regions of the human genome. J Clin Invest. 2016 Dec 1 ; 126(12):4690-4701 ; and Rock, Reits, Neefjes. Present Yourself! By MHC Class I and MHC Class II Molecules. Trends Immunol. 2016 Nov;37(11)724-737).
  • Peptide antigens are generally known in the art.
  • the peptide antigens in accordance with the invention are capable of binding to MHC class I proteins. It will be understood by a person skilled in the art that for each MHC class lb molecule or polypeptide capable of presenting peptides in accordance with the invention, peptide antigens which are capable of binding to said MHC class lb molecule or recombinant polypeptide will preferably be used. These peptide antigens can be selected based on methods known in the art.
  • Binding of peptide antigens to MHC class lb molecules or to polypeptides capable of peptide antigen binding in accordance with the invention can be assessed by methods known in the art, e.g. the methods of:
  • Such methods include experimental methods and methods for the prediction of peptide antigen binding.
  • Anchor residues which serve to anchor the peptide antigen on the MHC class I molecule and to ensure binding of the peptide antigen to the MHC class I molecule are known in the art.
  • the peptide antigen used in accordance with the invention contain any of the anchor or preferred amino acid residues in the positions as predicted for MHC class I molecules.
  • the peptide antigen is from human aquaporin 4.
  • non-anchor amino acid residues of the peptide antigen of the invention may or may not contain conservative substitutions, preferably not more than two conservative substitutions, more preferably one conservative subsitution with respect to the corresponding amino acid sequence of a peptide antigen from human aquaporin 4.
  • Peptide antigens of the invention preferably consist of naturally occurring amino acids. However, non-naturally occurring amino acids such as modified amino acids can also be used.
  • a peptide antigen of the invention encompasses the peptidomimetic of the indicated peptide antigen amino acid sequence of human aquaporin 4.
  • the recombinant polypeptides of the invention can be used for the treatment of neuromyelitis optica.
  • the treatment can be a treatment by inducing myelin-specific regulatory T cells.
  • regulatory T cells e.g., CD8-positive regulatory T cells
  • cytotoxic T cells recognizing the same or another myelin antigen.
  • Regulatory T-cells e.g., CD8- positive regulatory T cells
  • IL-10 secretion of IL-10.
  • CD8-positive regulatory T cells are not as well known as CD4CD25 regulatory T cells, they have even been described to be more potent. See, for instance:
  • CD 122 and CD8 While these are characterized by expression of CD 122 and CD8 in mice, their human counterparts have been described to be CD8 and CXCR3 positive. See, for instance:
  • the treatment according to the invention can be a treatment for reducing plasma or cerebrospinal fluid (CSF) levels of autoantibodies against human aquaporin 4.
  • the human patient can be a patient who had plasma or cerebrospinal fluid (CSF) autoantibodies against human aquaporin 4 prior to the start of the treatment.
  • the autoantibodies can be detected by various methods known in the art.
  • a preferred approach are cell-based assays (CBAs) where the suspected target antigen of the autoantibodies (e.g., aquaporin 4) is overexpressed in HEK293 or CHO cells which are then incubated with serum or cerebrospinal fluid, typically for 1 h at room temperature. Mock- transfected sister cells serve as controls.
  • CBAs cell-based assays
  • the suspected target antigen of the autoantibodies e.g., aquaporin 4
  • HEK293 or CHO cells which are then incubated with serum or cerebrospinal fluid, typically for 1 h at room temperature. Mock- transfected sister cells serve as controls.
  • Autoantibodies that bind to the cells are detected with different fluorescently labeled anti-human specific secondary antibodies that recognize total human IgG (heavy and light chain), IgG-Fc (constant chain) or lgG1.
  • Binding is quantified by either flow cytometry (CBA-FACS) or visual scoring by microscopic evaluation of the immunofluorescence (CBA-IF), which is often titrated.
  • CBA-FACS flow cytometry
  • CBA-IF immunofluorescence
  • Other approaches like enzyme-linked immunosorbent assays (ELISAs) or Western Blots are also possible, but often less sensitive, as conformation-sensitive antibodies may not be detected by these methods. Suitable approaches have been described in
  • Preferred amino acid sequences referred to in the present application can be independently selected from the following sequences.
  • the sequences are represented in an N-terminal to C-terminal order; and they are represented in the one-letter amino acid code.
  • Optional leader Peptide (absent from the recombinant polypeptide due to processing during cellular expression): e.g. MSRSVALAVLALLSLSGLEA (SEQ ID NO: 1)
