WO2023175123A1 - Shc enzymes and enzyme variants - Google Patents
Shc enzymes and enzyme variants Download PDFInfo
- Publication number
- WO2023175123A1 WO2023175123A1 PCT/EP2023/056842 EP2023056842W WO2023175123A1 WO 2023175123 A1 WO2023175123 A1 WO 2023175123A1 EP 2023056842 W EP2023056842 W EP 2023056842W WO 2023175123 A1 WO2023175123 A1 WO 2023175123A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- shc
- amino acid
- acid sequence
- hac
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/90—Isomerases (5.)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/49—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds
- A61K8/4973—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds containing heterocyclic compounds with oxygen as the only hetero atom
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q13/00—Formulations or additives for perfume preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11B—PRODUCING, e.g. BY PRESSING RAW MATERIALS OR BY EXTRACTION FROM WASTE MATERIALS, REFINING OR PRESERVING FATS, FATTY SUBSTANCES, e.g. LANOLIN, FATTY OILS OR WAXES; ESSENTIAL OILS; PERFUMES
- C11B9/00—Essential oils; Perfumes
- C11B9/0069—Heterocyclic compounds
- C11B9/0073—Heterocyclic compounds containing only O or S as heteroatoms
- C11B9/0076—Heterocyclic compounds containing only O or S as heteroatoms the hetero rings containing less than six atoms
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/50—Perfumes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1025—Acyltransferases (2.3)
- C12N9/1029—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P17/00—Preparation of heterocyclic carbon compounds with only O, N, S, Se or Te as ring hetero atoms
- C12P17/02—Oxygen as only ring hetero atoms
- C12P17/04—Oxygen as only ring hetero atoms containing a five-membered hetero ring, e.g. griseofulvin, vitamin C
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y504/00—Intramolecular transferases (5.4)
- C12Y504/99—Intramolecular transferases (5.4) transferring other groups (5.4.99)
- C12Y504/99017—Squalene--hopene cyclase (5.4.99.17)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2800/00—Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
- A61K2800/10—General cosmetic use
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y203/00—Acyltransferases (2.3)
- C12Y203/01—Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
- C12Y203/01048—Histone acetyltransferase (2.3.1.48)
Definitions
- the present invention relates generally to SHC/HAC enzymes and variants thereof.
- the present invention further relates to the various uses of the SHC/HAC enzymes and variants thereof, for example to enzymatically convert (3E,7E)-homofarnesol (EEH) to (-)-Ambrox or to enzymatically convert E,E-bishomofarnesol (BisEEH) to Ambra oxide and the like.
- the present invention also relates to the products of the enzymatic reactions, for example the (-)-Ambrox or Ambra oxide made using the SHC/HAC enzymes and variants thereof, and the various uses of said products.
- SHCs Squalene Hopene Cyclases
- a process for preparing (-)-Ambrox or a mixture comprising (-)- Ambrox comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)- Ambrox using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53,
- a process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)- Ambrox using a SHC/HAC enzyme variant,wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 13, 15, 23, 32, and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1.
- a process for preparing Ambra oxide or a mixture comprising Ambra oxide comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83,
- a process for preparing Ambra oxide or a mixture comprising Ambra oxide comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 13, 15, 23, 32, and wherein the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme corresponding to W169, A306 and/or G600 of SEQ ID NO: 1.
- a process wherein: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374,
- a process wherein: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G,
- a process wherein: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and - the G at position 600 of SEQ ID NO:1, 2, 3,13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or
- a process wherein: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383
- a process wherein: the amino acid at position 168 of SEQ ID NO:1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100,
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 7, 8, 9 or 386 and has the following mutations: M132R, A224V, I432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 10, 11,12 or 385 and has the following mutations: M132R, A224V, I432T and has at least one of the following mutations: W169G, A306V and G600M.
- a process wherein the W at position 169 is replaced by G. In an embodiment, there is provided a process wherein: the W at position 169 is replaced by G, and the A at position is replaced by V. In an embodiment, there is provided a process wherein: the W at position 169 is replaced by G, and the G at position 600 is replaced by M. In an embodiment, there is provided a process wherein: the W at position 169 is replaced by G, the A at position 306 is replaced by V, and the G at position 600 is replaced by M.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has at least one of the following mutations: W172G, A311V and G609M (Tel SHC/HAC variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 32, 311, 357, or 358 and has the following mutations: W196G, A335V and G629M (Sco SHC/HAC variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has at least one of the following mutations: W222G, A368V and G667M (Zmo SHC1 variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has a W172G mutation. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G and A311V mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G and G609M mutations.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has W172G, A311V and G609M mutations.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 32, 311, 357, or 358 and has a W196G mutation.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G and G629M mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 32, 311, 357, or 358 and has W196G, A335V and G629M mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has W222G mutation.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has W222G and A368V mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has W222G and G667M mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has W222G, A368V and G667M mutations.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G mutation. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G and A321V mutations. In an embodiment, there is provided a process wherein: the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G and G619M mutation.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 15, 313, 355 or 356 and has W177G, A321V and G619M mutations.
- the SHC/AHC enzyme variant has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11,12, 305, 306, 304, 302, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351, or 352.
- the SHC/HAC enzyme variant disclosed herein exhibits: - an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis- homofarnesol substrates are used, - an increased product selectivity for (-)-Ambrox (or Ambra oxide) when homofarnesol or bis- homofarnesol substrates are used, - an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the like – see, for example WO2021/110858 and WO2021/209482 respectively), - an increased productivity and/or - an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of
- wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131,
- the process comprises culturing a recombinant host cell that produces the SHC/HAC enzyme variant.
- the recombinant host cells comprise a nucleic acid sequence selected from SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45 or 46.
- the mixture of isomers of homofarnesol comprising EEH is an EE:EZ isomer mixture, preferably wherein the EE: EZ isomer mixture is in a weight ratio of 80:20.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 0.4 and the concentration of EEH is 450 g/l.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 1 and the concentration of EEH is 250 g/l.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 1 and the concentration of EEH is 300 g/l.
- a SHC/HAC enzyme variant as defined herein there is provided a (-)-Ambrox obtained by or obtainable by the process as defined herein, in a solid form in an amorphous or crystalline form.
- (-)-Ambrox as obtained herein as part of a fragrance or a cosmetic or a consumer product such as fabric care, toiletry, beauty care, a cleaning product, a detergent product, and/or a soap product.
- a fragrance or a cosmetic or a consumer product comprising (-)-Ambrox as obtained herein.
- a nucleic acid sequence encoding the SHC/HAC enzyme variant as defined herein.
- a construct comprising the nucleic acid sequence as defined herein.
- a recombinant host cell comprising the nucleic acid sequence or the construct as defined herein.
- FIGURES Figure 1: EEH conversion with AacSHC and 215G2SHC P1, P2, and P3 variants. Reactions were run with 8 g/l EEH (AacSHC wt 4 g/l EEH only), cells to an OD650nm of 10 applying individually optimized reaction conditions (T, pH, SDS).
- Figure 2 shows the reaction products of Homofarnesol SHC-catalyzed cyclization using a mix- ture of E,E- and E,Z-Homofarnesol isomers.
- Figure 3 Substrate specificity and product selectivity with P1, P2, and P3 SHC variants.
- Reactions were run with 8 g/l EEH, cells to an OD650nm of 10 applying individually optimized reaction conditions (T, pH, SDS).
- Figure 4 Homofarnesol cyclization with SHC variants. Reactions were run with 125 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.
- Figure 5 Homofarnesol bioconversions with SHC variants. Reactions were run with 125 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.
- Figure 6 Substrate specificity and product selectivity in Homofarnesol bioconversions with SHC enzyme variants. Reactions were run with 125 g/l E,E-Homofarnesol and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the SHC enzymes.
- Figure 7 Homofarnesol bioconversions with SHC variants. Reactions were run with 250 g/l EEH and 250 g/l cells, at T, pH and SDS (SDS:cells ratio) conditions defined as optimal for each of the variants.
- Figure 8 Homofarnesol bioconversions with SHC variants.
- SEQ ID NO: 1 is the wild-type Alicyclobacillus acidocaldarius (Aac) SHC amino acid sequence.
- SEQ ID NO: 2 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, A557T and R613S and may be referred to as SHC/HAC enzyme variant #65 or SHC#65 variant herein.
- SEQ ID NO: 3 may be referred to as 215G2 SHC (or 215G2 SHC variant) and corresponds to the wild-type AacSHC amino acid sequence with the mutations M132R, A224V and I432T.
- SEQ ID NO: 4 corresponds to SEQ ID NO: 1 with the substitution W169G (also called the Aac SHC P1).
- SEQ ID NO:5 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600M (also called the Aac SHC P2).
- SEQ ID NO:6 corresponds to SEQ ID NO: 1 with the substitutions W169G, A306V and G600M (also called the Aac SHC P3).
- SEQ ID NO: 7 corresponds to SEQ ID NO: 2 with the substitution W169G (also called the SHC#65 P1 variant).
- SEQ ID NO:8 corresponds to SEQ ID NO: 2 with the substitutions W169G and G600M (also called the SHC#65 P2 variant).
- SEQ ID NO:9 corresponds to SEQ ID NO: 2 with the substitutions W169G, A306V and G600M (also called the SHC#65 P3 variant).
- SEQ ID NO: 10 corresponds to SEQ ID NO: 3 with the substitution W169G (also called the 215G2 SHC P1 variant).
- SEQ ID NO:11 corresponds to SEQ ID NO: 3 with the substitutions W169G and G600M (also called the 215G2 SHC P2 variant).
- SEQ ID NO:12 corresponds to SEQ ID NO: 3 with the substitutions W169G, A306V and G600M (also called the 215G2 SHC P3 variant).
- SEQ ID NO:13 is identical with SEQ ID NO: 384.
- SEQ ID NO: 35 is the nucleotide sequence encoding the wild-type AacSHC.
- SEQ ID NO: 36 is the nucleotide sequence encoding the polypeptide of SEQ ID NO: 2 (SHC#65 variant).
- SEQ ID NO: 37 is the nucleotide sequence encoding the 215G2 variant (SEQ ID NO:3).
- SEQ ID NO: 38 is the nucleotide sequence encoding the AacSHC P1 represented by SEQ ID NO:4.
- SEQ ID NO: 39 is the nucleotide sequence encoding the AacSHC P2 represented by SEQ ID NO:5.
- SEQ ID NO: 40 is the nucleotide sequence encoding the AacSHC P3 represented by SEQ ID NO:6.
- SEQ ID NO: 41 is the nucleotide sequence encoding the SHC#65 P1 variant represented by SEQ ID NO:7.
- SEQ ID NO: 42 is the nucleotide sequence encoding the SHC#65 P2 variant represented by SEQ ID NO:8.
- SEQ ID NO: 43 is the nucleotide sequence encoding the SHC#65 P3 variant represented by SEQ ID NO:9.
- SEQ ID NO: 44 is the nucleotide sequence encoding the 215G2 P1 variant represented by SEQ ID NO:10
- SEQ ID NO: 45 is the nucleotide sequence encoding the 215G2 P2 variant represented by SEQ ID NO:11
- SEQ ID NO: 46 is the nucleotide sequence encoding the 215G2 P3 variant represented by SEQ ID NO:12
- SEQ ID NO: 47 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, Y81H, A557T and R613S and may be referred to as SHC/HAC enzyme variant #66 herein.
- SEQ ID NO: 48 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, Y81H, H431L and A557T and may be referred to as SHC/HAC enzyme variant #110B8 herein.
- SEQ ID NO: 49 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, T90A and R613S and may be referred to as SHC/HAC enzyme variant #90C7 herein.
- SEQ ID NO: 50 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, A172T and M277K and may be referred to as SHC/HAC enzyme variant #115A7 herein.
- SEQ ID NO: 51 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ I DNO:3) with the additional mutation L37Q.
- SEQ ID NO: 52 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ I DNO:3) with the additional mutation V174I.
- SEQ ID NO: 53 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ I DNO:3) with the additional mutations V174I and F601Y.
- SEQ ID NO: 54 is the amino acid sequence of the SHC/HAC variant 215G2 SHC (represented by SEQ I DNO:3) with the additional mutations L37Q, V174I and F601Y.
- SEQ ID NO: 55-296, 307-310 are wild type amino acid sequence of SHC/HAC as identified in table 2 or 16.
- SEQ ID NO: 297-300 are nucleotide sequences encoding SEQ ID NO:47-50.
- SEQ ID NO: 301 is the amino acid sequence of an GmoSHC variant with V45L, Q54E, M184I, T326S, F624Y.
- SEQ ID NO: 302 is the amino acid sequence of TelSHC with W172G, P311V, F425Y, G609A mutations.
- SEQ ID NO: 303 is the amino acid sequence of ZmoSHC1 with Q221S, W222G, A368V, F486Y, G667A mutations.
- SEQ ID NO: 304 is the amino acid sequence of TelSHC with W172G mutation (P1).
- SEQ ID NO: 305 is the amino acid sequence of AacSHC with W169G, G600M, M132R, A224V and I432T mutations.
- SEQ ID NO: 306 is the amino acid sequence of AacSHC with W169G, G600M, M132R and I432T mutations.
- SEQ ID NO: 307-310 (together with SEQ ID NO: 55-296) are wild type amino acid sequence of SHC/HAC as identified in table 2 or 16.
- SEQ ID NO: 311 is the amino acid sequence of ScoSHC1 with W196G mutation (P1)
- SEQ ID NO: 312 is the amino acid sequence of ZmoSHC1 with W222G mutation
- SEQ ID NO: 313 is the amino acid sequence of ZmoSHC2 with W177G mutation
- SEQ ID NO:314 is the motif DXDDTA found in SHC/HAC.
- SEQ ID NO: 315-360 are amino acid sequences of SHC variants, especially SEQ ID NO: 315- 347, 348, 350-352 (except 349) are SHC variants derived from the AaC SHC (SEQ ID NO:1).
- SEQ ID No.315 corresponds to SEQ ID NO: 1 with the substitution W169G.
- SEQ ID No.316 corresponds to SEQ ID NO: 1 with the substitution W169A.
- SEQ ID No.317 corresponds to SEQ ID NO: 1 with the substitution W169V.
- SEQ ID No.318 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600A.
- SEQ ID No.319 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600V.
- SEQ ID No.320 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600L.
- SEQ ID No.321 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600I.
- SEQ ID No.322 corresponds to SEQ ID NO: 1 with the substitutions W169G and G600M.
- SEQ ID No.323 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600A.
- SEQ ID No.324 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600V.
- SEQ ID No.325 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600L.
- SEQ ID No.326 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600I.
- SEQ ID No.327 corresponds to SEQ ID NO: 1 with the substitutions W169A and G600M.
- SEQ ID No.328 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600A.
- SEQ ID No.329 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600V.
- SEQ ID No.330 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600L.
- SEQ ID No.331 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600I.
- SEQ ID No.332 corresponds to SEQ ID NO: 1 with the substitutions W169V and G600M.
- SEQ ID No.333 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600A and A306V.
- SEQ ID No.334 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600V and A306V.
- SEQ ID No.335 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600L and A306V.
- SEQ ID No.336 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600I and A306V.
- SEQ ID No.337 corresponds to SEQ ID NO: 1 with the substitutions W169G, G600M and A306V.
- SEQ ID No.338 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600A and A306V.
- SEQ ID No.339 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600V and A306V.
- SEQ ID No.340 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600L and A306V.
- SEQ ID No.341 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600I and A306V.
- SEQ ID No.342 corresponds to SEQ ID NO: 1 with the substitutions W169A, G600M and A306V.
- SEQ ID No.343 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600A and A306V.
- SEQ ID No.344 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600V and A306V.
- SEQ ID No.345 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600L and A306V.
- SEQ ID No.346 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600I and A306V.
- SEQ ID No.347 corresponds to SEQ ID NO: 1 with the substitutions W169V, G600M and A306V.
- SEQ ID No.348 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V and I432T.
- SEQ ID NO:349 is a nucleotide sequence coding for a SHC variant derived from AacSHC.
- SEQ ID No.350 corresponds to SEQ ID NO: 1 with the substitutions W169G and A306V.
- SEQ ID No.351 corresponds to SEQ ID NO: 1 with the substitutions W169A and A306V.
- SEQ ID No.352 corresponds to SEQ ID NO: 1 with the substitutions W169V and A306V.
- SEQ ID NO:353 corresponds to SEQ ID NO: 13 with the substitutions W222G and G667M (also called the ZmoSHC1 P2 variant).
- SEQ ID NO:354 corresponds to SEQ ID NO: 13 with the substitutions W222G, A368V and G667M (also called the ZmoSHC1 P3 variant).
- SEQ ID NO:355 corresponds to SEQ ID NO: 15 with the substitutions W177G and G619M (also called the ZmoSHC2 P2 variant).
- SEQ ID NO:356 corresponds to SEQ ID NO: 15 with the substitutions W177G, A321V and G619M (also called the ZmoSHC2 P3 variant).
- SEQ ID NO:357 corresponds to SEQ ID NO: 32 with the substitutions W196G and G629M (also called the ScoSHC P2 variant).
- SEQ ID NO:358 corresponds to SEQ ID NO: 32 with the substitutions W196G, A335V and G629M (also called the ScoSHC P3 variant).
- SEQ ID NO:359 corresponds to SEQ ID NO: 23 with the substitutions W172G and G609M (also called the TelSHC P2 variant).
- SEQ ID NO:360 corresponds to SEQ ID NO: 23 with the substitutions W172G, A311V and G609M (also called the TelSHC P3 variant).
- SEQ ID NO: 361-383 are amino acid sequences of SHC variants derived from Aac SHC (SEQ ID NO:1) as identified in Table 18.