  • Peptide antigen any MHO class I peptide corresponding to MHO class I [alpha] 1&2 domains, e.g. KPLPVDMVL (SEQ ID NO: 2)
  • First linker For instance GGGGSGGGGSGGGGS (SEQ ID NO: 3) or GCGASGGGGSGGGGS (SEQ ID NO: 4) beta 2 Microglobulin, for instance:
  • Second Linker for instance:
  • [Alpha] 1 & 2 domain derived either from human HLA-G or from any other MHO class I [alpha]1&2 domain suitable to present the selected antigenic peptide, Y84 may be C in DT variant or A e.g. [Alpha] 1 & 2 domain derived from human HLA-G: E.g.
  • Human HLA-A2 [alpha]1 & 2 domain E.g. GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAH SQTHRVDLGTLRGCYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAA QTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT (SEQ ID NO: 8)
  • Human HLA-G [alpha]3 domain (or any MHC lb [alpha]3 domain, such as HLA-F, which also interacts with ILT2 and ILT4 receptors), for instance:
  • a shorter form of a human HLA-G [alpha]3 domain may be used which lacks the optional C- terminal amino acid sequence from intron 4 (SKEGDGGIMSVRESRSLSEDL; SEQ ID NO: 20), i.e. :
  • IEGRTGTKLGP SEQ ID NO: 10.
  • Spacer sequence e.g. NSAVD (SEQ ID NO: 14) or GS
  • exemplary peptide antigens which can be part of the recombinant polypeptides of the invention are as follows:
  • VLISLCFGL (SEQ ID NO: 22), preferably in recombinant polypeptides containing HLA-G alphal and 2 domains
  • IIGAVLAGGL (SEQ ID NO: 24), preferably in recombinant polypeptides containing HLA-A2 alphal and 2 domains
  • a recombinant polypeptide of the invention (with the optional leader peptide):
  • sequence of the peptide antigen (here: KPLPVDMVL) of the above full length recombinant polypeptide can be substituted by any peptide antigen sequence in accordance with the invention, i.e. by any peptide antigen presented by said recombinant polypeptide, wherein the peptide antigen is a peptide of human aquaporin 4.
  • recombinant polypeptides of the invention may consist of a sequence consisting of a peptide antigen which is a peptide of human aquaporin 4 (e.g., any one of the peptide antigens of SEQ ID NOs: 2, 22, 23, and 24), followed by the sequence of
  • polypeptides of the invention may also contain the optional leader peptide as exemplified above.
  • the receptors ILT2 also known as LILRB1 and ILT4 (also known as LILRB2) are known in the art. Preferred sequences of these receptors in accordance with the invention are as follows:
  • PEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH SEQ ID NO: 18
  • the sequence of human aquaporin 4 is known in the art.
  • Preferred amino acid sequences of human aquaporin 4 are as follows:
  • Expi-293F cells (Thermo Fisher), grown in Expi-293TM expression medium (Thermo Fisher): transfection of 1 pig DNA into 2.5x10 6 cells/ml using the ExpifectamineTM 293 Transfection kit (Thermo Fisher) using Opti-MEM (Thermo Fisher) for complexation of DNA with Expifectamine, after 18-20 h, addition of enhancer according to the protocol, harvesting of the supernatant after 4-6 days (37°C, 8% CO2, humidified incubator), 19 mm 2 orbital shaker 125 rpm
  • Spot-tag protein purification equilibration of Spot-Cap resin: transfer of desired slurry amount into an appropriate tube, sediment beads by centrifugation (4°C, 4 min, 2500 g), remove & discard supernatant, add 10 bed volumes PBS (cold) to beads, invert to mix, sediment beads by centrifugation (4°C, 4 min, 2500 g), remove & discard supernatant, repeat 2 times
  • PBMC peripheral blood mononuclear cells
  • PBMCs were thawed 1 day prior to PBMC pulsing (d-1) and kept over night in 5 ml X-VIVO 15 medium containing 5% human AB serum in a well of a 6 well plate at 37°C.
  • X-VIVO 15 complete medium X-VIVO 15 medium + 2% human AB serum supplemented with cytokine cocktail: 10 ng/ml TGF-b1 , 10 ng/ml IL-4, 20 ng/ml IL-2, 20 ng/ml GM-CSF
  • ELISPOT plates were coated using anti-hlL10 (clone 9D-7, 1 :500 dilution in PBS, sterile filtered) and alL10 (10G8-biotin) and on day 14, 200,000 cells were seeded per well on the ELISPOT plates in duplicates, including negative controls (cells plus PBS) and a positive control (e.g. LPS).
  • anti-hlL10 clone 9D-7, 1 :500 dilution in PBS, sterile filtered
  • alL10 10G8-biotin
  • the PFDF membrane was activated with 50 pl/well EtOH (35% v/v) for 1 min followed by 5x washing with 200 pl distilled sterile water. Plate was coated with 100 pl/well antibody solution at 4°C over night. On the next day, unbound coating antibody was removed, 5 washing steps were performed with 200 pl PBS and 200 pl blocking buffer (X-VIVO 15 5% hAB serum) was added and the plate incubated for 30 min - 2 h at room temperature.
  • the respective antigenic peptide in DMSO or DMSO as a control were prepared, and a final amount of 5 pg peptide/ml was added to the final volume of 100 pl/well.
  • 150,000 cells were seeded per well in X-VIVO 15 medium with 5% human AB serum.
  • Blocking buffer (X VIVO 15 medum + 5% hAB serum) was carefully removed, and medium with PBS as negative control and stimulants (5 pg/ml total volume in each well) were added to the other wells and incubated at 37°C over night.
  • Secondary antibody was prepared: 1 pg/ml alL-10-biotinylated antibody in 0.5% BSA/1x PBS (1 :1000 dilution) and horseradish peroxidase-conjugated streptavidin (1 :750 in 0.5% BSA/PBS), tetramethylbenzidine solution was filtered using a 0.45 pm filter and stored at 4°C till use.
  • Capture antibodies anti-hlL10 (Clone: 9D-7, Mabtech #3430-3-250; 1 :500 dilution), anti-hlL10-biotinylated (Mabtech, #3430-6-250)
  • Blocking buffer X-vivo 5% hAB serum (sterile) [blocking is done in the same medium as cell culture]
  • Example 2 Surrogates of recombinant polypeptides of the invention induce IL10 secreting Treg in mice
  • Wild type black 6 mice were injected with 100
  • Gp34_KbG AVYNFATMGCGASGGGGSGGGGSIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKV EHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSGGGGSGGGGSGGGGS GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKG NEQSFRVDLRTLLGCYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAAL ITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDPPKTHVTHHPVFDYEATLRCWALGFYPAEII LTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVWPSGEEQRYTCHVQHEGLPEPLMLRWSKEGDGGIM SVRESRSLS
  • the Gp34 peptide is a well-characterized T cell epitope derived from Lymphocytic Choriomeningitis virus (LCMV) Glycoprotein. While this antigen was traditionally named Gp33, the epitope presented on H2-K b was later found to comprise just amino acids 34-41. (An epitope beginning at amino acid 33 is, in contrast, presented on H2-K d .) Therefore, we call the H2-K b epitope Gp34, which is in line with the most recent recommendations. Still, there is an ambiguous use of the Gp33 and Gp34 nomenclature in the literature. The first 8 amino acids of SEQ ID NO: 26 show the correct sequence. After 2 weeks, mice were sacrificed, and splenocytes re-challenged either with the matching or a mismatching peptide. IL-10 secreting cells were quantified by ELIspot. The results are shown in Figure 3.
  • Example 3 Surrogates of recombinant polypeptides of the invention selectively prevent CD8+ T-cell driven EAE in mice
  • Example 4 Some surrogates of recombinant polypeptides of the invention selectively prevent CD4 + T cell driven EAE in mice
  • MOG35-55 peptide/CFA Complete Freund's Adjuvance; final concentration Mycobacterium Tuberculosis H37RA and peptide each 1 mg/ml
  • emulsion were injected each left and right s.c. into the flank and 250ng pertussis toxin (in 200pl PBS) intraperitoneally. A second pertussis toxin injection was given 3 days later.
  • Mog-reactive antibodies in sera of AIM Bio (33 or 100pig) treated mice were detected via standard ELISA protocol, with 3 washes in between each step. Briefly, ELISA plates were coated with 10
  • Example 5 Human recombinant polypeptide candidates of the invention for NMO
  • the recombinant polypeptides of the invention are newly developed protein complexes derived from the pregnancy-associated immunosuppressive MHC molecule HLA-G. It is likely that HLA-G enables an embryo to influence the maternal immune system to tolerate embryonic antigens but further antagonize antigens from pathogens.
  • the recombinant polypeptides of the invention containing variable peptides were able to selectively eliminate peptide-specific cytotoxic effector T cells as well as induce peptide-specific regulatory T cells in the test tube.
  • Figure 8 shows a list of the human MS & MOGAD recombinant polypeptide candidates.
  • CD8 Treg were upregulated by at least 30% in 65% of of all healthy blood donors (Figure 9).
  • Example 6 Further proof-of-principle of stability and effects of the recombinant polypeptides of the invention.
  • the inventors set out to obtain and test recombinant polypeptidies having the general structure of the recombinant polypeptides of the invention but containing various different peptide antigens, in order to obtain further proof-of-principle that recombinant polypeptidies of the invention and surrogates thereof are stable and efficacious.
  • the tested recombinant polypeptidies are stable during freeze-thawing and storage and are thermally stable. Further, they induce Treg in a dosedependent manner (Figure 13) and inhibit T cell lysis in a dose-dependent manner ( Figure 14). Effects of the recombinant polypeptidies on the serum cyctokine profile in EAE-ODC Ova mice are shown in Figure 15.
  • IL-10 and possibly IL-4 both known to be immunosuppressive cytokines downregulating immune responses in inflammatory settings.
  • IL-2 seems to be induced in response to presenting the cells with a cognate peptide that is irrespective of the alpha3 domain.
  • IL-2 is needed for T cell activation and survival.
  • Example 7 Therapeutic effect of recombinant peptides, which comprise a murine aquaporin antigen peptide, in 2D2 TCR transgenic mice.