- SEQ ID No.361 corresponds to SEQ ID NO: 1 with the substitution T77A.
- SEQ ID No.362 corresponds to SEQ ID NO: 1 with the substitution I92V.
- SEQ ID No.363 corresponds to SEQ ID NO: 1 with the substitution F129L.
- SEQ ID No.364 corresponds to SEQ ID NO: 1 with the substitution M132R.
- SEQ ID No.365 corresponds to SEQ ID NO: 1 with the substitution A224V.
- SEQ ID No.366 corresponds to SEQ ID NO: 1 with the substitution I432T.
- SEQ ID No.367 corresponds to SEQ ID NO: 1 with the substitution Q579H.
- SEQ ID No.368 corresponds to SEQ ID NO: 1 with the substitution F601Y.
- SEQ ID No.369 corresponds to SEQ ID NO: 1 with the substitutions M132R and I432T.
- SEQ ID No.370 corresponds to SEQ ID NO: 1 with the substitution F601Y.
- SEQ ID No.371 corresponds to SEQ ID NO: 1 with the substitutions T77A, I92V and F129L.
- SEQ ID No.372 corresponds to SEQ ID NO: 1 with the substitutions Q579H and F601Y.
- SEQ ID No.373 corresponds to SEQ ID NO: 1 with the substitutions F129L.
- SEQ ID No.374 corresponds to SEQ ID NO: 1 with the substitutions F129L and F601Y.
- SEQ ID No.375 corresponds to SEQ ID NO: 1 with the substitutions F129L, M132R and I432T.
- SEQ ID No.376 corresponds to SEQ ID NO: 1 with the substitutions M132R, I432T and F601Y.
- SEQ ID No.377 corresponds to SEQ ID NO: 1 with the substitutions F129L, M132R, I432T, and F601Y.
- SEQ ID No.378 corresponds to SEQ ID NO: 1 with the substitution F605W.
- SEQ ID No. 379 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, A557T and H431L, and may be referred to as SHC/HAC enzyme variant #49 or SHC#49 variant herein.
- SEQ ID No. 381 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, Y81H, A557T and R613S and may be referred to as SHC/HAC enzyme variant #66 or SHC#66 variant herein.
- SEQ ID No. 381 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, Y81H, H431L and A557T, and may be referred to as SHC/HAC enzyme variant #110B8 or SHC#110B8 variant herein.
- SEQ ID No.382 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, T90A and R613S, and may be referred to as SHC/HAC enzyme variant #90C7 or SHC#90C7variant herein.
- SEQ ID No. 383 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, A172T and M277K, and may be referred to as SHC/HAC enzyme variant #115A7or SHC#115A7 variant herein.
- SEQ ID No.385 corresponds to SEQ ID NO: 3 with the substitutions W169G and A306V.
- SHC enzyme means a wild-type (WT) Squalene Hopene Cyclase enzyme that is naturally occurring in, for example, a thermophilic bacterium such as Alicyclobacillus acidocaldarius (Aac). SHCs that act in the cyclisation of homofarnesol to Ambrox may also be referred to as Homofarnesol Ambrox Cyclase (HAC) enzymes. Therefore, the term “SHC/HAC enzyme” may be used herein.
- the term "variant" is to be understood as a polypeptide which differs in comparison to the polypeptide from which it is derived by one or more changes or alteration in the amino acid sequence.
- the polypeptide from which a variant is derived is also known as the parent or reference polypeptide.
- a variant is constructed artificially, preferably by gene- technological means.
- the polypeptide from which the variant is derived is a wild-type protein or wild-type protein domain.
- the variants usable in the present disclosure may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variants, provided that the variant exhibits at least one biological activity of the parent polypeptide.
- SHC/HAC enzyme variant means an enzyme that is derived from a wild-type SHC enzyme (such as Aac SHC enzyme, represented by SEQ ID NO:1) but has one or more amino acid alterations compared to the wild-type SHC enzyme and is therefore not naturally occurring in a prokaryote.
- Table 2 gives a list of wild-type SHC that may be used in the present invention to generate a SHC/HAC enzyme variant.
- Tables 3 and 16 give a list of preferred wild type SHC to be used in the present invention to generate a SHC/HAC enzyme variant.
- Table 3 lists the following SHC/AHC enzymes: AaC SHC represented by SEQ ID NO:1, ZmoSHC1 represented by SEQ ID NO:13 or 384, ZmoSCH2 represented by SEQ ID NO:15, BjpSHC represented by SEQ ID NO:16, Burkhoderia ambifaria SHC represented by SEQ ID NO:17 or 18, Bacillus anthracis SHC represented by SEQ ID NO:19, Frankia alni SHC represented by SEQ ID NO:20, Rhodopseudomonas palustris SHC represented by SEQ ID NO:21, GmoSCO SHC represented by SEQ ID NO:22, Tel SHC represented by SEQ ID NO:23, ApaSHC1 represented by SEQ ID NO:24, BmeSHC represented by SEQ ID NO:25 , SalSHC represented by SEQ ID NO:26
- More preferred wild type SHC to be used in the present invention to generate a SHC/HAC enzyme variant are: AaC SHC represented by SEQ ID NO:1, ZmoSHC1 represented by SEQ ID NO:13, ZmoSCH2 represented by SEQ ID NO:15, Tel SHC represented by SEQ ID NO:23 and ScoSHC represented by SEQ ID NO:32.
- the one or more amino acid alterations may, for example, modify (e.g. increase) the enzymatic activity for a substrate (e.g. EEH).
- a SHC/HAC enzyme variant may be derived from a SHC/HAC variant.
- SHC/HAC variants include SEQ ID NO:2, 3, 4748, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.
- Assays for determining and quantifying SHC/HAC enzyme and/or SHC/HAC enzyme variant activity are described herein and are known in the art.
- SHC/HAC enzyme and/or SHC/HAC enzyme variant activity can be determined by incubating purified SHC/HAC enzyme or enzyme variant or extracts from host cells or a complete recombinant host organism that has produced the SHC/HAC enzyme or enzyme variant with an appropriate substrate under appropriate conditions and carrying out an analysis of the reaction products (e.g. by gas chromatography (GC) or HPLC analysis). Further details on SHC/HAC enzyme and/or SHC/HAC enzyme variant activity assays and analysis of the reaction products are provided in the Examples. These assays include producing the SHC/HAC enzyme variant in recombinant host cells (e.g. E. coli).
- recombinant host cells e.g. E. coli
- the term "activity" means the ability of an enzyme to react with a substrate to provide a desired product. The activity can be determined in what is known as an activity test for monitoring the formation of the desired product.
- the SHC/HAC enzyme derivatives of the present disclosure may be characterized by their ability to cyclize homofamesol (e.g. EEH) into (-)-Ambrox and demonstrate a biological activity such as an HAC activity.
- the SHC/HAC enzyme derivatives of the present disclosure may be characterized by their ability to cyclize bishomofamesol (e.g. E,E-Bishomofarnesol) into Ambra oxide.
- an activity or a biological activity of a SHC/HAC variant is compared with the corresponding activity or biological activity of the wild type, parent, reference SHC/HAC it derives from and under the same conditions.
- Examples of wild type SHC/HAC enzymes have been identified in table 2, 3 or 16.
- wild type SHC/HAC enzymes are those represented by SEQ ID NO:1 or by any of SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125,
- Examples of parent or reference SHC/HAC enzyme used to create the SHC/HAC variant of the invention may be represented by any of SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383.
- a variant is regarded as a variant within the context of the present application, if it exhibits the relevant activity to a degree of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150% or at least 200% of the activity of the parent polypeptide.
- a variant is regarded as a variant within the context of the present application, if it exhibits the relevant biological activity to a degree of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150% or at least 200% of the activity of the parent polypeptide (as the terms derivative and variant are used interchangeably throughout the present disclosure).
- the SHC/HAC enzyme variants described herein show a better yield (i.e. increased yield) compared to the yield obtained using a reference SHC enzyme (e.g.
- yield refers to the gram of recoverable product (i.e. (-)-Ambrox or Ambra oxide) per gram of feedstock (which can be calculated as a percent molar conversion rate).
- “increase” may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the yield obtained using a reference SHC enzyme.
- “selectivity” refers to “product selectivity” and describes the ability to produce a particular compound (eg (-)-Ambrox or Ambra oxide) in an enzymatically catalyzed method as described in a substantially enriched/predominant form (“product selectivity”) from a mixture of several substrate isomers.
- the mixture of homofarnesol substrate isomers is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- “selectivity” refers to “product selectivity” and describes the ability to produce a particular compound (eg (-)-Ambrox, i.e. compound (I)) in an enzymatically catalyzed method as described in a substantially enriched/predominant form (“product selectivity”) from a EEH:EZH mixture with a ratio of 80:20 or 90:10.
- substantially enriched/predominant form may mean that the total products formed as a result of the cyclisation reaction of the enzyme variant of WT SHC may, for example, consist essentially of or consist of: - compound of formula (I) ((-)-Ambrox) described herein when using any of the homofarnesol substrate isomer mixture identified above (preferably EEH:EZH, more preferably with a ratio of 80:20 or 90:10) or - compounds of formula (I) ((-)-Ambrox) and formula (III) described herein when using any of the homofarnesol substrate isomer mixture identified above (preferably EEH:EZH, more preferably with a ratio of 80:20 or 90:10).
- compounds of formula (II) and (IV) may not detectable at the end of the process or during the first 3, 4, 5 or 6 or 12 or 18 hours of the process.
- the detection of compounds of formula (I), (II), (III) and (IV) may be done using techniques known to the skilled person, preferably those used in the experimental part. It also means that in the absence of any downstream processing steps, only the compound of formula (I) or only the compounds of formula (I) and (III) are produced.
- DSP down stream processing
- DSP down stream processing
- a downstream processing step means a separation of solid (-)-Ambrox from unreacted homofarnesol substrate as well as a separation of (-)-Ambrox from other by-products (eg compounds II and/or III and/ir IV).
- DSP steps may include but are not limited to one or more of a centrifugation, a filtration, a steam or organic solvent extraction or distillation, or a selective crystallization step.
- a distillation step may be more efficient at separating (-)-Ambrox from unreacted homofarnesol than separating (-)- Ambrox from the by-products produced.
- Each of these downstream processing steps have been later defined herein. Exemplary downstream processing steps are provided in WO2022/023464 the contents of which are incorporated herein by reference.
- the SHC/HAC enzyme variants described herein show an increased product selectivity (i.e increased selectivity for (-)-Ambrox or Ambra oxide) compared to the product selectivity obtained using a reference SHC enzyme (e.g.
- a wild-type SHC/HAC enzyme such as AacSHC/AHC enzyme represented by SEQ ID NO:1 or of any other wild type SHC/HAC enzyme represented by SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120
- product selectivity also refers to the gram of recoverable product (i.e. (-)-Ambrox or Ambra oxide) per gram of total products formed (which can be calculated as a percent molar conversion rate).
- “increase” may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the yield obtained using a reference SHC enzyme.
- “selectivity” means an ability to preferentially convert a particular substrate isomer (eg the EEH isomer) into a specific product in an enzymatically catalyzed method as described herein out of a plurality/mixture of several substrate isomers (“substrate selectivity”). More specifically, this means that a particular product (-)-Ambrox is enriched with respect to the enzymatic conversion of a specific substrate (EEH) isomer from a mixture of several substrate isomers.
- substrate selectivity of an enzyme or enzyme variant refers to the ability of the enzyme or enzyme variant to react with a particular substrate isomer compared to another substrate isomer, while the enzyme is in contact with a mixture comprising at least two distinct substrate isomers.
- a WT SHC enzyme (such as those represented by SEQ ID NO:1 or by any of the SHC/HAC disclosed in tables 2, 3 or 16 or represented by SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55.56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120,
- the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the wt% of total products formed as a result of the reaction of the enzyme variant of a WT or of a reference or parent SHC with the mixture comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH may be at least about 1 percentage point greater than the wt% of total products formed as a result of the reaction of the corresponding WT or parent or reference of SHC enzyme withthe same mixture comprising EEH.
- the wt% of total products formed as a result of the reaction of said enzyme variant may be at least about 2 or at least about 3 or at least about 4 percentage points greater than the wt% of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH.
- the wt% of total products formed as a result of the reaction of said enzyme variant may be up to about 40 or up to about 30 or up to about 20 or up to about 15 or up to about 10 percentage points greater than the wt% of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH.
- the wt% of total products formed as a result of the reaction of said enzyme variant with a mixture comprising EEH may be from about 1 to about 40 or from about 2 to about 30 or from about 3 to about 20 or from about 4 to about 10 percentage points greater than the wt% of total products formed as a result of the reaction of WT or reference or parent SHC with the same mixture comprising EEH.
- the total products formed as a result of the reaction of the enzyme variant of a WT SHC or of reference or parent SHC may, for example, comprise, consist essentially of or consist of compounds of formula (I) ((-)-Ambrox) and formula (IV) described herein when a mixture comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH is used as a substrate.
- the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the total products formed as a result of the reaction of the enzyme variant of WT or of a reference or parent SHC may, for example, comprise, consist essentially of or consist of compounds of formula (X) and/or formula (XII) described herein when bisEEH is used as a substrate.
- the wt% of (-)-Ambrox formed using the enzyme variant of a WT SHC/HAC (such as those WT SHC/HAC represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120
- the wt% of (-)-Ambrox formed as a result of the reaction of the enzyme variant of said WT or reference or patent SHC with said mixture comprising EEH may be at least about 2 or at least about 3 or at least about 4 percentage points greater than the wt% of (-)-Ambrox formed as a result of the reaction of said WT or reference or parent SHC with said mixture comprising EEH.
- the wt% of (-)-Ambrox formed as a result of the reaction of saidenzyme variant of WT SHC with said mixture comprising EEH may be up to about 40 or up to about 30 or up to about 20 or up to about 15 or up to about 10 percentage points greater than the wt% of (-)-Ambrox formed as a result of the reaction of said WT or said reference or parent SHC with said mixture comprising EEH.
- the wt% of (-)-Ambrox formed as a result of the reaction of said enzyme variant of said WT or said parent or reference SHC with said mixture comprising EEH may be from about 1 to about 40 or from about 2 to about 30 or from about 3 to about 20 or from about 4 to about 10 percentage points greater than the wt% of (-)- Ambrox formed as a result of the reaction of said WT of said reference or parent SHC with said mixture comprising EEH.
- the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH isomer and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- % conversion of EEH : % conversion of EZH) or bisEEH:bisEZH conversion ratio i.e. % conversion of bisEEH : % conversion of bisEZH
- This may be determined by measuring the amount of EEH and EZH or bisEEH and bisEZH remaining in the reaction mixture when the reaction has completed. Uusally the reaction has completed after 18 hours or after 20 hours.
- an enzyme variant of a WT SHC/HAC (such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126,
- the SHC/HAC enzyme variant of a WT or of a reference or parent SHC/HAC may, for example, provide an EEH:EZH conversion ratio of at least about 2.0 in a process for making (-)-Ambrox from a mixture of homofarnesol comprising at least two distinct substrate isomers of homofarnesol, said mixture comprising EEH and EZH.
- the mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers of homofarnesol comprises the EEH and the EZH isomers and is selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the mixture comprises EEH and EZH.
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 55:45, 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the enzyme variant of a WT or of a reference or parent SHC/HAC may provide an EEH:EZH conversion ratio of at least about 2.5 or at least about 3.0 or at least about 3.5 in a process for making (-)-Ambrox from a mixture as defined above.
- the mixture comprises EEH and EZH.
- the enzyme variant of said WT SHC/HAC or of said reference or parent SHC/HAC may provide an EEH:EZH conversion ratio up to about 5.0 or up to about 4.5 or up to about 4.0 in a process for making (-)-Ambrox from the mixture as defined above.
- said mixture comprises EEH and EZH.
- the enzyme variant of said WT or of said reference or parent SHC/HAC may provide an EEH:EZH conversion ratio ranging from about 2.0 to about 5.0 or from about 2.5 to about 4.5 or from about 3.0 to about 4.0 in a process for making (-)-Ambrox from the mixture as defined above.
- said mixture comprises EEH and EZH.
- the WT SHC enzyme or enzyme variant of WT SHC has a higher selectivity for EEH over other isomers of homofarnesol compared to WT AacSHC and/or variants of WT AacSHC
- the wild-type SHC/HAC enzyme e.g.
- the SHC/HAC enzyme variant may be derived) may be selected from TelSHC1, ApaSHC1, ZmoSHC1, ZmoSHC2, BjaSHC (or BjpSHC), GmoSHC BmeSHC, SalSHC, ApaSHCA.
- the WT SHC enzyme or enzyme variant of WT SHC has a higher selectivity for EEH over other isomers of homofarnesol compared to WT AacSHC and/or variants of WT AacSHC
- the wild-type SHC/HAC enzyme e.g.
- the SHC/HAC enzyme variant may be derived) may be selected from ZmoSHC1, BjaSHC (BjpSHC), GmoSHC, ApaSHC1 and BmeSHC.
- the SHC/HAC enzyme variants described herein show an increased rate of EEH conversion (or increased rate of BisEEH conversion) compared to the rate of conversion of a reference SHC enzyme (e.g.
- a wild-type SHC/HAC enzyme such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129,
- conversion rate refers to the amount of converted substrate (i.e. EEH or BisEEH) per gram of biocatalyst and per unit of time (which can be calculated as a percent molar conversion rate).
- “increase” may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the conversion rate obtained using a reference SHC enzyme.
- the SHC/HAC enzyme variants described herein show an increased specificity for their substrate EEH (or BisEEH) compared to the specificity of a reference SHC enzyme (e.g. a wild-type SHC/HAC enzyme such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 11
- substrate specificity also refers to the amount of a particular converted substrate isomer (i.e. EEH or BisEEH) per gram of substrate initially present at a certain point of time of an enzymatically catalysed reaction, or during an "interval" of said reaction.
- said selectivity may be observed during an "interval” corresponding 1 to 99 %, 2 to 95%, 3 to 90%, 5 to 85%, 10 to 80%, 15 to 75%, 20 to 70%, 25 to 65%, 30 to 60, or 40 to 50% conversion of the initial amount of the substrate.
- the “interval” may be from 1 to 8 hours or from 2 to 7 or from 3 to 6 hours. In an embodiment, the “interval is 6 hours.
- “increase” may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the substrate specificity obtained using a reference SHC enzyme.
- the SHC/HAC enzyme variants described herein show a modified (e.g. increased) productivity relative to a reference SHC enzyme (e.g.
- wild-type AacSHC (SEQ ID NO:1) or 215G2 AacSHC (SEQ ID NO:3) or SHC#65 (SEQ ID NO:2) or a parent SHC enzyme the variant derives from such as any of the following wild type SHC/HAC identified in table 2 or 3 or 16 or represented by SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106,
- productivity refers to the amount of recoverable product (i.e. (-)-Ambrox or Ambra oxide) in grams per liter of reaction capacity per hour of bioconversion time (i.e. time after the substrate was added).
- productivity also refers to the amount of recoverable product in grams per liter of reaction capacity per hour of bioconversion time (ie time after the substrate was added) per gram of biocatalyst used in the reaction.
- “increase” may mean an increase of at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, at least 200% or at least 400% of the productivity obtained using a reference SHC enzyme.
- the SHC/HAC enzyme variant disclosed herein exhibits: - an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis- homofarnesol substrates are used, - an increased product selectivity for (-)-Ambrox (or Ambra oxide) when homofarnesol or bis- homofarnesol substrates are used, - an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the like – see, for example WO2021/110858 and WO2021/209482 respectively) - an increased productivity and/or - an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e
- wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131,
- the SHC/HAC enzyme variant disclosed herein exhibits: - an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis- homofarnesol substrates are used - an increased product selectivity for (-)-Ambrox (or Ambra oxide) when homofarnesol or bis- homofarnesol substrates are used - an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the like – see, for example WO2021/110858 and WO2021/209482 respectively)- an increased productivity and - an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion over the first 3 to 6 hours (or over the first 4, 5 or 6 hours) of the reaction, compared to the reference SHC enzyme (e.g.
- the SHC/HAC enzyme variants described herein show a modified (i.e. increased) yield compared with the yield of a reference SHC enzyme (e.g.
- the SHC/HAC enzyme variants described herein show a modified (i.e. increased) yield compared with the yield of a reference AacSHC (SEQ ID NO: 1) or SHC#65 (SEQ ID NO:2), or 215G2 AacSHC (SEQ ID NO: 3) or ZmoSHC1 represented by SEQ ID NO:13 or ZmoSCH2 represented by SEQ ID NO:15 or Tel SHC represented by SEQ ID NO:23 or ScoSHC represented by SEQ ID NO:32.
- the wild-type SHC/HAC enzyme e.g.
- the SHC/HAC enzyme variant may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme, the Zymomonas mobilis (Zmo) SHC/HAC enzyme, the Bradyrhizobium japonicum (Bjp/Bja) SHC/HAC enzyme, the Acetobacter pasteurianus (Apa) SHC/HAC enzyme, the Bacillus megaterium (Bme) SHC/HAC enzyme or the Gluconobacter morbifer (Gmo) SHC/HAC enzyme.
- the wild-type SHC/HAC enzyme e.g.
- target yield factor refers to the ratio between the product concentration obtained and the concentration of the SHC/HAC variant enzyme (for example, purified SHC/HAC enzyme variant or an extract from the recombinant host cells producing the SHC/HAC enzyme variant) in the reaction medium.
- the SHC/HAC enzyme variants disclosed herein show a modified (e.g. increased) fold increase in enzymatic activity (e.g.
- a modified/increased homofarnesol Ambrox cyclase (HAC) activity relative to the activity of a reference SHC protein (e.g. SEQ ID No.1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120,
- amino acid alteration means an insertion of one or more amino acids between two amino acids, a deletion of one or more amino acids or a substitution (which may be conservative or non-conservative) of one or more amino acids with one or more different amino acids relative to the amino acid sequence of a reference amino acid sequence. Substitutions replace the amino acids of the reference sequence with the same number of amino acids in the variant sequence.
- Reference amino acid sequences may, for example, be a wild-type (WT) amino acid sequence (for example SEQ ID NO: 1 or any of SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122,
- substitution is synonymous with the word “replacement”.
- the amino acid alterations can be easily identified by a comparison of the amino acid sequences of the SHC/HAC enzyme variant with the amino acid sequence of the reference amino acid sequence.
- Conservative amino acid substitutions may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
- the 20 naturally occurring amino acids as outlined above can be grouped into the following six standard amino acid groups: (1) hyd rophobic: Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
- conservative substitutions means an exchange of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
- glycine and proline may be substituted for one another based on their ability to disrupt alpha-helices.
- Some preferred conservative substitutions within the above six groups are exchanges within the following sub-groups: (i) Ala, Val, Leu and Ile; (ii) Ser and Thr; (ii) Asn and Gln: (iv) Lys and Arg; and (v) Tyr and Phe. Given the known genetic code, and recombinant and synthetic DNA techniques, the skilled scientist readily can construct DNAs encoding the conservative amino acid variants.
- a set of conserved amino acids in the amino acid sequence of a wild type SHC comprises L22, Q26, G30, W32, A44, L48, Q72, G76, W78, Y95, L98, G102, A113, I117, G121, G122, F129, T130, L134, A135, G138, W142, P146, W169, A170, R171, F217, D222, R237, I261, P263, P281, S309, P310, W312, D313, T314, A320, W339, Q344, G349, D350, W351, G361, G362, A364, F365, N369, Y372, P373, D374, D376, D377, W406, Q411, G415, A419, P433, D436, D442, P443, D447, V448, Q4
- a set of conserved amino acids in the amino acid sequence for five wild type SHC in particular wild type AacSHC of SEQ ID No.1, wild type ZmoSHC1 of SEQ ID No.13, wild type ZmoSHC2 of SEQ ID No.15, wild type TelSHC of SEQ ID No.23 and wild type ScoSHC of SEQ ID No.32 is presented.
- non-conservative substitutions or “non-conservative amino acid exchanges” are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) as shown above.
- the SHC/HAC enzyme variants described herein are prepared using non-conservative substitutions which alter the biological function (e.g. HAC activity) of the disclosed SHC/HAC enzyme variants.
- HAC activity e.g. HAC activity
- the one-letter amino acid symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission are indicated as follows. The three letter codes are also provided for reference purposes. Table 1: Amino acid nomenclature
- Amino acid alterations such as amino acid substitutions may be introduced using known protocols of recombinant gene technology including PCR, gene cloning, site- directed mutagenesis of cDNA, transfection of host cells, and in vitro transcription which may be used to introduce such changes to the reference sequence resulting in an SHC/HAC enzyme variant.
- the enzyme variants can then be screened for SHC/HAC functional activity. Suitable sources of SHC/HAC enzymes are identified in table 2, 3 or 16.
- suitable sources include, for example, Alicyclobacillus acidocaldarius (Aac), Zymomonas mobilis (Zmo), Bradyrhizobium japonicum (Bjp), Gluconobacter morbifer (Gmo), Burkholderia ambifaria, Bacillus anthracis, Methylococcus capsulatus, Frankia alni, Acetobacter pasteurianus (Apa), Thermosynechococcus elongatus (Tel), Streptomyces coelicolor (Sco), Rhodopseudomonas palustris (Rpa), Teredinibacter turnerae (Ttu), Pelobacter carbinolicus(Pca) or Syntrophotalea carbinolica DSM 2380, Bacillus megaterium (Bme), Streptomyces albolongus (Sal) and Tetrahymena pyriformis (see, for example WO 2010/
- the SHC/HAC enzyme (e.g. from which the SHC/HAC enzyme variant may be derived) may be the Alicyclobacillus acidocaldarius (Aac) SHC/HAC enzyme, the Zymomonas mobilis SHC/HAC (ZmoSHC1) enzyme the Bradyrhizobium japonicum (Bjp or Bja) SHC/HAC enzyme or the Gluconobacter morbifer (Gmo) SHC/HAC enzyme or an Acetobacter pasteurianus SHC/HAC (ApaSHC1) enzyme or the Bacillus megaterium (Bme) SHC/HAC enzyme.
- the SHC/HAC enzyme e.g.
- AacSHC Alicyclobacillus acidocaldarius
- ZmoSHC Zmomonas mobilis
- BjpSHC Bradyrhizobium japonicum
- ApaSHC may be used to refer to the Acetobacter pasteurianus (Apa) SHC/HAC enzymes
- BmeSHC Bacillus megaterium (Bme) SHC/HAC enzyme
- SalSHC may be used to refer to the Strepto
- AacSHC, ZmoSHC and BjpSHC enzyme sequences are disclosed in BASF WO 2010/139719, US 2012/01345477A1, Seitz et al (as cited above) and Seitz (2012 PhD thesis as cited above).
- Two different sequences are disclosed for ZmoSHC, referred to as ZmoSHC1 and ZmoSHC2.
- the Gmo SHC/HAC enzyme sequence is disclosed in WO 2018/157021.
- the SalSHC enzyme is disclosed in Liu et al (2020): A Novel Soluble Squalene-Hopene Cyclase and Its Application in Efficient Synthesis of Hopene, Frontiers in Bioengineering and Biotechnology, vol 8, article 426, https://doi.org/10.3389/fbioe.2020.00426). Table 2. Sources and accession numbers of wild-type (WT) SHC enzymes.
- sequences of the wild-type AacSHC, wild-type ZmoSHC1, wild-type ZmoSHC2, wild-type BjpSHC, wild-type GmoSHC, wild-type TelSHC and wild-type ApaSHC1, wild-type BmeSHC, wild-type SalSHC and wild-type ApaSHCA are also disclosed herein in table 3.
- Most preferred wild-type SHC are: AacSHC (SEQ ID NO: 1) or ZmoSHC1 represented by SEQ ID NO:13 or ZmoSCH2 represented by SEQ ID NO:15 or Tel SHC represented by SEQ ID NO:23 or ScoSHC represented by SEQ ID NO:32.
- a reference AacSHC protein as used herein may refer to the wild-type AacSHC protein as disclosed in SEQ ID NO: 1.
- AacSHC has the activity of a homofarnesol Ambrox cyclase (HAC) useful in the production of Ambrox derivatives through a biocatalytic reaction of SHC with a homofarnesol substrate.
- the main reaction of the AacSHC is the cyclisation of a linear or a non- linear substrate such as homofarnesol to produce Ambrox.
- Another reference AacSHC protein is SHC/AHC enzyme 215G2 SHC or 215G2 SHC as disclosed in SEQ ID NO: 3.
- SEQ ID NO:3 corresponds to SEQ ID NO:1 with the mutations M132R, A224V and I432T.
- Another reference AacSHC protein is SHC/AHC enzyme variant#65 as disclosed in SEQ ID NO: 2.
- SEQ ID NO:2 corresponds to SEQ ID NO: 1 with the substitutions M132R, A224V, I432T, A557T and R613S and may be referred to as SHC/HAC enzyme variant #65 or SHC#65 variant herein.
- the wording “functional homologs” may be replaced by “functional equivalents” or by “homologs”.
- Functional homologs of the wild-type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein are also suitable for use in cyclization reactions, for example for producing (-)- Ambrox, for example in a recombinant host.
- the recombinant host may include one or more heterologous nucleic acid(s) encoding functional homologs of the polypeptides described above and/or a heterologous nucleic acid encoding a SHC/HAC derivative enzyme as described herein.
- a functional homolog is a polypeptide that has sequence identity and optionally sequence similarity to a reference polypeptide, and that carries out one or more of the biochemical or physiological function(s) of the reference polypeptide.
- a functional homolog and the reference polypeptide may be natural occurring polypeptides, and the sequence identity and optionally sequence similarity may be due to convergent or divergent evolutionary events.
- functional homologs are sometimes designated in the literature as homologs, or orthologs, or paralogs.
- Variants of a naturally occurring functional homolog such as polypeptides encoded by mutants of a wild-type coding sequence, may themselves be functional homologs.
- Functional homologs can also be created via site-directed mutagenesis of the coding sequence for a polypeptide, or by combining domains from the coding sequences for different naturally-occurring polypeptides ("domain swapping").
- Techniques for modifying genes encoding functional homologs described herein are known and include, inter alia, directed evolution techniques, site- directed mutagenesis techniques and random mutagenesis techniques, and can be useful to increase specific activity of a polypeptide, alter substrate specificity, alter expression levels, alter subcellular location, or modify polypeptide:polypeptide interactions in a desired manner. Such modified polypeptides are considered functional homologs.
- the term "functional homolog” is sometimes applied to the nucleic acid that encodes a functionally homologous polypeptide. Functional homologs can be identified by analysis of nucleotide and polypeptide sequence alignments.
- performing a query on a database of nucleotide or polypeptide sequences can identify homologs of the nucleic acid sequences encoding the SHC derivative polypeptides and the like.
- Hybridization can also be used to identify functional homologs and/or as a measure of homology between two nucleic acid sequences.
- a nucleic acid sequence encoding any of the proteins disclosed herein, or a portion thereof, can be used as a hybridization probe according to standard hybridization techniques.
- the hybridization of a probe to DNA or RNA from a test source is an indication of the presence of the relevant DNA or RNA in the test source.
- Hybridization conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 6.3.1-6.3.6, 1991.
- Moderate hybridization conditions are defined as equivalent to hybridization in 2x sodium chloride/sodium citrate (SSC) at 30°C followed by a wash in 1x SSC, 0.1% SDS at 50°C.
- Highly stringent conditions are defined as equivalent to hybridization in 6x sodium chloride/sodium citrate (SSC) at 45°C followed by a wash in 0.2x SSC, 0.1% SDS at 65°C.
- Sequence analysis to identify functional homologs can also involve BLAST, Reciprocal BLAST, or PSI-BLAST analysis of non- redundant databases using a relevant amino acid sequence as the reference sequence.
- Amino acid sequence is, in some instances, deduced from the nucleotide sequence. Those polypeptides in the database that have greater than 40% sequence identity are candidates for further evaluation for suitability for use in the SHC/HAC bioconversion reaction. Amino acid sequence similarity allows for conservative amino acid substitutions, such as substitution of one hydrophobic residue for another or substitution of one polar residue for another. If desired, manual inspection of such candidates can be carried out in order to narrow the number of candidates to be further evaluated. Manual inspection can be performed by selecting those candidates that appear to have for e.g.
- conserved functional domains typically, polypeptides that exhibit at least about 30% amino acid sequence identity are useful to identify conserved regions.
- conserved regions of related polypeptides exhibit at least 30%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, amino acid sequence identity.
- a conserved region exhibits at least, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% amino acid sequence identity. Sequence identity can be determined as set forth above and below.
- a region may comprise from 5 to 50 amino acids or from 10 to 150 or from 10 to 80 or from 10 to 100 amino acids.
- the SHC/HAC enzymes or enzyme variants described herein and used in the methods described herein may, for example, be based on an amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
- the produced reference SHC enzyme may be based on an amino acid sequence produced from E. coli.
- Percent (%) identity with respect to the nucleotide sequence of a gene is defined as the percentage of nucleotides in a candidate DNA sequence that is identical with the nucleotides in the DNA sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent nucleotide sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- polypeptide and protein are used interchangeably herein and mean any peptide-linked chain of amino acids, regardless of length or post-translational modification.
- derivative includes but is not limited to a variant.
- derivative and “variant” are used interchangeably herein.
- a variant enzyme usable in the present disclosure exhibits a total number of up to 200 (up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200) changes (alterations) in the amino acid sequence (i.e.
- variant usable in the present disclosure differs from the protein or domain from which it is derived by up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acid exchanges, preferably conservative amino acid changes.
- Variants may additionally or alternatively comprise deletions of amino acids, which may be N-terminal truncations, C-terminal truncations or internal deletions or any combination of these.
- deletion variants Such variants comprising N-terminal truncations, C- terminal truncations and/or internal deletions are referred to as “deletion variants” or “fragments” in the context of the present application.
- the terms “deletion variant” and “fragment” are used interchangeably herein.
- a deletion variant may be naturally occurring (e.g. splice variants) or it may be constructed artificially, preferably by gene-technological means.
- the protein or protein domain from which the deletion variant is derived is a wild-type protein.
- deletion variants of the present disclosure may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variants, provided that the deletion variants exhibit at least one biological activity of the parent polypeptide.
- a deletion variant (or fragment) has a deletion of up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acids at its N-terminus and/or at its C- terminus and/or internally as compared to the parent polypeptide.
- the SHC/HAC enzyme variants described herein only include substitutions and do not include any deletions or insertions.
- a variant of the WT/reference SHC/HAC or the SHC/HAC Derivative of the present disclosure may have a sequence identity of at least 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least
- a polynucleotide belonging to a family of any of the enzymes disclosed herein or a protein can be identified based on its similarity to the relevant gene or protein, respectively. For example, the identification can be based on sequence identity.
- the disclosure features isolated nucleic acid molecules which are at least 30%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%,
- SEQ ID NO: 1 SEQ ID NO:13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133
- the polypeptide in question and the reference polypeptide exhibit the indicated sequence identity or similarity over a continuous stretch of 20, 30, 40, 45, 50, 60, 70, 80, 90, 100 or more amino acids.
- the polynucleotide in question and the reference polynucleotide exhibit the indicated sequence identity over a continuous stretch of 60, 90, 120, 135, 150, 180, 210, 240, 270, 300 or more nucleotides.