  • 2D2 TCR transgenic mice were divided into 4 cohorts. Each cohort consisted of at least 5 animals. WT (C57BL/6) littermate-matched mice were in the 5 th cohort. Experiment period started when the 2D2 mice spontaneously developed optic neuritis. Disease onset was determined either by optical abnormality or by elevated levels of anti-MOG IgG in serum.
  • mice were injected (i.v) with either one of treatment mouse-adapted single-chain MHC lb molecules AQP147_KbG (antigen peptide: VTTVHGNL; SEQ ID NO: 39) /AQP203_KbG (antigen peptide: FAINYTGASM; SEQ ID NO: 40) or with control AIM Bio Gp34_KbG.
  • Control mice received PBS only. Dose was set at 5mg/kg of body weight in 250pl. control or treatment injections were administered intravenously (DO). Untreated mice received PBS. The injections were repeated on D15 and D30. Mice were weighed daily and EAE symptoms were monitored (Table 1).
  • mice reaching an EAE score of 6 were sacrificed prior to completion of study period. All animals were sacrificed on D42 with CO2. Optic nerve, eyes, spinal cord, brain, serum, and lymph nodes were harvested and cryo-preserved in -20° C. Heart blood was collected and processed for serum analysis.
  • EAE was scored according to a 10 point scoring system (Bittner et al., Journal of visualized experiments: JoVE, (86), 51275)
  • Tissue sections were fixed with 4% PFA in PBS for 10 minutes; followed by blocking with buffer containing 5% BSA, 0.2% Triton-X100 and 5% NGS in 1X PBS for 2 hours at RT. Tissues were stained overnight at 4°C with either single or a suitable combination of primary antibodies in staining buffer containing 1% BSA, 1%NGS and 0.2% Triton-X100.
  • the primary antibodies are: I) rat anti- mouse CD3 (1 :200, Invitrogen); ii) rat anti-mouse CD8 (1 :200, Biorad); ill) rabbit anti-cleaved-caspase3 (1 :400, Cell signaling).
  • Sections were washed thrice with PBS and stained for 1h in dark at RT with corresponding fluorescently-labelled secondary antibodies: I) anti- rabbit-Cy3 (1:300, Dianova); ii) anti-rat-AF488 (1 :300, Invitrogen). Sections were washed with PBS and DNA was stained with DAPI (1 :500, Sigma-Aldrich) for 10 min at RT in dark. Sections were finally washed and mounted with aquapolymount (Polysciences). Optical sections were obtained using Zeiss Axiocam at 20X or 40X magnification.
  • Immunofluorescent images were quantified using ImageJ-Fiji Version 1.53t. 3-4 sections were analyzed for each animal. Images were split into individual channels and converted to 8-bit images. Threshold for 8-bit images of cleaved caspase-3 staining was set at 5 MFI and from DAPI staining was set at 100. Area covered by cleaved-caspase 3/Area covered by DAPI gives the percentage of cleaved caspase3 in a section.
  • treatment with AQP147_KbG conferred complete protection from EAE in treated mice ( Figure 20), inhibited immune cell infiltration in optic nerve (Figure 21) and completely inhibited apoptosis in optic nerve, spinal cord and retina (Figure 22). Further, while there were less CD8 T cells in AIM treated mice, there were few, but clearly more regulatory T cells in the optic nerve ( Figure 23). Additionally, AQP147_KbG completely rescued IRL (inner retinal layer) cells from degradation ( Figure 24).
  • the recombinant polypeptides of the invention can be used in the treatment of neuromyelitis optica in a human patient.
  • compositions, polypeptides, nucleic acids, cells, and products for use in the invention are industrially applicable. For example, they can be used in the manufacture of, or as, pharmaceutical products.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Epidemiology (AREA)
  • Rheumatology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2023/057684 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo Ceased WO2023180549A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
US18/849,075 US20250205322A1 (en) 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
EP23716418.1A EP4499231A1 (en) 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
KR1020247034451A KR20240164796A (ko) 2022-03-24 2023-03-24 새로운 NMO 치료제로서 MHC Ib-매개의 아쿠아포린 4(AQP4)-특이적인 면역억제
AU2023237632A AU2023237632A1 (en) 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
CN202380029744.3A CN119110810A (zh) 2022-03-24 2023-03-24 MHC Ib介导的水通道蛋白4(AQP4)特异性免疫抑制作为NMO的新型治疗方法
JP2024556458A JP2025510786A (ja) 2022-03-24 2023-03-24 視神経脊髄炎(NMO)の新規治療法としてのMHC Ibを介したアクアポリン4(AQP4)特異的免疫抑制
IL314754A IL314754A (en) 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
MX2024011666A MX2024011666A (es) 2022-03-24 2023-03-24 Inmunosupresion especifica de acuaporina 4 (aqp4) mediada por mhc ib como nuevo tratamiento para la nmo.
CA3250911A CA3250911A1 (en) 2022-03-24 2023-03-24 Specific immunosuppression of aquaporin 4 (AQP4) mediated by MHC IB as a novel treatment for NMO
CONC2024/0012332A CO2024012332A2 (es) 2022-03-24 2024-09-11 Inmunosupresión específica de acuaporina 4 (aqp4) mediada por mhc ib como nuevo tratamiento para la nmo