- sequence identity is to be calculated with reference to the longer of the two sequences to be compared, if not specifically indicated otherwise. If the reference sequence is indicated, the sequence identity is determined on the basis of the full length of the reference sequence (e.g.
- a peptide sequence consisting of 130 amino acids compared to the amino acids of full length of wild-type AacSHC with 631 amino acid residues may exhibit a maximum sequence identity percentage of 20.6% (130/631 x 100) while a sequence with a length of 300 amino acids may exhibit a maximum sequence identity percentage of 47.5% (300/631 x 100).
- the identityof nucleotide and amino acid sequences, i.e. the percentage of sequence identity can be determined via sequence alignments. Such alignments can be carried out with several art- known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci.
- Preferred parameters used are the default parameters as they are set on https://www.ebi.ac.uk/Tools/msa/clustalo/.
- the grade of sequence identity may be calculated using e.g. BLAST, BLAT or BlastZ (or BlastX).
- BLASTN and BLASTP programs Altschul et al (1990) J. Mol. Biol.215, 403-410.
- Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res.25, 3389-3402.
- Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1: 154-162) or Markov random fields.
- % identity between two sequences is determined using CLUSTAL O (version 1.2.4).
- similarity means the degree of sequence relatedness between amino acid sequences, as the case may be, as determined by the match between strings of such sequences.
- similarity between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide. "Identity” and “similarity” can be readily calculated by known methods, including but not limited to those described in (Computational Molecular Biology, Lesk, A.
- Preferred parameters for polypeptide sequence comparison include the following: Algorithm: Needleman and Wunsch, J. Mol. Biol.48:443-453 (1970); Comparison matrix: BLOSSUM62 from Hentikoff and Hentikoff, Proc. Natl. Acad. Sci. USA.89:10915-10919 (1992); Gap Penalty: 12; and Gap Length Penalty: 4.
- a program useful with these parameters is publicly available as the "Ogap" program from Genetics Computer Group, located in Madison, WI. The aforementioned parameters are the default parameters for amino acid comparisons (along with no penalty for end gaps).
- the skilled person may also take into account so-called “conservative” amino acid substitutions, as will be clear to the skilled person.
- “Similarity” between two amino acid sequences is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one polypeptide to the sequence of a second polypeptide.
- “conservative” amino acid substitutions refer to the interchangeability of residues having similar side chains. Examples of classes of amino acid residues for conservative substitutions are given in the Tables below.
- Table 4 Classes of amino acid residues
- Table 5 Alternative conservative amino acid residue substitution classes
- Table 6 Alternative physical and functional classifications of amino acid residues
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine
- a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine
- a group of amino acids having amide-containing side chains is asparagine and glutamine
- a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan
- a group of amino acids having basic side chains is lysine, arginine, and histidine
- a group of amino acids having sulphur-containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
- Substitutional variants of the amino acid sequence disclosed herein are those in which at least one residue in the disclosed sequences has been removed and a different residue inserted in its place.
- the amino acid change is conservative.
- Preferred conservative substitutions for each of the naturally occurring amino acids are as follows: Ala to Ser; Arg to Lys; Asn to Gln or His; Asp to Glu; Cys to Ser or Ala; Gln to Asn; Glu to Asp; Gly to Pro; His to Asn or Gln; Ile to Leu or Val; Leu to Ile or Val; Lys to Arg; Gln or Glu; Met to Leu or Ile; Phe to Met, Leu or Tyr; Ser to Thr; Thr to Ser; Trp to Tyr; Tyr to Trp or Phe; and, Val to Ile or Leu.
- Specific SHC/HAC enzymes and enzymes variants that may be used in the methods described herein are further described below.
- SHC/HAC enzyme variants derived from Aac SHC/HAC enzyme (SEQ ID NO:1) or from variants of said Aac SHC/HAC enzyme (SEQ ID NO:2 or SEQ ID NO:3) or derived from other wild type SHC as identified herein (such as those identified in table 2, 3 or 16 especially such as those represented by SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96,
- SEQ ID NO:3 corresponds to SEQ ID NO:1 with the amino acid alterations (substitutions) M132R, A224V and I432T.
- SEQ ID NO:2 corresponds to SEQ ID NO: 1 with the amino acid alterations (substitutions) M132R, A224V, I432T, A557T and R613S.
- the new SHC/HAC enzyme variants derived from SEQ ID NO:2 or 3 still comprise the amino acid alterations (substitutions) they had compared to SEQ ID NO:1.
- amino acid alterations are the following: - Variant derived from SEQ ID NO:3 may comprise the following amino acid alterations (substitutions): M132R, A224V and I432T compared to SEQ ID NO:1, - Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R, A224V, I432T, A557T and R613S compared to SEQ ID NO:1, - Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R and I432T compared to SEQ ID NO:1, - Variant derived from SEQ ID NO:2 may comprise the following amino acid alterations (substitutions): M132R and I432T, A557T and R613S compared to SEQ ID NO:1.
- Variant derived from any one of the sequences listed in Table 14 of WO2016/170099 including but not limited to SEQ ID No.5, 7,9, 11, 13, 15, 17, 19, 171, 23, 25, 27, 29, 31, 33, 35,37 or 39 (corresponding to SEQ ID NO:361-368, 378, 3, 369-377 of the present application respectively).
- Variants derived from any one of the sequences listed in Table 6 of WO2021/110848 including but not limited to SEQ ID No.5, 17, 18, 2 or 4 (see table 8 below and sequences disclosed at the end of the experimental part).
- Table 7 corresponding to Table 14 of WO 2016/170099: AacSHC Derivative amino acid and nucleotide SEQ ID No.
- Table 8 corresponding to Table 6 of WO2021/110848. Mutations in selected new SHC variant enzymes. Note: these mutations appear in addition to the mutations present in 215G2 SHC: M132R, A224V, and I432T. SEQ ID NO:2,3,4,5,17 and 18 of table 8 correspond to SEQ ID NO:379, 2, 380, 381, 382 and 383.
- Sequences identified in tables 7 and 8 above are represented by any of SEQ ID NO: 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 in the sequence listing and as indicated at the end of the experimental part.
- the SHC/HAC enzyme variant may have equal to or less than about 30 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124,
- the SHC/HAC enzyme variant may have equal to or less than about 25 or equal to or less than about 20 or equal to or less than about 15 or equal to or less than about 10 or equal to or less than about 9 or equal to or less than about 8 or equal to or less than about 7 or equal to or less than about 6 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
- the SHC/HAC enzyme variant may have at least about 5 or at least about 6 amino acid alterations compared to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55.56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124,
- amino acid alterations may, for example, be insertions, deletions and/or substitutions as described above.
- Amino acid alterations are defined relative to a reference sequence.
- An amino acid alteration relative to a reference sequence means that the amino acid sequence of the variant sequence is different to the reference sequence.
- Amino acids in the reference sequence and the variant sequence may be assigned a number, where the numbering starts with the amino acid at the N-terminus of the polypeptide (i.e. the amino acid at the N-terminus of the polypeptide is numbered 1, the next amino acid is numbered 2 etc.).
- the “position” of a reference sequence refers to a specific amino acid residue present in the reference sequence as identified by the specific numbering of the amino acids in the reference sequence.
- the “position” of a variant sequence refers to a specific amino acid residue present in the variant sequence as identified by the specific numbering of the amino acids in the variant sequence. Since the variant sequence may include deletions or insertions compared to the reference sequence, the amino acids in the variant sequence may be numbered differently to the same amino acids in the reference sequence. By way of example, if an amino acid is inserted between amino acids 131 and 132 of SEQ ID NO: 1, the amino acid following the insertion will have the numbering 133 in the variant sequence while it retains the numbering 132 in the reference sequence. In this example, the position of the variant sequence that corresponds to position 132 of the reference sequence is position 133.
- amino acids in the variant sequence that have been retained from the reference sequence may be defined by referring to the “corresponding position” of the reference sequence.
- a “position” in the variant sequence may be defined by reference to a “corresponding position” in the reference sequence.
- substitutions in the variant sequence compared to the reference sequence may be defined by referring to the “corresponding position” of the reference sequence in spite of any insertions and/or deletions in the reference sequence.
- the amino acids of a reference sequence have been deleted, there is no “corresponding position” in the variant sequence.
- there are no insertions or deletions compared to the reference sequence i.e. there are only substitutions
- the “corresponding position” of the reference sequence will be the same as the position in the variant sequence.
- position 169 in AacSHC represented by SEQ ID NO:1 corresponds to position 222 in ZmoSHC1 (SEQ ID NO:13 or 14), position 177 in ZmoSHC2 (SEQ ID NO:15), position 172 in TelSHC (SEQ ID NO:23) and position 196 in ScoSH1 (SEQ ID NO:32).
- position 306 in AacSHC represented by SEQ ID NO:1 corresponds to position 368 in ZmoSHC1 (SEQ ID NO:13 or 14), position 321 in ZmoSHC2 (SEQ ID NO:15), position 311 in TelSHC (SEQ ID NO:23) and position 335 in ScoSH1 (SEQ ID NO:32).
- position 600 in AacSHC represented by SEQ ID NO:1 corresponds to position 667 in ZmoSHC1 (SEQ ID NO:13 or 14), position 619 in ZmoSHC2 (SEQ ID NO:15), position 609 in TelSHC (SEQ ID NO:23) and position 629 in ScoSH1 (SEQ ID NO:32).
- the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124,
- the SHC/HAC enzyme variant amino acid sequence has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85,86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128,
- the SHC/HAC enzyme or enzyme variant (also named type 1 variants) has an amino acid sequence with at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:
- the SHC/HAC enzyme or enzyme variant has an amino acid sequence with at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, and has
- a SHC/HAC enzyme variant (also named type 2 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115,
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 3 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115,
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 4 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a functional equivalent of G is P.
- a and V are functional equivalents.
- M, L and I are also functional equivalents of A and V.
- position 169 in AacSHC represented by SEQ ID NO:1 corresponds to position 222 in ZmoSHC1 (SEQ ID NO:13), position 177 in ZmoSHC2 (SEQ ID NO:15), position 172 in TelSHC (SEQ ID NO:23) and position 196 in ScoSH1 (SEQ ID NO:32).
- the new amino acid (X) at a position corresponding to position 306 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be V or a functional equivalent thereof.
- a functional equivalent of V is A, M, L and I.
- position 306 in AacSHC represented by SEQ ID NO:1 corresponds to position 368 in ZmoSHC1 (SEQ ID NO:13), position 321 in ZmoSHC2 (SEQ ID NO:15), position 311 in TelSHC (SEQ ID NO:23) and position 335 in ScoSH1 (SEQ ID NO:32).
- the new amino acid (X) at a position corresponding to position 600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be A, V, L, I or M or a functional equivalent thereof. All these amino acids are functional equivalents.
- position 600 in AacSHC represented by SEQ ID NO:1 corresponds to position 667 in ZmoSHC1 (SEQ ID NO:13), position 619 in ZmoSHC2 (SEQ ID NO:15), position 609 in TelSHC (SEQ ID NO:23) and position 629 in ScoSH1 (SEQ ID NO:32).
- a SHC/HAC enzyme variant (also named type 5 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18,19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 6 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121,
- the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G.
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 7 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121,
- the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G
- the G at position 600 of SEQ ID NO:1, 2, 3,13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by M.
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124
- the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, and - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V.
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 8 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121,
- the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V, and - the G at
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365,
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169 and A306 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 9 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, A306 and/or G600 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54,
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 305 or 306 and has amino acid alteration relative to SEQ ID NO: 1,2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 305 or 306 at position W169 of SEQ ID NO: 1,2, 3, 47, 48, 49, 50, 51, 52, 53 or
- each of the SHC/HAC enzyme variant having at least 70,0% identity or similarity with SEQ ID NO: 2, 3, 47, 48, 49, 50, 51, 53, 54, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383 ,305 or 306 still has the same mutation(s) that differentiates it from SEQ ID NO:1.
- Each of these mutations has already been defined herein at least in the section entitled “Summary of the sequences”.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC1 P1 variant, SEQ ID NO: 312) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 13 or 14 and has amino acid alteration relative to SEQ ID NO: 13 at position W222 of SEQ ID NO: 13 or 14 and such amino acid alteration is the W at position 222 is replaced by G.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:312 and that still has W222G.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC1 P2 variant: SEQ ID NO: 353) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222 and G667 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G and G at position 667 is replaced by M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222 and A368 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G and A at position 368 is replaced by V.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC1 P3 variant: SEQ ID NO: 354) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 13 and has amino acid alterations relative to SEQ ID NO: 13 at positions W222, A368 and G667 of SEQ ID NO: 13 and such amino acid alteration is the W at position 222 is replaced by G, A at position 368 is replaced by V, and G at position 667 is replaced by M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC2 P1 variant, SEQ ID NO: 313) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at position W177of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC2 P2 variant, SEQ I DNO: 355) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at position W177 and G619 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G and the G at position 619 is replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 or 355 and that still has W177G and G619M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at positions W177, and 321 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G and the A at position 321 is replaced by V.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G and A321V.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ZmoSHC2 P3 variant, SEQ I DNO: 356) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:15 and has amino acid alteration relative to SEQ ID NO: 15 at positions W177, A321 and G619 of SEQ ID NO: 15 and such amino acid alteration is the W at position 177 is replaced by G, A at position 321 is replaced by V, and the G at position 619 is replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:313 and that still has W177G, A321V and G619M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (Tel SHC variant P1 SEQ ID NO: 304) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at position W172 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:304 and that still has W172G.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:302 and that still has W172G.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (Tel SHC variant P2 SEQ ID NO: 359) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at positions W172 and G609 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G and G at position 609 replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:359 and that still has W172G and G609M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at positions W172 and A311 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G and A at position 311 is replaced by V.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:360 and that still has W172G and A311V.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (Tel SHC variant P3 SEQ ID NO: 360) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 23 and has amino acid alteration relative to SEQ ID NO: 23 at positions W172, A311 and G609 of SEQ ID NO: 23 and such amino acid alteration is the W at position 172 is replaced by G, A at position 311 is replaced by V, and G at position 609 replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:360 and that still has W172G, A311V and G609M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ScoSHC1 P1 variant SEQ ID NO: 311) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at position W196 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G.
- a SHC/HAC enzyme variant (ScoSHC1 P2 variant SEQ ID NO: 357) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196 and G629 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G and the G at position 629 is replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G and G629M.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196, and A335 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G and the A at position 335 is replaced by V.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G and A335V.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (ScoSHC1 P3 variant SEQ ID NO: 358) (also named type 10 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO:32 and has amino acid alteration relative to SEQ ID NO: 32 at positions W196, A335 and G629 of SEQ ID NO: 32 and such amino acid alteration is the W at position 196 is replaced by G, A at position 335 is replaced by V, and the G at position 629 is replaced by M.
- this enzyme variant is represented by an amino acid sequence having at least 70% with SEQ ID NO:311 and that still has W196G, A335V and G629M.
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the enzyme variant is as follows: - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 90.0 % identity to SEQ ID NO: 7, 8, 9 or 386and has the following mutations: M132R, A224V, I432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 90.0 % identity to SEQ ID NO: 10, 11, 12 or 385 and has the following mutations: M132R, A224V, I432T and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named type 11 variants) has an amino acid sequence having at least 70.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions corresponding to positions W169, and G600M of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 or 54, 361, 362,
- the identity or similarity may be of at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the SHC/HAC enzyme variant also named type 12 variants
- the SHC/HAC enzyme variant (also named type 13 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 4, and has at least the following mutation relative to SEQ ID NO:1: W169G.
- the SHC/HAC enzyme variant (also named type 14 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 5, and has at least the following mutations relative to SEQ ID NO:1: W169G and G600M.
- the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 350, and has at least the following mutations relative to SEQ ID NO:1: W169G and A306V.
- the SHC/HAC enzyme variant (also named type 15 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 6, and has at least the following mutationS relative to SEQ ID NO:1: W169G, A306V and G600M.
- the identity or similarity may be of at least least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the SHC/HAC enzyme variant (also named type 16 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 3, has the following mutations M132R, A224V, I432T relative to SEQ ID NO: 1 and has at least one of the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 3.
- the SHC/HAC enzyme variant (also named type 17 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 10, has the following mutations M132R, A224V, I432T relative to SEQ ID NO: 1 and has the following mutation: W169G relative to SEQ ID NO: 3.
- the SHC/HAC enzyme variant (also named type 18 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 11, has the following mutations M132R, A224V, I432T relative to SEQ ID NO: 1 and has the following mutations: W169G and G600M relative to SEQ ID NO: 3.
- the SHC/HAC enzyme variant (also named type 32 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 385, has the following mutations M132R, A224V, I432T relative to SEQ ID NO: 1 and has the following mutations: W169G and A306V relative to SEQ ID NO: 3.
- the SHC/HAC enzyme variant (also named type 19 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 12, has the following mutations M132R, A224V, I432T relative to SEQ ID NO: 1 and has the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 3.
- the identity or similarity may be of at least least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the SHC/HAC enzyme variant (also named type 20 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 2, has the following mutations: M132R, A224V, I432T, A557T, R613S relative to SEQ ID NO: 1 and has at least one of the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 2.
- the SHC/HAC enzyme variant (also named type 21 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 7, has the following mutations M132R, A224V, I432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutation: W169G relative to SEQ ID NO: 2.
- the SHC/HAC enzyme variant (also named type 22 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 8, has the following mutations M132R, A224V, I432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G and G600M relative to SEQ ID NO: 2.
- the SHC/HAC enzyme variant (also named type 33 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:386, has the following mutations M132R, A224V, I432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G and A306V relative to SEQ ID NO: 2.
- the SHC/HAC enzyme variant (also named type 23 variants) has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 9, has the following mutations M132R, A224V, I432T, A557T, R613S relative to SEQ ID NO: 1 and has the following mutations: W169G, A306V and G600M relative to SEQ ID NO: 2.
- the identity or similarity may be of at least least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the SHC/AHC enzyme variant (also named type 34 variants) has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1-12, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47-54, 55-296, 301-313, 315-353, 354-383 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, is replaced by G; wherein the A at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 is replaced by V; and/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced by M.
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the SHC/AHC enzyme variant (also named type 24 variants) has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11,12, 304, 311, 312, 313, 305, 306, 302, 359, 357, 353, 355, 360, 358, 354, 356.
- the SHC/AHC enzyme variant (also named type 25 variants) has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351, 352.
- each of the SHC/HAC enzyme variants defined herein may have the following additional amino acid alteration wherein the (new) amino acid (X) at a position corresponding to position 168 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may be S or a functional equivalent thereof.
- a functional equivalent of S is C, T, N or Q.
- a SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 and - has an amino acid alteration relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 at position corresponding to position W169 of SEQ ID NO: 1, 2, 3 or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57,
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- any SHC/HAC enzyme variant may comprise at least one of the following conserved amino acids L22, Q26, G30, W32, A44, L48, Q72, G76, W78, Y95, L98, G102, A113, I117, G121, G122, F129, T130, L134, A135, G138, W142, P146, W169, A170, R171, F217, D222, R237, I261, P263, P281, S309, P310, W312, D313, T314, A320, W339, Q344, G349, D350, W351, G361, G362, A364, F365, N369, Y372, P373, D374, D376, D377, W406, Q411, G415, A419, P433, D436, D442, P443, D447, V448, Q479, G483, W485, G487, R488, W489, G490, N492,
- This variant may also be derived from any wild type SHC/HAC enzyme as defined herein (e.g. SEQ ID NO: 13, 14, 15, 16, 17, 18,19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126
- This variant may be derived from any variant types defined earlier herein .
- a process for making (-)-Ambrox by enzymatically converting EEH to (-)-Ambrox There is also provided herein a process for making Ambra oxide by enzymatically converting E,E-bishomofarnesol to Ambra oxide.
- These processes may use any SHC/HAC enzyme variant described herein (especially of types 1 to 25).
- Percent (%) identity with respect to a polypeptide or nucleotide sequence is defined respectively as the percentage of amino acids or nucleotides in a candidate sequence that are identical with the amino acids or nucleotides in the reference sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- polypeptide and protein are used interchangeably herein and mean any peptide-linked chain of amino acids, regardless of length or post-translational modification.
- the similarity of nucleotide and amino acid sequences i.e. the percentage of sequence identity, can be determined via sequence alignments. Such alignments can be carried out with several art- known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T.
- Gapped BLAST may be utilized as described in Altschul et al (1997) Nucleic Acids Res.25, 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used.
- Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1: 154-162) or Markov random fields.
- Shuffle-LAGAN Brunauer M., Bioinformatics 2003b, 19 Suppl 1: 154-162
- Markov random fields When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.
- % identity between two sequences is determined using CLUSTAL O (version 1.2.4). Additional amino acid alterations may be present in the SHC/AHC variants disclosed herein.
- Variant of type 26 In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101,
- Variant of type 27 In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53 , 54 , 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100,
- Variant of type 28 In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 , 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101
- Variant of type 29 In an embodiment, examples of additional amino acid alterations relative to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54 , 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100
- amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be Y81X.
- the SHC/HAC enzyme variants may additionally comprise insertions and/or deletions, the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 81.
- the new amino acid (X) at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be Met, Ala, Val, Leu, Ile, Cys, Ser, Thr, Asn, Gln, Asp, Glu, His, Lys, Arg, Gly, Pro, Trp, or Phe.
- amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1 may substitute the amino acid of SEQ ID NO: 1 (i.e. Y) for a basic amino acid (i.e. His, Lys or Arg).
- the amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- Y for histidine (i.e. the amino acid alteration at a position corresponding to position 81 of SEQ ID NO: 1 is Y81H).
- the amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be H431X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 431.
- the new amino acid (X) at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, 3) may, for example, be Met, Ala, Val, Leu, Ile, Cy
- the amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- H for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or Ile).
- amino acid alteration at a position corresponding to position 431 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- H for leucine
- the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 , (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) may, for example, be T90X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 90.
- the new amino acid (X) at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 , (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, 3) may, for example, be Met, Ala, Val, Leu, Ile, Cys, Ser
- the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 , (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 90 of SEQ ID NO:1, 2, or 3) may substitute the amino acid of SEQ ID NO: 1 (i.e.
- T for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu, Ile).
- a hydrophobic amino acid i.e. Met, Ala, Val, Leu, Ile.
- the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- T) for alanine i.e. the amino acid alteration at a position corresponding to position 90 of SEQ ID NO: 1 is T90A.
- the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be A172X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 172.
- the new amino acid (X) at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54 , 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 172 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Val, Leu, Ile, Cys,
- the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- A) for a neutral hydrophilic amino acid i.e. Cys, Ser, Thr, Asn, Gln
- the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- A) for threonine i.e. the amino acid alteration at a position corresponding to position 172 of SEQ ID NO: 1 is A172T.
- the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be M277X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 277.
- the new amino acid (X) at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 81 of SEQ ID NO:1, 2, or 3) may, for example, be Ala, Val, Leu, Ile, Cys
- the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- a basic amino acid i.e. His, Lys, Arg
- the amino acid alteration at a position corresponding to position 277 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may, for example, be L37X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 37.
- the new amino acid (X) at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 37 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Ile, Cys, Ser,
- the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54,361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- a neutral hydrophilic amino acid i.e. Cys, Ser, Thr, Asn or Gln
- amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- L) for glutamine i.e. the amino acid alteration at a position corresponding to position 37 of SEQ ID NO: 1 is L37Q.
- the amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be V174X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 174.
- the new amino acid (X) at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 174 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Leu, Ile, Cys
- the new amino acid (X) at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be a hydrophobic amino acid (i.e.
- the amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- V) for isoleucine i.e. the amino acid alteration at a position corresponding to position 174 of SEQ ID NO: 1 is V174I.
- the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be F601X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 601.
- the new amino acid (X) at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,2, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 601 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, Ile, Cy
- the new amino acid (X) at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be an aromatic acid (i.e.
- the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- F for tyrosine
- the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1 , 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may, for example, be T77X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 77.
- the new amino acid (X) at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18,19, 20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 77 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu,
- the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- T for a hydrophobic amino acid (i.e. Met, Ala, Val, Leu or Ile).
- a hydrophobic amino acid i.e. Met, Ala, Val, Leu or Ile.
- the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- T) for alanine i.e. the amino acid alteration at a position corresponding to position 77 of SEQ ID NO: 1 is T77A.
- the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be I92X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 92.
- the new amino acid (X) at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18,19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 92 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, Cy
- the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54 ,361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- a hydrophobic amino acid i.e. Met, Ala, Val, Leu or Ile
- the amino acid alteration at a position corresponding to position 92 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be F129X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 129.
- the new amino acid (X) at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18,19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310 corresponding to 129 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, I
- the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- a hydrophobic amino acid i.e. Met, Ala, Val, Leu or Ile
- the amino acid alteration at a position corresponding to position 129 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- F for leucine
- the amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383(or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may, for example, be Q579X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 579.
- the new amino acid (X) at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310 corresponding to 579 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, Ile, Cys
- the amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1 , 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- amino acid alteration at a position corresponding to position 579 of SEQ ID NO: 1, 2, 3 , 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may substitute the amino acid of SEQ ID NO: 1 (i.e.
- the amino acid alteration at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be F605X.
- the numbering of the new amino acid (X) in the new SHC/HAC enzyme variant may not be 605.
- the new amino acid (X) at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20 , 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34 , 55-296, 307-310 corresponding to 605 of SEQ ID NO:1, 2, or 3) may, for example, be Met, Ala, Val, Leu, Ile, Cy
- the new amino acid (X) at a position corresponding to position 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 may, for example, be an aromatic acid (i.e.
- the amino acid alteration at a position corresponding to position 605 of SEQ ID NO: 1 , 2, or 3 may substitute the amino acid of SEQ ID NO: 1 (i.e. F) for tryptophan (i.e. the amino acid alteration at a position corresponding to position 601 of SEQ ID NO: 1 is F605W).
- the SHC/HAC enzyme variant may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 132 and 432 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,2021, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 169, 306, 600, 132 and 432 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the SHC/HAC enzyme variant is as earlier defined herein and may have an amino acid alteration (e.g. substitution) at a position corresponding to position 169, 306, 600, 601 of SEQ ID NO: 1 , 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 601 of SEQ ID NO:1, 2, or 3).
- an amino acid alteration e.g. substitution
- the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 77, 92 and 129 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 77, 92, 129 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 579 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33.34, 55-296, 307-310 corresponding to 169, 306, 600, 579 and 601 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 129, 132 and 432 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 129, 132, 432 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 132, 432 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600, 132, 432, 601 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the SHC/HAC enzyme variant is as earlier defined herein and may have amino acid alterations (e.g. substitutions) at positions corresponding to positions 169, 306, 600, 129, 132, 432 and 601 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 169, 306, 600, 129, 132, 432, 601 of SEQ ID NO:1, 2, or 3).
- amino acid alterations e.g. substitutions
- the new SHC/HAC enzyme variants may, for example, exhibit attractive biological activities as earlier defined herein.
- the new enzyme variants may exhibit increased enzymatic activity for the conversion of EEH to (-)-Ambrox or the conversion of BisEEH to Ambra oxide compared to the SHC/HAC enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17,18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, or 307-310.
- Increased enzymatic activity may refer to any aspect of the enzymatic conversion of EEH to (-)-Ambrox or enzymatic conversion of BisEEH to Ambra oxide including, for example, increased total conversion of EEH or BisEEH, increased rate of conversion of EEH or BisEEH (e.g. in the first 3 hours or in the first 4 hours of reaction or in the first 5 hours of reaction), increased production of (-)-Ambrox or Ambra oxide, and decreased production of by-products.
- Increased enzymatic activity may be defined by increased productivity in general, which may be defined in terms of (-)-Ambrox or Ambra oxide produced per gram of biocatalyst, per hour and per liter of reaction.
- the SHC/HAC enzyme variant disclosed herein exhibits: - an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis- homofarnesol substrates are used, - an increased product selectivity for (-)-Ambrox (or Ambra oxide) when homofarnesol or bis- homofarnesol substrates are used, - an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the like – see, for example WO2021/110858 and WO2021/209482 respectively) - an increased productivity and/or - an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e
- wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 or 215G2 AacSHC or SHC#65 or a parent SHC enzyme the variant derives from such as those represented by SEQ ID NO:2, 3, 47-54).
- the new SHC/HAC enzyme variants as defined herein may, for example, provide increased EEH or E,E-bishomofarnesol (BisEEH) conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310. Therefore, the process described herein may have an increased level of EEH or BisEEH conversion compared to the process using the SHC/HAC wild-type enzyme of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310.
- the new SHC/HAC enzyme variants may, for example, provide increased rate of EEH or BisEEH conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310. Therefore, the process described herein may have an increased rate of EEH or BisEEH conversion compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18,19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310.
- the new SHC/HAC enzyme variants as defined herein may, for example, provide increased rate of EEH or BisEEH conversion over the first 4 hours or over the first 3 hours or over the first 4 hours or over the first 5 hours or over the first 6 hours of the reaction compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20,21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310.
- the process described herein may have an increased rate of EEH or BisEEH conversion over the first 3 hours or over the first 4 hours or over the first 5 hours or over the first 6 hours compared to the SHC/HAC wild-type enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310.
- This may be assessed using the new enzyme versus the reference enzyme under the same reaction conditions (e.g. same pH and temperature) or using each enzyme under its respective optimized reaction conditions (e.g. optimized pH and temperature) which may be different to each other.
- the new SHC/HAC enzyme variant as defined herein may provide or the process may have at least about 40 % EEH or BisEEH conversion in the first 6 hours of the reaction.
- the new SHC/HAC enzyme variant may provide or the process may have at least about 45 % or at least about 50 % or at least about 55 % or at least about 60 % EEH or BisEEH conversion in the first 6 hours of the reaction.
- the new SHC/HAC enzyme variant may provide or the process may have at least about 30 % EEH or BisEEH conversion in the first 5 hours of the reaction.
- the new SHC/HAC enzyme variant may provide or the process may have at least about 35 % or at least about 45 % or at least about 50 % or at least about 55 % EEH or BisEEH conversion in the first 6 hours of the reaction. This may be when compared to using both enzymes (i.e. the new SHC/HAC enzyme variant and the enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20,21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310) under the same reaction conditions (e.g. same pH and temperature) or when compared to using each enzyme under its respective optimized reaction conditions (e.g. optimized pH and temperature) which may be different to each other.
- both enzymes i.e. the new SHC/HAC enzyme variant and the enzyme of SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20,21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310
- the same reaction conditions e.g.
- the conversion of EEH to (-)-Ambrox or the conversion of BisEEH to Ambra oxide or the conversion of hydroxyfarnesylacetone to Amberketal may, for example, be determined using an activity assay as described above and may be calculated as gram of recoverable product per gram of feedstock (which can be calculated as a percent molar conversion rate).
- any reference herein to a 99%/100% conversion rate for a homofarnesol substrate to (-)-Ambrox is a reference to a 99%/100% conversion of the homofarnesol isomer (i.e. EEH) capable of conversion to (-)-Ambrox using a SHC/HAC enzyme or enzyme variant.
- any reference herein to a 99%/100% conversion rate for a bishomofarnesol substrate to Ambra oxide is a reference to a 99%/100% conversion of the bishomofarnesol isomer (i.e. BisEEH) capable of conversion to Ambra oxide using a SHC/HAC enzyme or enzyme variant.
- any reference herein to a 99%/100% conversion rate for a hydroxyfarnesyl substrate to Amberketal is a reference to a 99%/100% conversion of the hydroxyfarnesyl substrate capable of conversion to Amberketal using a SHC/HAC enzyme or enzyme variant.
- the production of Amberketal from a hydroxyfarnesylacetone substrate using a WT SHC enzyme or an SHC variant is disclosed in WO2021/209482, the contents of which is incorporated herein by reference.
- the optimum temperature range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein may, for example, be from about 250C to about 550C, from about 250C to about 500C, from about 300C to about 550C, or from about 300C to about 500C.
- the optimum temperature for the wild type SHC/HAC enzymes orthe SHC/HAC enzyme variants describe herein may, for example, be equal to or greater than about 350C.
- the optimum temperature for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may range from about 400C to about 500C, for example from about 420C to about 480C or from about 440C to about 460C.
- the optimum temperature of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may be about 450C.
- the processes for making (-)-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature of the SHC/HAC enzyme variant.
- the optimum pH range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may from about 5 to about 7, from about 5 to about 6.5, or from about 5 to about 6.
- the optimum pH for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may, for example, be equal to or greater than about 5.4.
- the optimum pH for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may range from about 5.2 to about 6.0, for example from about 5.4 to about 5.8, for example from about 5.6 to about 5.8.
- the optimum pH of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may be about 5.6 or about 5.8.
- the processes for making (-)-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum pH of the wild type SHC/HAC enzymes or the SHC/HAC enzyme variant.
- the optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the process for making (-)-Ambrox or Ambra oxide disclosed herein may, for example, be from about 0.005 w/w% to about 0.04 w/w%, from about 0.010 w/w% to about 0.10 w/w%.
- the optimum concentration of SDS may be from about 0.040 w/w% to about 0.080 w/w%, for example about 0.050 w/w% when the substrate (e.g. EEH or BisEEH) is used at 4 g/l with cells to an OD650nm of 10.
- the optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the processes for making (-)-Ambrox or Ambra oxide disclosed herein may, for example, be from about 1.0 w/w% to about 1.5 w/w% when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells.
- the optimum concentration of SDS may be from about 1.2 w/w% to about 1.4 w/w%, for example about 1.3 w/w% when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells.
- (-)-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature range or optimum temperature and/or the optimum pH range or optimum pH and/or the SDS optimum concentration range or optimum SDS concentration for the specific enzyme used, as set out in the Table 7 the Examples below.
- SHC/HAC enzyme variants as defined herein (of all types 1-34) derived from an Aac SHC/HAC enzyme variant exhibit improved biological activity such as improved enzymatic activity for the conversion of EEH to (-)-Ambrox and for the conversion of BisEEH to Ambra oxide.
- the new SHC/HAC enzyme variants have at least one, two or three amino acid alterations in addition to the amino acid substitutions already present in the 215G2 SHC/HAC (SEQ ID NO:3) or the SHC #65 (SEQ ID NO:2) enzyme variant.
- Additional SHC/HAC enzyme variants may have amino acid alterations (e.g.
- substitutions at positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, 3).
- enzyme variants derived from ZmoSHC1, ZmoSHC2, BjpSHC, GmoSHC, TelSHC, ApaSHC1, BmeSHC, SalSHC, or ApaSHCA having one or more of the new amino acid alterations identified at positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1 , 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,34, 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, 3) will also provide enzymatic activity for the conversion of EEH to (-)-Ambrox or BisEEH to Ambra oxide
- a SHC/HAC enzyme variant (also named variant of type 30) having at least about 70.0 % identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55-296, 307-310 corresponding to 169, 306, 600, 81, 90, 172, 277, 557, 613 of SEQ ID NO:1, 2, or 3).
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a process for preparing Ambra oxide or a mixture comprising Ambra oxide comprising enzymatically converting BisEEH or a mixture comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC variant having at least about 70.0 % identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 81, 90, 172, 277, 431, 557 and 613 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a SHC/HAC enzyme variant (also named variant of type 31) having at least about 70.0 % identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17,18, 19,20.21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 and/or 34, 55-296, 307-310 corresponding to 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO:1, 2, or 3).