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP22164161.6A EP4249062A1 (en) 2022-03-24 2022-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
EP22164161.6 2022-03-24

Publications (1)

Publication Number Publication Date
WO2023180549A1 true WO2023180549A1 (en) 2023-09-28

Family

ID=81325683

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2023/057684 Ceased WO2023180549A1 (en) 2022-03-24 2023-03-24 Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo

Country Status (12)

Country Link
US (1) US20250205322A1 (https=)
EP (2) EP4249062A1 (https=)
JP (1) JP2025510786A (https=)
KR (1) KR20240164796A (https=)
CN (1) CN119110810A (https=)
AU (1) AU2023237632A1 (https=)
CA (1) CA3250911A1 (https=)
CL (1) CL2024002725A1 (https=)
CO (1) CO2024012332A2 (https=)
IL (1) IL314754A (https=)
MX (1) MX2024011666A (https=)
WO (1) WO2023180549A1 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025061917A1 (en) * 2023-09-22 2025-03-27 Julius-Maximilians-Universität Würzburg Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140199333A1 (en) * 2012-12-11 2014-07-17 The Regents Of The University Of California Aquaporin-4 Peptides, Compositions and Methods of Use
WO2018185564A2 (en) * 2017-04-07 2018-10-11 Uti Limited Partnership Assay to measure the potency of receptor-ligand interactions in nanomedicines
WO2018215340A1 (en) 2017-05-23 2018-11-29 Julius-Maximilians-Universität Würzburg Combinations of mhc class ib molecules and peptides for targeted therapeutic immunomodulation
WO2021184017A1 (en) * 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140199333A1 (en) * 2012-12-11 2014-07-17 The Regents Of The University Of California Aquaporin-4 Peptides, Compositions and Methods of Use
WO2018185564A2 (en) * 2017-04-07 2018-10-11 Uti Limited Partnership Assay to measure the potency of receptor-ligand interactions in nanomedicines
WO2018215340A1 (en) 2017-05-23 2018-11-29 Julius-Maximilians-Universität Würzburg Combinations of mhc class ib molecules and peptides for targeted therapeutic immunomodulation
WO2021184017A1 (en) * 2020-03-13 2021-09-16 Codiak Biosciences, Inc. Extracellular vesicles for treating neurological disorders

Non-Patent Citations (32)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 2000, WILLIAMS & WILKINS
ALTSCHUL ET AL.: "Basic local alignment search tool.", JOURNAL OF MOLECULAR BIOLOGY, vol. 215, 1990, pages 403 - 410, XP002949123, DOI: 10.1006/jmbi.1990.9999
ALTSCHUL ET AL.: "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402, XP002905950, DOI: 10.1093/nar/25.17.3389
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, GREENE PUBLISHING ASSOCIATES
BITTNER ET AL., J VIS EXP, no. 86, 15 April 2014 (2014-04-15), pages 51275
BITTNER ET AL., JOURNAL OF VISUALIZED EXPERIMENTS: JOVE, no. 86, pages 51275
CLEMENTS ET AL., PROC NATL ACAD SCI USA, vol. 102, no. 9, 1 March 2005 (2005-03-01), pages 3360 - 5
DESAIKULKARNI-KALE: "T-cell epitope prediction methods: an overview", METHODS MOL BIOL, vol. 1184, 2014, pages 333 - 64
DIEHL ET AL., CURR BIOL, vol. 6, no. 3, 1 March 1996 (1996-03-01), pages 305 - 14
HANSEN ET AL., TRENDS IMMUNOL, vol. 31, no. 10, October 2010 (2010-10-01), pages 363 - 9
HARLOWLANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS
JUMPER ET AL.: "Highly accurate protein structure prediction with AlphaFold", NATURE, vol. 596, 2021, pages 583 - 589, XP055888904, DOI: 10.1038/s41586-021-03819-2
JUNFENG LIUDACAN CHENGOLAY D. NIEZHENHUA DAI: "CD8+CD122+ T-Cells: A Newly Emerging Regulator with Central Memory Cell Phenotypes", FRONT. IMMUNOL
KARIKARI ET AL., BRAIN BEHAV IMMUN, vol. 101, 12 January 2022 (2022-01-12), pages 194 - 210
LEE ET AL., IMMUNITY, vol. 3, no. 5, November 1995 (1995-11-01), pages 591 - 600
LENNON, V. A.KΗZER, T. J.PITTOCK, S. J.VERKMAN, A. S.HINSON, S. R: "IgG marker of optic-spinal multiple sclerosis binds to the aquaporin-4 water channel", J. EXP. MED., vol. 202, 2005, pages 473 - 477, XP055031683, DOI: 10.1084/jem.20050304
NA ET AL., BRAIN, vol. 131, September 2008 (2008-09-01), pages 2353 - 2365
NEEFJES ET AL., NAT REV IMMUNOL, vol. 11, no. 12, 11 November 2011 (2011-11-11), pages 823 - 36
NIEDERLOVA, V.TSYKLAURI, 0.CHADIMOVA, TSTEPANEK, O.: "CD8+Tregs revisited: A heterogeneous population with different phenotypes and properties", EUR. J. IMMUNOL., vol. 51, 2021, pages 512 - 530, Retrieved from the Internet <URL:https://doi.org/10.1002/eji.202048614>
NIELSEN ET AL., PROTEIN SCI, vol. 12, 2003, pages 1007 - 1017
PEARSON ET AL.: "MHC class I-associated peptides derive from selective regions of the human genome", J CLIN INVEST, vol. 126, no. 12, 1 December 2016 (2016-12-01), pages 4690 - 4701
PEARSON ET AL.: "MHC class I-associated peptides derive from selective regions of the human genome", J CLIN INVEST., vol. 126, no. 12, 1 December 2016 (2016-12-01), pages 4690 - 4701
RAMMENSEE ET AL.: "SYFPEITHI: database for MHC ligands and peptide motifs", IMMUNOGENETICS, vol. 50, 1999, pages 213 - 219, XP002254433, DOI: 10.1007/s002510050595
RAMMENSEE, BACHMANN, EMMERICH, BACHOR, STEVANOVIC.: "SYFPEITHI: database for MHC ligands and peptide motifs", IMMUNOGENETICS, vol. 50, November 1999 (1999-11-01), pages 213 - 9, XP002254433, DOI: 10.1007/s002510050595
ROCKREITSNEEFJES: "Present Yourself! By MHC Class I and MHC Class II Molecules", TRENDS IMMUNOL, vol. 37, no. 11, November 2016 (2016-11-01), pages 724 - 737
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SHI ZOKUNO YRIFA'I MENDHARTI ATAKANE KISOBE K ET AL.: "Human CD8+CXCR3+T cells have the same function as murine CD8+CD122+ Treg", EURJIMMUNOL, vol. 39, 2009, pages 2106 - 2119, XP071223857, DOI: 10.1002/eji.200939314
SHIROISHI ET AL., PROC NATL ACAD SCI USA., vol. 100, no. 15, 22 July 2003 (2003-07-22), pages 8856 - 8861
SHIROISHI ET AL., PROC NATL ACAD SCI USA., vol. 103, no. 44, 31 October 2006 (2006-10-31), pages 16412 - 7
TIGNO-ARANJUEZ ET AL., J IMMUNOL, vol. 183, no. 9, 1 November 2009 (2009-11-01), pages 5654 - 5661
WATERS, P.PETTINGILL, PLANG, B.: "Detection methods for neural autoantibodies", HANDB. CLIN. NEUROL., vol. 133, 2016, pages 147 - 163
ZUBIZARRETA IRATI ET AL: "Immune tolerance in multiple sclerosis and neuromyelitis optica with peptide-loaded tolerogenic dendritic cells in a phase 1b trial", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 116, no. 17, 23 April 2019 (2019-04-23), pages 8463 - 8470, XP093058248, ISSN: 0027-8424, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6486735/pdf/pnas.201820039.pdf> DOI: 10.1073/pnas.1820039116 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025061917A1 (en) * 2023-09-22 2025-03-27 Julius-Maximilians-Universität Würzburg Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo