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- a process for preparing Ambra oxide or a mixture comprising Ambra oxide comprising enzymatically converting BisEEH or a mixture comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC variant having at least about 70.0 % identity to a wild-type SHC/HAC enzyme amino acid sequence, wherein the SHC/HAC enzyme variant amino acid sequence has one or more amino acid alterations relative to the wild-type SHC/HAC enzyme at a position selected from positions corresponding to positions 169, 306, 600, 77, 92, 129, 579, 601, 605 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 and/or 34, 55-296, 307-310 corresponding
- the identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the identity of the amino acid substituting W169, A306 and G600 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53 and/or 54 (or at a position in an amino acid sequence of a wild type SHC/HAC enzyme as SEQ ID NO: 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 55-296, 307-310 corresponding to 169, 306, 600 of SEQ ID NO:1, 2, or 3) has already been disclosed herein. These specific key positions and identity of substituting amino acids are repeated below.
- the W at position 169 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, - the A at position 306 is replaced by V or a functional equivalent thereof and/or - the G at position 600 is replaced by A, V, L, I or M or a functional equivalent thereof, preferably wherein the G at position 600 is replace by M.
- the amino acid residue at position 168 has a large amino acid side chain (eg Tyrosine (Q), it is replaced by an amino acid residue with a smaller side chain (eg serine).
- amino acid residue at position 168 is a serine (S) residue
- S serine
- Table 10 conserved positions of amino acids located at the active site of the SHC/HAC (based on Aac SHC/HAC). conserveed positions can be seen for amino acid positions 169, 261, 312, 365, 489, 600, 609 and 612 for five different WT SHC enzymes. Differences in hydrogen binding pocket can be seen for Q, Y and C in ZmoSHC1, ZmoSHC2 and ScoSHC for the amino acid position 168.
- Homofarnesol may have isomerism as shown below. Table 11. Homofarnesol isomers. Beta-farnesene can be converted directly to E,E-homofarnesol (EEH) or indirectly to EEH via E,E- homofarnesate which is then converted to EEH.
- EH E,E-homofarnesol
- E,E- homofarnesate E,E- homofarnesate
- 3Z,7E) homofarnesol is a reference to E,Z-homofarnesol which is also designated as EZH. Whilst homofarnesol may be a mixture of four isomers, the (3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E) isomers, it seems from the literature that (-)-Ambrox is only obtained from (3E,7E) homofarnesol (see Neumann and Simon (1986) as cited above).
- a reference to (3E,7E)- homofarnesol is a reference to E,E-homofarnesol which is also designated as EEH.
- the starting materials for the processes described herein for preparing (-)-Ambrox may, for example, be (3E,7E)-homofarnesol or a mixture comprising (3E,7E)-homofarnesol, for example a mixture of isomers of homofarnesol comprising (3E,7E)-homofarnesol.
- the homofarnesol starting material comprises a mixture of (3E,7E) and (3Z,7E), termed herein an EE:EZ isomeric mixture.
- An EE:EZ isomeric mixture of homofarnesol has the CAS number of 35826- 67-6.
- the homofarnesol feedstock/starting material may be a mixture of isomers. Accordingly, the homofarnesol starting material may also comprise a mixture of the four isomers EE:EZ:ZZ:ZE which corresponds with (3E,7E), (3Z,7E), (3Z,7Z) and (3E,7Z).
- the homofarnesol starting material is selected from one of more of the following mixture: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)].
- the homofarnesol starting material is selected from one or more of the following mixtures: [(3E,7E), (3Z,7E)] and/or [(3Z,7E), (3E/7E) and (3E,7Z)], also designated [EE:EZ] and [EE:EZ:ZE] respectively.
- the ratio of EEH:EZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11 ; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38: 61:39; 60:40; 59:41; 58:42; 57:43; 56:44; 55:45: 54:46; 53:47: 52:48; 51:49; or about 50:
- the ratio of EEH:EZH may range from about 50:50 to about 100:00 or from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the homofarnesol starting material comprises >90% E,E-homofarnesol (EEH).
- the homofarnesol starting material comprises an EE:EZ weight ratio of 86:14.
- the homofarnesol starting material comprises an EE:EZ weight ratio of 80:20.
- the homofarnesol starting material comprises an EE:EZ weight ratio of 70:30.
- the homofarnesol starting material comprises an EE:EZ weight ratio of 69:31.
- the number of homofarnesol isomers present may influence the speed of the reaction.
- a SHC/HAC enzyme or enzyme variant may be capable of converting E,E-homofarnesol to (-)- Ambrox from a complex mixture of homofarnesol isomers (e.g. EE:EZ:ZE:ZZ).
- the homofarnesol substrate may comprise a isomeric mixture of 2-4 isomers, preferably two isomers. Accordingly, the homofarnesol substrate may consist of or consist essentially of a isomeric mixture of 2-4 isomers, preferably two isomers.
- the homofarnesol substrate comprises an EE:EZ isomeric mixture.
- the homofarnesol substrate consists of or consists essentially of an EE:EZ isomeric mixture. If, for example, an EE:EZ isomer mixture is used, then compounds (eg compounds II, III and IV as set out in Table 3) other than (-)-Ambrox are in an “oily” form (rather than a solid form) which facilates the stirring of the reaction mixture and ths resulting bioconversion process.,
- a reduced cell:homofarnesol substrate ratio may be used leading to a reduction in the amount of solid material (eg cells and (- )-Ambrox)) in the reaction mixture which is advantageous not only for the stirrability of the reaction mixture but also for downstream processing (especially as regards filtration) as
- a cell to EEH ratio of 0.5 or 0.4 or 0.3 or 0.2 or 0.1 is used.
- the EEH conversion is of at least 50%, 60%, 70%, 80%, 90%, 95% or 98%.
- such a cell to EEH ratio is used even when 100 or 150 or 200 or even 250 g/l EEH is present.
- concentration of EEH is used a conversion of up to 4.5 or 5.0 or 5.5 or even 5.9 or 6.0 g of EEH is converted per gram of cells.
- EEH may be present in a mixture with other isomer of homofarnesol as described herein. We refer to the total concentration of EEH present even if other isomer of homofarnesol may be present.
- BISHOMOFARNESOL Bishomofarnesol may have isomerism as shown in Table 12 below. Table 12. Bishomofarnesol isomers.
- Bishomofarnesol may be produced from E-Nerolidol as described in WO 2021/110848.
- bishomofarnesol may be produced as a mixture of two or more isomers (e.g. a mixture of E,E-bishomofarnesol and E,Z-bishomofarnesol). Whilst bishomofarnesol may present as a mixture of four isomers (the (Z,Z), (E,Z), (Z,E) and (E,E) isomers) it seems that Ambra oxide is only obtained from E,E-bishomofarnesol.
- the starting materials for the processes described herein for preparing Ambra oxide may, for example, be E,E-bishomofarnesol or a mixture comprising E,E-bishomofarnesol, for example a mixture of isomers of bishomofarnesol comprising E,E-bishomofarnesol.
- the bishomofarnesol starting material comprises a mixture of (BisEEH) and (BisEZH), termed herein an EE:EZ isomeric mixture.
- the bishomofarnesol feedstock/starting material may be a mixture of isomers. Accordingly, the bishomofarnesol starting material may also comprise a mixture of the four isomers EE:EZ:ZZ:ZE.
- the ratio of BisEEH:BisEZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11 ; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38: 61:39; 60:40; 59:41; 58:42; 57:43; 56:44; 55:45: 54:46; 53:47: 52:48; 51:49; or about
- the ratio of BisEEH:BisEZH may range from about 50:50 to about 100:00 or from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the bishomofarnesol starting material comprises >90% E,E- bishomofarnesol (EEH).
- the bishomofarnesol starting material comprises an BisEEH:BisEZH weight ratio of 86:14.
- the bishomofarnesol starting material comprises a BisEEH:BisEZH weight ratio of 80:20.
- the bishomofarnesol starting material comprises a BisEEH:BisEZH weight ratio of 70:30. In further embodiments, the bishomofarnesol starting material comprises an BisEEH:BisEZH weight ratio of 69:31 or 65:35
- the number of bishomofarnesol isomers present may influence the speed of the reaction.
- a SHC/HAC enzyme or enzyme variant may be capable of converting E,E-bishomofarnesol to Ambra oxide from a complex mixture of bishomofarnesol isomers (e.g. EE:EZ:ZE:ZZ).
- the bishomofarnesol substrate may comprise a isomeric mixture of 2-4 isomers, preferably two isomers. Accordingly, the bishomofarnesol substrate may consist of or consist essentially of a isomeric mixture of 2-4 isomers, preferably two isomers. Preferably the bishomofarnesol substrate comprises an EE:EZ isomeric mixture.
- the bishomofarnesol substrate consists of or consists essentially of an EE:EZ isomeric mixture.
- NUCLEIC ACIDS AND METHODS OF MAKING NUCLEIC ACIDS there is further provided herein nucleic acids encoding a SHC/HAC enzyme variant as described herein. (of types 1 to 30).
- the nucleic acid may, for example, be an isolated nucleic acid.
- a construct comprising a nucleic acid sequence encoding a SHC/HAC enzyme variant as described herein.
- a “construct” is an artificially created segment of nucleic acid that is to be transfected into a target cell.
- the construct may comprise the nucleic acid encoding the SHC/HAC enzyme or enzyme variant and an expression controller (e.g. promoter).
- an expression controller e.g. promoter
- a vector comprising a construct as described herein.
- a “vector” is a DNA molecule that is used as a vehicle to artificially carry foreign genetic material into a cell where it can be replicated and/or expressed.
- the vector may, for example, be a plasmid, a viral vector, a cosmid, or an artificial chromosome.
- construct and “vector” may overlap, for example where the construct is a plasmid.
- SEQ ID NO: 38 is the nucleotide sequence encoding the AacSHC P1 represnted by SEQ ID NO:4.
- SEQ ID NO: 39 is the nucleotide sequence encoding the AacSHC P2 represnted by SEQ ID NO:5.
- SEQ ID NO: 40 is the nucleotide sequence encoding the AacSHC P3 represnted by SEQ ID NO:6.
- SEQ ID NO: 41 is the nucleotide sequence encoding the SHC#65 P1 variant represented by SEQ ID NO:7.
- SEQ ID NO: 42 is the nucleotide sequence encoding the SHC#65 P2 variant represented by SEQ ID NO:8.
- SEQ ID NO: 43 is the nucleotide sequence encoding the SHC#65 P3 variant represented by SEQ ID NO:9.
- SEQ ID NO: 44 is the nucleotide sequence encoding the 215G2 P1 variant represented by SEQ ID NO:10.
- SEQ ID NO: 45 is the nucleotide sequence encoding the 215G2 P2 variant represented by SEQ ID NO:11.
- SEQ ID NO: 46 is the nucleotide sequence encoding the 215G2 P3 variant represented by SEQ ID NO:12.
- nucleic acid or “nucleic acid molecule” as used herein shall specifically refer to polynucleotides of the disclosure which can be DNA, cDNA, genomic DNA, synthetic DNA, or RNA, and can be double-stranded or single-stranded, the sense and/or an antisense strand.
- nucleic acid or “nucleic acid molecule” shall particularly apply to the polynucleotide(s) as used herein, e.g. as full-length nucleotide sequence or fragments or parts thereof, which encode a polypeptide with enzymatic activity, e.g. an enzyme of a metabolic pathway, or fragments or parts thereof, respectively.
- the term also includes a separate molecule such as a cDNA where the corresponding genomic DNA has introns and therefore a different sequence; a genomic fragment that lacks at least one of the flanking genes; a fragment of cDNA or genomic DNA produced by polymerase chain reaction (PCR) and that lacks at least one of the flanking genes; a restriction fragment that lacks at least one of the flanking genes; a DNA encoding a non-naturally occurring protein such as a fusion protein (e.g. a His tag), mutein, or fragment of a given protein; and a nucleic acid which is a degenerate variant of a cDNA or a naturally occurring nucleic acid.
- a separate molecule such as a cDNA where the corresponding genomic DNA has introns and therefore a different sequence
- a genomic fragment that lacks at least one of the flanking genes
- Fusion proteins can add one or more amino acids (such as but not limited to Histidine (His)) to a protein, usually at the N-terminus of the protein but also at the C-terminus or fused within regions of the protein.
- Histidine Histidine
- Such fusion proteins or fusion vectors encoding such proteins typically serve three purposes: (i) to increase production of recombinant proteins; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by providing a ligand for affinity purification.
- nucleic acid or “nucleic acid molecule” also includes codon optimised sequences suitable for expression in a particular microbial host cell (e.g. E. coli host cell).
- codon optimized means a nucleic acid protein coding sequence which has been adapted for expression in a prokaryotic or a eukaryotic host cell, particularly bacterial host cells such as E. coli host cells by substitution of one or more or preferably a significant number of codons with codons that are more frequently used in bacterial (e.g. E. coli) host cell genes.
- nucleotide sequence encoding the reference amino acid sequence (SEQ ID NO: 1 or 2 or 3 or the gene can be codon-optimized for the selected host organisms, such as e.g. E. coli.
- a nucleotide sequence encoding the wild type Aac SHC (SEQ ID NO:1) is SEQ ID NO:35.
- a nucleotide sequence encoding the parent SHC (SEQ ID NO:2) is SEQ ID NO:36.
- a nucleotide sequence encoding the other patent SHC (SEQ ID NO:3) is SEQ ID NO:37.
- a ribonucleic acid (RNA) molecule can be produced by in vitro transcription.
- Segments of DNA molecules are also considered within the scope of the disclosure, and can be produced by, for example, the polymerase chain reaction (PCR) or generated by treatment with one or more restriction endonucleases.
- Segments of a nucleic acid molecule may be referred to as DNA fragments of a gene, in particular those that are partial genes.
- a fragment can also contain several open reading frames (ORF), either repeats of the same ORF or different ORF's.
- ORF open reading frames
- the term shall specifically refer to coding nucleotide sequences, but shall also include nucleotide sequences which are non- coding, e.g. untranscribed or untranslated sequences, or encoding polypeptides, in whole or in part.
- a reference to an isolated DNA does not mean a DNA present among hundreds to millions of other DNA molecules within, for example, cDNA or genomic DNA libraries or genomic DNA restriction digests in, for example, a restriction digest reaction mixture or an electrophoretic gel slice.
- An isolated nucleic acid molecule of the present disclosure encompasses segments that are not found as such in the natural state.
- isolated DNA can refer to (1) a DNA that contains sequence not identical to that of any naturally occurring sequence, a polynucleotide or nucleic acid which is not naturally occurring, (e.g. is made by the artificial combination (e.g. artificial manipulation of isolated segments of nucleic acids, e.g. by genetic engineering techniques) of two otherwise separated segments of sequences through human intervention) or (2), in the context of a DNA with a naturally-occurring sequence (e.g. a cDNA or genomic DNA), a DNA free of at least one of the genes that flank the gene containing the DNA of interest in the genome of the organism in which the gene containing the DNA of interest naturally occurs.
- a DNA with a naturally-occurring sequence e.g. a cDNA or genomic DNA
- isolated DNA as used herein, specifically with respect to nucleic acid sequences may also refer to nucleic acids or polynucleotides produced by recombinant DNA techniques, e.g. a DNA construct comprising a polynucleotide heterologous to a host cell, which is optionally incorporated into the host cell.
- a chimeric nucleotide sequence may specifically be produced as a recombinant molecule.
- recombination shall specifically apply to assembly of polynucleotides, joining together such polynucleotides or parts thereof, with or without recombination to achieve a cross-over or a gene mosaic.
- a recombinant gene encoding a polypeptide described herein may include the coding sequence for that polypeptide, operably linked, in sense orientation, to one or more regulatory regions suitable for expressing the polypeptide. Because many microorganisms are capable of expressing multiple gene products from a polycistronic mRNA, multiple polypeptides can be expressed under the control of a single regulatory region for those microorganisms, if desired.
- a coding sequence and a regulatory region are considered to be operably linked when the regulatory region and coding sequence are positioned so that the regulatory region is effective for regulating transcription or translation of the sequence.
- recombinant as used herein, specifically with respect to enzymes shall refer to enzymes produced by recombinant DNA techniques, i.e. produced from cells transformed by an exogenous DNA construct encoding the desired enzyme.
- synthetic enzymes are those prepared by chemical synthesis. A chimeric enzyme may specifically be produced as recombinant molecule.
- recombinant DNA therefore includes a recombinant DNA incorporated into a vector into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote (or the genome of a homologous cell, at a position other than the natural chromosomal location).
- nucleic acid molecule(s) of the present disclosure is/are operatively linked to expression control sequences allowing expression in prokaryotic and/or eukaryotic host cells.
- operatively linked means incorporated into a genetic construct so that expression control sequences effectively control expression of a coding sequence of interest.
- the transcriptional/translational regulatory elements referred to above include but are not limited to inducible and non-inducible, constitutive, cell cycle regulated, metabolically regulated promoters, enhancers, operators, silencers, repressors and other elements that are known to those skilled in the art and that drive or otherwise regulate gene expression.
- Such regulatory elements include but are not limited to regulatory elements directing constitutive expression or which allow inducible expression like, for example, CUP-1 promoter, the tet-repressor as employed, for example, in the tet-on or tet-off systems, the lac system, the trp system regulatory elements.
- Isopropyl ⁇ -D-1-thiogalactopyranoside (IPTG) is an effective inducer of gene expression in the concentration range of 100 ⁇ to 1.0 mM.
- IPTG Isopropyl ⁇ -D-1-thiogalactopyranoside
- This compound is a molecular mimic of allolactose, a lactose metabolite that triggers transcription of the lac operon, and it is therefore used to induce gene expression when the gene is under the control of the lac operator.
- nucleic acid molecule(s) of the present disclosure can form part of a hybrid gene encoding additional polypeptide sequences, for example, a sequence that functions as a marker or reporter.
- marker and reporter genes including beta-lactamase, chloramphenicol acetyltransferase (CAT), adenosine deaminase (ADA), aminoglycoside phosphotransferase dihydrofolate reductase (DHFR), hygromycin-B-phosphotransferase (HPH), thymidine kinase (TK), lacZ (encoding beta- galactosidase), and xanthine guanine phosphoribosyltransferase (XGPRT).
- additional useful reagents for example, additional sequences that can serve the function of a marker or reporter.
- the present disclosure provides a recombinant polynucleotide encoding the SHC/HAC enzyme or variant thereof, which may be inserted into a vector for expression and optional purification.
- a vector is a plasmid representing a circular double stranded DNA loop into which additional DNA segments are ligated.
- Certain vectors can control the expression of genes to which they are functionally linked. These vectors are called "expression vectors".
- expression vectors suitable for DNA recombination techniques are of the plasmid type.
- an expression vector comprises a gene such as the SHC/HAC enzyme or variant thereof as described herein.
- plasmid and "vector” may be used interchangeably since the plasmid is the vector type most often used.
- vectors can include DNA sequences which include but are not limited to DNA sequences that are not naturally present in the host cell, DNA sequences that are not normally transcribed into RNA or translated into a protein ("expressed") and other genes or DNA sequences which one desires to introduce into the non-recombinant host. It will be appreciated that typically the genome of a recombinant host described herein is augmented through the stable introduction of one or more recombinant genes. However, autonomous or replicative plasmids or vectors can also be used within the scope of this disclosure.
- the present disclosure can be practiced using a low copy number, e.g. a single copy, or high copy number (as exemplified herein) plasmid or vector.
- the vector of the present disclosure includes plasmids, phagemids, phages, cosmids, artificial bacterial and artificial yeast chromosomes, knock-out or knock-in constructs, synthetic nucleic acid sequences or cassettes and subsets may be produced in the form of linear polynucleotides, plasmids, megaplasmids, synthetic or artificial chromosomes, such as plant, bacterial, mammalian or yeast artificial chromosomes.
- the diverse gene substrates may be incorporated into plasmids.
- the plasmids are often standard cloning vectors, e.g. bacterial multicopy plasmids.
- the substrates can be incorporated into the same or different plasmids.
- at least two different types of plasmid having different types of selectable markers are used to allow selection for cells containing at least two types of vectors.
- bacterial or yeast cells may be transformed with any one or more nucleotide sequences as is well known in the art.
- the gene to be recombined with the genome or other genes is used to transform the host using standard transforming techniques.
- DNA providing an origin of replication is included in the construct.
- the origin of replication may be suitably selected by the skilled person.
- a supplemental origin of replication may not be required if sequences are already present with the genes or genome that are operable as origins of replication themselves.
- HOST CELLS METHODS OF MAKING HOST CELLS, AND METHODS OF MAKING AMBROX AND AMBRA OXIDE USING HOST CELLS
- a recombinant host cell comprising a nucleic acid sequence or a construct or a vector as described herein.
- a recombinant host cell that produces a SHC/HAC enzyme or enzyme variant as described herein.
- a recombinant host cell may also be named an engineered cell or a cell.
- the processes described herein for producing (-)-Ambrox or Ambra oxide may, for example, comprise culturing a recombinant host cell as described herein.
- the term “culturing” refers to a process of producing living cells such that they produce a SHC/HAC enzyme or enzyme variant as described herein (such as those of the types 1 to 30) that can be used in a process for producing (-)-Ambrox or Ambra oxide as described herein. It is not necessary for the cells to divide and replicate themselves, although this is not excluded.
- a bacterial or yeast cell may be transformed by exogenous or heterologous DNA when such DNA has been introduced inside the cell.
- the transforming DNA may or may not be integrated, i.e. covalently linked into the genome of the cell. In prokaryotes, and yeast, for example, the transforming DNA may be maintained on an episomal element such as a plasmid.
- a stably transfected cell is one in which the transfected DNA has become integrated into a chromosome so that it is inherited by daughter cells through chromosome replication. This stability is demonstrated by the ability of the eukaryotic cell to establish cell lines or clones comprised of a population of daughter cells containing the transforming DNA.
- the introduced DNA is not originally resident in the host that is the recipient of the DNA, but it is within the scope of the disclosure to isolate a DNA segment from a given host, and to subsequently introduce one or more additional copies of that DNA into the same host, e.g. to enhance production of the product of a gene or alter the expression pattern of a gene.
- the introduced DNA will modify or even replace an endogenous gene or DNA sequence, e.g. by homologous recombination or site-directed mutagenesis.
- Suitable recombinant hosts include microorganisms, plant cells, and plants.
- the present disclosure also features recombinant hosts.
- the term "recombinant host”, also referred to as a "genetically modified host cell” or a “transgenic cell” denotes a host cell that comprises a heterologous nucleic acid or the genome of which has been augmented by at least one incorporated DNA sequence.
- a host cell of the present disclosure may be genetically engineered with the polynucleotide or the vector as outlined above.
- the host cells that may be used for purposes of the disclosure include but are not limited to prokaryotic cells such as bacteria (for example, E. coli and B. subtilis), which may, for example, be transformed with, for example, recombinant bacteriophage DNA, plasmid DNA, bacterial artificial chromosome, or cosmid DNA expression vectors containing the polynucleotide molecules of the disclosure; simple eukaryotic cells like yeast (for example, Saccharomyces and Pichia), which may, for example, be transformed with, for example, recombinant yeast expression vectors containing the polynucleotide molecule of the disclosure.
- prokaryotic cells such as bacteria (for example, E. coli and B. subtilis), which may, for example, be transformed with, for example, recombinant bacteriophage DNA, plasmid DNA, bacterial artificial chromosome, or cosmid DNA expression vectors containing the polynucleotide molecules of the disclosure
- the polynucleotide can integrate, for example, into the chromosome or the mitochondrial DNA or can be maintained extrachromosomally like, for example, episomally or can be only transiently comprised in the cells.
- the term "cell" as used herein in particular with reference to genetic engineering and introducing one or more genes or an assembled cluster of genes into a cell, or a production cell is understood to refer to any prokaryotic or eukaryotic cell.
- Prokaryotic and eukaryotic host cells are both contemplated for use according to the disclosure, including bacterial host cells like E. coli or Bacillus sp, yeast host cells, such as S.
- the cell is a eukaryotic cell, preferably a fungal, mammalian or plant cell, or a prokaryotic cell.
- Suitable eukaryotic cells include, for example, without limitation, mammalian cells, yeast cells, or insect cells (including Sf9), amphibian cells (including melanophore cells), or worm cells including cells of Caenorhabditis (including Caenorhabditis elegans).
- Suitable mammalian cells include, for example, without limitation, COS cells (including Cos-1 and Cos-7), CHO cells, HEK293 cells, HEK293T cells, HEK293 T-RexTM cells, or other transfectable eucaryotic cell lines.
- Suitable bacterial cells include without limitation E. coli.
- prokaryotes such as E. coli, Bacillus, Streptomyces, or mammalian cells, like HeLa cells or Jurkat cells, or plant cells, like Arabidopsis, may be used.
- the cell may, for example, be selected from prokaryotic, yeast, plant, and/or insect host cells.
- the cell is an Aspergillus sp.
- the cell preferably, it can be selected from the group consisting of the genera Saccharomyces, Candida, Kluyveromyces, Hansenula, Schizosaccharomyces, Yarrowia, Pichia and Aspergillus.
- the cell us a bacteria cells, for example, having a genus selected from Escherichia, Streptomyces, Bacillus, Pseudomonas, Lactobacillus and Lactococcus.
- the bacteria may be E. coli.
- the E. coli host cell is an E. coli host cell which is recognized by the industry and regulatory authorities (including but not limited to an E. coli K12 host cell or an E.
- the recombinant host may be a recombinant E. coli host cell.
- E. coli which may be recombinantly prepared as described herein.
- the recombinant host may be a recombinant E. coli host cell.
- the recombinant E. coli microorganism comprises nucleotide sequences encoding SHC/HAC enzyme or enzyme variant genes.
- the recombinant E. coli microorganism comprises a vector construct as described herein.
- the recombinant E. coli microorganism comprises nucleotide sequences encoding the SHC/HAC enzymes and enzyme variants disclosed herein.
- Another preferred host cell to use with the present disclosure is S. cerevisiae which is a widely used chassis organism in synthetic biology.
- the recombinant host may be S. cerevisiae.
- Culturing of cells may be performed in a conventional manner.
- the culture medium may contain a carbon source, at least one nitrogen source and inorganic salts, and vitamins are added to it.
- the constituents of this medium can be the ones which are conventionally used for culturing the species of microorganism in question.
- Carbon sources of use in the instant method include any molecule that can be metabolized by the recombinant host cell to facilitate growth and/or production of (-)-Ambrox or Ambra oxide. Examples of suitable carbon sources include, but are not limited to, sucrose (e.g. as found in molasses), fructose, xylose, glycerol, glucose, cellulose, starch, cellobiose or other glucose containing polymer.
- carbon sources such as sucrose, fructose, xylose, ethanol, glycerol, and glucose are suitable.
- the carbon source can be provided to the host organism throughout the cultivation period or alternatively, the organism can be grown for a period of time in the presence of another energy source, e.g. protein, and then provided with a source of carbon only during the fed-batch phase.
- Another energy source e.g. protein
- the suitability of a recombinant host cell microorganism for use in the methods of the present disclosure may be determined by simple test procedures using well known methods. For example, the microorganism to be tested may be propagated in a rich medium (e.g.
- LB-medium Bacto- tryptone yeast extract medium, nutrient medium and the like
- recombinant host cells i.e. recombinant host cells
- the products are typically produced by a production host cell line on the large scale by suitable expression systems and fermentations, e.g. by microbial production in cell culture.
- a defined minimal medium such as M9A is used for cell cultivation.
- the components of M9A medium comprise: 14 g/l KH 2 PO 4 , 16 g/l K 2 HPO 4 , 1 g/l Na 3 Citrate.2H 2 O, 7.5 g/l (NH 4 ) 2 SO 4 , 0.25 g/l MgSO 4 .7H 2 O, 0.015 g/l CaCl 2 .2H 2 O, 5 g/l glucose and 1.25 g/l yeast extract).
- nutrient rich medium such as LB was used.
- the components of LB medium comprise: 10 g/l tryptone, 5 g/l yeast extract, 5 g/l NaCl.
- a minimal medium may be prepared as follows: for 350 ml culture: to 35 ml citric acid/phosphate stock (133 g/l KH2PO4, 40 g/l (NH4)2HPO4, 17 g/l citric acid.H 2 O with pH adjusted to 6.3) was added 307 ml H2O, the pH adjusted to 6.8 with 32% NaOH as required. After autoclaving 0.850 ml 50% MgSO 4 , 0.035 ml trace elements solution (see below) solution, 0.035 ml Thiamin solution and 7 ml 20% glucose were added.
- Trace elements solution 50 g/l Na2EDTA.2H2O, 20 g/l FeSO 4 .7H 2 O, 3 g/l H 3 BO 3 , 0.9 g/l MnSO 4 .2H 2 O, 1.1 g/l CoCl 2 , 80 g/L CuCl 2 , 240 g/l NiSO 4 .7H 2 O, 100 g/l KI, 1.4 g/l (NH 4 ) 6 Mo 7 O 24 .4H 2 O, 1 g/l ZnSO 4 .7H 2 O, in deionized water
- Thiamin solution 2.25 g/l Thiamin.HCl in deionized water
- MgSO 4 solution 50 % (w/v) MgSO 4 .7H 2 O in deionized water
- the recombinant microorganism may be grown in a batch, fed batch or continuous process or combinations thereof.
- the recombinant microorganism is grown in a fermentor at a defined temperature(s) in the presence of a suitable nutrient source, e.g. a carbon source, for a desired period of time to produce sufficient enzyme to convert homofarnesol to Ambrox or to convert bishomofarnesol to Ambra oxide and to produce a desired amount of Ambrox including (-)-Ambrox or a desired amount of Ambra oxide of formula (X).
- the recombinant host cells may be cultivated in any suitable manner, for example by batch cultivation or fed-batch cultivation.
- the term "batch cultivation” is a cultivation method in which culture medium and/or nutrients is/are neither added nor withdrawn during the cultivation.
- the term "fed-batch” means a cultivation method in which culture medium and/or nutrients is/are added during the cultivation but no culture medium is withdrawn.
- One embodiment of the present disclosure provides a method (or a process) of producing (-)- Ambrox or Ambra oxide in a cellular system comprising producing SHC/HAC enzymes or enzyme variants under suitable conditions in a cellular system, adding homofarnesol or bishomofarnesol to the cellular system, converting homofarnesol to (-)-Ambrox or converting bishomofarnesol to Ambra oxide using the SHC/HAC enzymes or enzyme variants produced using the cellular system, collecting (-)-Ambrox or Ambra oxide from cellular system and optionally isolating the (- )-Ambrox materials or Ambra oxide of formula (X) from the system.
- each of the SHC/HAC enzyme variants earlier disclosed herein may be used in this process, (especially each of the types 1-30 disclosed earlier herein) of SHC/HAC enzyme variants.
- a process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)- Ambrox using an SHC/HAC enzyme variant amino acid sequence that has amino acid alterations relative to SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 at positions
- a process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)- Ambrox using a SHC/HAC enzyme variant having an amino acid sequence with at least 30%, identity or similarity to SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ
- the identity or similarity may be at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the amino acid alterations in the SHC/HAC variants used in said process are the following: - the W at position 169 of SEQ ID NO: 1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, - the A at position 306 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by V or a functional equivalent thereof and
- the amino acid alterations in the SHC/HAC variants used in said process are the following: - the amino acid at position 168 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is S or the amino acid at a position in an amino acid sequence of a wild type SHC corresponding to 168 of SEQ ID NO:1, 2, 3, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is S.
- the SHC/HAC variants used in said process are the following: - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5, 6 or 350 and have mutation W169G or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5 , 6 or 350 and have the following mutations: W169G and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5 ,6 or 350 and has at least one of the following mutations: W169G and A306V or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO
- the identity or similarity may be at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- the amino acid alterations in the SHC/HAC variants used in said process have an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11, 12, 305, 306, 302, 304, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 350, 386 or 385.
- the amino acid alterations in the SHC/HAC variants used in said process have an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351 or 352.
- Expression of other nucleotide sequences may serve to enhance the method.
- the bioconversion method can include the additional expression of other nucleotide sequences in the cellular system.
- a further embodiment of the present disclosure is a bioconversion method of making (-)-Ambrox or Ambra oxide comprising growing host cells comprising SHC/HAC enzyme or enzyme variant genes, producing SHC/HAC enzyme variants in the host cells, feeding homofarnesol (e.g. EEH) or bishomofarnesol (e.g.
- the recombinant host cell microorganism may be cultured in a number of ways in order to provide cells in suitable amounts producing the SHC/HAC enzymes or enzyme variants for the subsequent bioconversion step. Since the microorganisms applicable for the bioconversion step vary broadly (e.g. yeasts, bacteria and fungi), culturing conditions are, of course, adjusted to the specific requirements of each species and these conditions are well known and documented. Any of the art known methods for growing cells of recombinant host cell microorganisms may be used to produce the cells utilizable in the subsequent bioconversion step of the present disclosure. Typically, the cells are grown to a particular density (measurable as optical density (OD)) to produce a sufficient biomass for the bioconversion reaction.
- OD optical density
- the cultivation conditions chosen influence not only the amount of cells obtained (the biomass) but the quality of the cultivation conditions also influences how the biomass becomes a biocatalyst.
- the recombinant host cell microorganism expressing the SHC/HAC enzyme or enzyme variant gene and producing the SHC/HAC enzyme or enzyme variant is termed a biocatalyst which is suitable for use in a bioconversion reaction.
- the biocatalyst is a recombinant whole cell producing SHC/HAC enzymes or enzyme variants or it may be in suspension or an immobilized format.
- the biocatalyst is a membrane fraction or a liquid fraction prepared from the recombinant whole cell producing the SHC/HAC enzyme or enzyme variant (as disclosed for example in Seitz et al 2012 - as cited above).
- the recombinant biocatalyst producing SHC/HAC enzymes or enzyme variants includes whole cells collected from the fermenter (for the bioconversion reaction) or the cells in the fermenter (which are then used in a one-pot reaction).
- a substrate e.g. homofarnesol or bishomofarnesol
- the SHC/HAC enzymes or enzyme variants may also be in an immobilized form (e.g. associated with an enzyme carrier) which allows the SHC/HAC enzymes or enzyme variants to interact with a substrate (e.g. homofarnesol or bishomofarnesol).
- a substrate e.g. homofarnesol or bishomofarnesol.
- the SHC/HAC enzymes or enzyme variants may also be used in a soluble form.
- the process of the disclosure is carried out using recombinant whole cells as biocatalyst.
- the use of whole cells in the appropriate amount is advantageous because (i) the integrity of the SHC enzyme (which is membrane associated) appears to be maintained; and (ii) the cells may have a positive contribution in the distribution of an oily (ie liquid) substrate in the reaction.
- the use of a recombinant whole cell as biocatalyst may assist in thedistribution of the substrate (which is in liquid form) but not the (-)-Ambrox product (which is in a solid form).
- the biocatalyst is produced in sufficient amounts (to create a sufficient biomass), harvested and washed (and optionally stored (e.g. refrigerated, frozen or lyophilized)) before starting the bioconversion step.