Also Published As

Publication number Publication date
CA3250911A1 (en) 2023-09-28
EP4499231A1 (en) 2025-02-05
EP4249062A1 (en) 2023-09-27
AU2023237632A1 (en) 2024-08-15
CO2024012332A2 (es) 2024-09-30
MX2024011666A (es) 2024-09-27
CN119110810A (zh) 2024-12-10
JP2025510786A (ja) 2025-04-15
US20250205322A1 (en) 2025-06-26
KR20240164796A (ko) 2024-11-20
IL314754A (en) 2024-10-01
CL2024002725A1 (es) 2025-02-14

Similar Documents

Publication Publication Date Title
US20250205322A1 (en) Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
JP2026065089A (ja) Dcaf4l2特異的t細胞受容体
US20250222083A1 (en) Mhc ib-mediated myelin-specific immunosuppression as a novel treatment for multiple sclerosis and mog antibody disease
CA2897655C (en) Antigen processing-independent epitopes (apitopes) of myelin oligodendrocyte glycoprotein
AU2024346292A1 (en) Mhc ib-mediated aquaporin 4 (aqp4)-specific immunosuppression as a novel treatment for nmo
US20250205323A1 (en) Mhc ib-mediated islet-antigen-specific immunosuppression as a novel treatment for type 1 diabetes
AU2024347130A1 (en) Mhc ib-mediated myelin-specific immunosuppression as a novel treatment for multiple sclerosis and mog antibody disease
CN114466860A (zh) 用于1型糖尿病的胰岛素原肽
WO2025061918A1 (en) Mhc 1b-mediated alpha-synuclein-specific tolerance induction as a novel treatment for parkinson&#39;s disease
AU2024257340A1 (en) Rcn1-derived teipp neoantigens and uses thereof
HK1211596B (en) Peptide

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23716418

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 202417059640

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2023237632

Country of ref document: AU

Date of ref document: 20230324

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024017595

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: NC2024/0012332

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 2024556458

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/011666

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 202380029744.3

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: NC2024/0012332

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 20247034451

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020247034451

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2023716418

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 11202406066R

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2023716418

Country of ref document: EP

Effective date: 20241024

ENP Entry into the national phase

Ref document number: 112024017595

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240827

WWP Wipo information: published in national office

Ref document number: 18849075

Country of ref document: US