- the cells are produced in sufficient amounts (to create a sufficient biocatalyst) and the reaction conditions are then adjusted without the need to harvest and wash the biocatalyst for the bioconversion reaction.
- This one step (or "one pot") method is advantageous as it simplifies the process while possibly reducing costs.
- the culture medium used to grow the cells is also suitable for use in the bioconversion reaction provided that the reaction conditions are adjusted to facilitate the bioconversion reaction.
- the optimum pH for growing the cells is in the range of 6.0 - 7.0.
- the optimum pH for the bioconversion reaction is dependent on the type of SHC/HAC enzyme or enzyme variant used in the bioconversion reaction.
- the pH is regulated using techniques which are well known to the Skilled Person.
- the pH of the reaction mixture may be in the range of 4-8, preferably, 5 to 6.5, more preferably 4.8-6.0 for the SHC/HAC enzyme variants and in the range of from about pH 5.0 to about pH 7.0 for the wild-type SHC/HAC enzymes and can be maintained by the addition of buffers to the reaction mixture.
- Exemplary buffers for this purpose include but are not limited to a citric acid buffer, a phosphate buffer, an acetic acid buffer and/or a succinic acid buffer.
- the optimum pH range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants may from about 5 to about 7, from about 5 to about 6.5, or from about 5 to about 6.
- the preferred temperature is between from about 15°C and about 60°C, for example from about 15°C to about 50°C or from about 15°C to about 45°C or from about 30°C to about 60°C or from about 30°C to about 40°C or from about 35 C to about 40°C or or from about 40°C to about 45°C from about 40°C to about 50°C.
- the temperature can be kept constant or can be altered during the bioconversion process.
- the optimum temperature range for the wild type SHC/HAC enzymes or the SHC/HAC enzyme variants described herein may, for example, be from about 250C to about 550C, from about 250C to about 500C, from about 300C to about 550C, or from about 300C to about 500C.
- a solubilizing agent e.g. a surfactant, detergent, solubility enhancer, water miscible organic solvent and the like
- surfactant means a component that lowers the surface tension (or interfacial tension) between two liquids or between a liquid and a solid. Surfactants may act as detergents, wetting agents, emulsifiers, foaming agents, and dispersants.
- surfactants include but are not limited to Triton X-100, Tween 80, taurodeoxycholate, Sodium taurodeoxycholate, Sodium dodecyl sulfate (SDS), and/or sodium lauryl sulfate (SLS). Whilst Triton X-100 may be used to partially purify the SHC/HAC enzyme or enzyme variant (in soluble or membrane fraction/ suspension form), it may also be used in the bioconversion reaction (see for example the disclosure in Seitz (2012 PhD thesis as cited above) as well as the disclosure in Neumann and Simon (1986 - as cited above) and JP2009060799.
- the Applicant selected and identified SDS as a particularly useful solubilizing agent from a long list of other less useful solubilizing agents.
- the Applicant identified SDS as a remarkably better solubilizing agent than e.g. Triton X-100 in terms of reaction velocity and yield for the homofarnesol to (-)-Ambrox bioconversion reaction (when EEH is used at both 4 g/l and 125 g/l.
- At least one SHC/HAC derivative enzyme that maximal homofarnesol to (-)-Ambrox bioconversion activity with Triton X- 100 (at a concentration range of about 0.005% to 0.48%) in the reaction may be only around 20% of the activity obtained with SDS (at a concentration of about 0.07%) with EEH at 4 g/l and cells at an OD650nm of 10.
- the use of SDS with recombinant microbial host cells may be advantageous as the SDS may interact advantageously with the host cell membrane in order to make the SHC/HAC enzyme or enzyme variant (which is a membrane bound enzyme) more accessible to the homofarnesol substrate.
- the inclusion of SDS at a suitable level in the reaction mixture may improve the properties of the emulsion (homofarnesol in water) and/or improve the access of the homofarnesol substrate to the SHC enzyme within the host cell while at the same time preventing the disruption (e.g. denaturation of the SHC (WT or SHC/HAC variant) enzyme).
- concentration of the solubilising agent (e.g. SDS) used in the bioconversion reaction is influenced by the biomass amount and the substrate (EEH) concentration. That is, there is a degree of interdependency between the solubilising agent (e.g. SDS) concentration, the biomass amount and the substrate (EEH) concentration.
- biocatalyst and solubilising agent e.g. SDS
- solubilising agent e.g. SDS
- the solubilising agent concentration is too low, a suboptimal homofarnesol conversion may be observed.
- the solubilising agent e.g. SDS
- the solubilising agent e.g. SDS
- the solubilising agent e.g. SDS
- the solubilising agent (e.g. SDS) concentration is too high, then there may be a risk that the biocatalyst is affected through either the disruption of the intact microbial cell and/or denaturation/inactivation of the SHC/HAC enzyme or enzyme variant.
- a suitable concentration of SDS in the context of the biomass amount and, substrate (EEH) concentration is within the knowledge of the Skilled Person.
- a predictive model can be developed by the Skilled Person to determine the suitable SDS, substrate (EEH) and biomass concentrations.
- SDS in the range of 0.010-0.075% may be appropriate when 4g/l EEH and biocatalyst to an OD of 10.0 (650nm) are used.
- an adjusted SDS concentration (1.3%) may be appropriate.
- AacSHC) or SHC/HAC variant may be from about 250C to about 550C, from about 250C to about 500C, from about 300C to about 550C, or from about 300C to about 500Cm from about 30°C to about 60°C, for example from about 45°C to about 60°C, for example from about 50°C to about 60°C, for example about 55°C.
- the pH range of the bioconversion reaction for a WT SHC enzyme (eg. AacSHC) or SHC/HAC variant may be from about 5.0 to 7.0, from about 5 to about 6.5, or from about 5 to about 6, more preferably from about 5.6 to about 6.2, even more preferably about 6.0.
- the temperature of the bioconversion reaction for a SHC/HAC enzyme variant may be about 30°C to about 55°C, for example from about 40°C to about 50°C, for example about 45°C.
- the pH of the bioconversion reaction for a SHC/HAC enzyme variant may be about 4.8-6.4, preferably about 5.2-6.0.
- the solubilising agent used in the bioconversion reaction is SDS.
- the SDS concentration used in the bioconversion reaction for the WT SHC enzyme (e.g. AacSHC) may be in the range of about0.010-0.075%, preferably about 0.030% when EEH at about 4g/l and cells at an OD650nm of 10 is used.
- the SDS concentration used in the bioconversion reaction for the SHC/HAC enzyme variant may be in the range of about 0.005 w/w% to about 0.04 w/w%, from about 0.010 w/w% to about 0.10 w/w%, from about0.0025-0.090%, preferably about 0.050% when EEH at about 4g/l and cells at an OD650nm of 10 is used.
- the biocatalyst may be loaded to the reaction to an OD of about 10.0 (650nm) when the reaction is loaded with homofamesol at an EEH concentration of about 4 g/l EEH.
- the [SDS]/[cells] ratio may be in the range of about, 10:1-20:1, preferably about 15:1 -18:1, preferably about 16:1 when the ratio of biocatalyst to EEH homofamesol is about 2:1 in the bioconversion reaction.
- the SDS concentration in the bioconversion reaction for a SHC variant enzyme may be in the range of about 1-2%, preferably in the range of about 1.4-1.7%, even more preferably about 1.5% when the homofamesol concentration is about 125g/l EEH and the biocatalyst concentration is 250g/l (corresponding to an OD of about 175 (650nm)).
- the ratio of biocatalyst to EEH homofamesol substrate may be in the range of about 0.5:1 - 2:1, in some embodiments 2:1, preferably about 1:1 or 0.5:1.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.
- the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of of EEH:EZH is about 100:00; 99:01; 98:02; 97:03; 96:04; 95:05; 94:06; 93:07; 92:08; 91:09; 90:10; 89:11 ; 88:12; 87:13; 86:14; 85:15; 84:16; 83:17; 82:18; 81:19; 80:20; 79:21; 78:22; 77:23; 76:24; 75:25; 74:26; 73:27; 72:28; 71:29; 70:30; 69:31; 68:32; 67:33; 66:34; 65:35; 64:36; 63:37; 62:38:
- a cell (or biocatalyst) to EEH ratio of 0.5 or 0.4 or 0.3 or 0.2 or 0.1 is used.
- the EEH conversion is of at least 50%, 60%, 70%, 80%, 90%, 95% or 98%. In an embodiment, such a cell (or biocatalyst) to EEH ratio is used even when 100 or 150 or 200 or even 250 g/l EEH is present. In an embodiment when such cell (or biocatalyst) to EEH ratio is used and such concentration of EEH is used a conversion of up to 4.5 or 5.0 or 5.5 or even 5.9 or 6.0 g of EEH is converted per gram of cells (or biocatalyst). Such results have been obtained in the experimental part (see example 9).
- EEH may be present in a mixture with other isomer of homofarnesol as described herein. We refer to the total concentration of EEH present even if other isomer of homofarnesol may be present.
- Example 9 demonstrates, under certain reaction conditions using the SHC variants disclosed and described herein, the [cells]:[EEH] ratio was lowered further down to values of 0.3, 0.2, and 0.1. The reaction time was extended to approx.200 h to possibly allow for reaching a plateau in E,E-Homofarnesol conversion.
- Example 17 it was demonstrated that using 450 g/l EEH and a [cells]:[EEH] ratio of 0.4, full EEH conversion was obtained in 72 h. Full conversion was obtained in 24 h with 250 g/l EEH at [cells]:[EEH] ratio of 1.0. This indicated the possibility for full conversion of up to ⁇ 450 g/l EEH in 3 days using an appropriate amount of cells, and that this was possible with a [cells]:[EEH] ratio at least as low as 0.4 under the conditions tested.
- a process is provided wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 0.4 and the concentration of EEH is 450 g/l.
- a process wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is in a range of 0.1-0.5, preferably 0.4 and the concentration of EEH is in the range of 250g/l to 650g/l, preferably 450 g/l.
- a process wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture is 1 and the concentration of EEH is 250 g/l.
- This improvement can be attributed to an increase in total turnover number when certain SHC mutations (eg P2 mutations) are introduced into a reference SHC enzyme (eg SHC#65).
- This increased total turnover number may be the result of an increased catalytic potential or an increased stability of the new SHC variant (eg SHC#65 P2 enzyme variant), or a combination of the two.
- An increased stability may be the result of the optimal reaction conditions for the new SHC vaiant (eg SHC#65 P2) with significantly lower temperature and SDS concentration.
- the optimum temperature for the SHC/HAC enzyme variants may, for example, be equal to or greater than about 350C.
- the optimum temperature for the SHC/HAC enzyme variants may range from about 400C to about 500C, for example from about 420C to about 480C or from about 440C to about 460C.
- the optimum temperature of the SHC/HAC enzyme variants may be about 450C.
- the processes for making (-)-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum temperature of the SHC/HAC enzyme variant.
- the optimum pH for the SHC/HAC enzyme variants may, for example, be equal to or greater than about 5.4.
- the optimum pH for the SHC/HAC enzyme variants may range from about 5.2 to about 6.0, for example from about 5.4 to about 5.8, for example from about 5.6 to about 5.8.
- the optimum pH of the SHC/HAC enzyme variants may be about 5.6 or about 5.8.
- the process for making (-)-Ambrox or Ambra oxide disclosed herein may be carried out at the optimum pH of the SHC/HAC enzyme variant.
- the optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the process for making (-)-Ambrox or Ambra oxide disclosed herein may, for example, be from about 0.005 w/w% to about 0.04 w/w%, from about 0.010 w/w% to about 0.10 w/w%.
- the optimum concentration of SDS may be from about 0.040 w/w% to about 0.080 w/w%, for example about 0.050 w/w% when the substrate (e.g.
- EEH or BisEEH is used at 4 g/l with cells to an OD 650nm of 10
- the process for making (-)-Ambrox or Ambra oxide disclosed herein may be carried out using the optimum concentration of SDS described herein.
- the optimum concentration of sodium dodecyl sulfate (SDS) in the reaction medium of the processes for making (-)-Ambrox or Ambra oxide disclosed herein may, for example, be from about 1.0 w/w% to about 1.5 w/w% when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cells.
- the optimum concentration of SDS may be from about 1.2 w/w% to about 1.4 w/w%, for example about 1.3 w/w% when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 250 g/l of cellsor about 0.65 w/w% when the substrate (e.g. EEH or BisEEH) is used at 125 g/l with 125 g/l of cells.
- the substrate e.g. EEH or BisEEH
- the substrate e.g. EEH or BisEEH
- (-)-Ambrox or Ambra oxide disclosed herein may be carried out within the optimum temperature range or at the optimum temperature and/or within the optimum pH range or at the optimum pH and/or within the SDS optimum concentration range or at the optimum SDS concentration for the specific enzyme used, as set out in Table 15 in the Examples below.
- (-)-Ambrox is produced using a biocatalyst to which the homofamesol substrate is added.
- Ambra oxide is produced using a biocatalyst to which the bishomofamesol substrate is added. It is possible to add the substrate by feeding using known means (e.g. peristaltic pump, infusion syringe and the like).
- Homofamesol and bishomofarnesol may be oil soluble compounds and provided in an oil format.
- the biocatalyst microbial cells such as intact recombinant whole cell and/or cell debris and/or immobilised enzyme
- the bioconversion reaction may be regarded as a three phase system (comprising an aqueous phase, a solid phase and an oil phase) when homofarnesol or bishomofarnesol is added to the bioconversion reaction mixture. This is the case even when SDS is present.
- a soluble WT SHC or a SHC/HAC enzyme variant is used as a biocatalyst, this is considered a two phase system.
- a fermenter may be used to grow recombinant host cells expressing the SHC/HAC enzyme or enzyme variant gene and producing active SHC/HAC enzymes or enzyme variants to a sufficient biomass concentration suitable for use as a biocatalyst in the same fermenter vessel which is used to convert the homofarnesol source to (-)-Ambrox, for example in admixture with one or more of the by-products (II), (IV) and/or (III) or bishomofarnesol source to Ambra oxide, for exmaple in admixture with one or more of the by-products (XI), (XII) and/or (XIII).
- each molecule may be called a compound or a by-product depending on the context in which reference is made to said molecule.
- the wording “by-product” is used when said molecule is not desired but can be accepted under certain conditions in the end product. If a by- product is included in an end product (eg either alone or as part of a composition), it may be referred to as a compound rather than a by-product).
- a by-product may be acceptable in an end product if does not impact or substantially impact on the olfactory profile of the end product or the composition comprising the by-product.
- the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of (-)-Ambrox that using pure EEH as the sole substrate isomer allows for the production of (-)-Ambrox and undetectable by-product (IV), even though no further downstream processing (such asfiltration/selective crystallization/distillation) is carried out.
- the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of (-)-Ambrox that using pure EEH as the sole substrate isomer allows for the production of (-)-Ambrox.
- the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomer and so selective for the production of (-)-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows for the production of only (-)-Ambrox and by-product (III).
- the mixture comprises EEH and EZH.
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the SHC/HAC variants disclosed herein are so selective for an EEH substrate isomerand so selective for the production of (-)-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows the production of (-only (-)-Ambrox and at least by-product (II).
- the mixture comprises EEH and EZH.
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the SHC/HAC variants disclosed herein are so selective for EEH and so selective for the production of (-)-Ambrox that using a mixture of homofarnesol substrate isomers comprising at least two distinct substrate isomers being the EEH and the EZH isomers and being selected from one of more of the following mixtures: [(3Z,7Z), (3E,7Z), (3Z,7E) and (3E,7E)], [(3Z,7E) and (3E,7E)], [(3Z,7E), (3E,7Z)] and/or [(3E,7E) and (3E,7Z)] allows the production of only (-)-Ambrox and at least by-product III but wherein by-products (II) and (IV) are not detected.
- the mixture comprises EEH and EZH.
- the mixture is [(3E,7E), (3Z,7E)] also designated [EE:EZ] or EEH:EZH.
- the ratio of EEH:EZH within this mixture may range from about 50:50 to about 99:01 or from about 60:40 to about 99:1 or from about 70:30 to about 95:5 or from about 80:20 to about 95:5.
- the bioconversion of EEH into (-)-Ambrox or BisEEH to Ambra oxide in the presence of a recombinant host cell comprising a SHC/HAC enzyme or enzyme variant generates an (-)-Ambrox or Ambra oxide yield of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96
- the activity of the SHC/HAC enzyme or enzyme variant is defined via the reaction rate (amount of product/(amount of product + amount of remaining starting material)) x 100) in mol percent.
- the bioconversion of EEH into (-)-Ambrox or BisEEH into Ambra oxide in the presence of a SHC/HAC enzyme or enzyme variant produces an (-)-Ambrox or Ambra oxide yield of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83
- the yield and/or the reaction rate are determined over a defined time period of, for example, 4, 6, 8, 10, 12, 16, 20, 24, 36 or 48 hours, during which EEH is converted into (-)-Ambrox or BisEEH is converted into Ambra oxide by a recombinant host cell comprising a nucleotide sequence encoding a SHC/HAC enzyme or enzyme variant.
- the reaction is carried out under precisely defined conditions of, for example, 25°C, 30°C, 40°C, 50°C or 60°C.
- the yield and/or the reaction rate are determined by carrying out the reaction of converting EEH into (-)-Ambrox or BisEEH into Ambra oxide by the SHC/HAC enzymes or enzyme variants according to the invention at 35°C over a period of 24-72 hours.
- a recombinant host cell comprising a nucleotide sequence encoding a SHC/HAC enzyme variant is characterized in that it shows a 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16-, 17-, 18-, 19-, 20-, 21-, 22-, 23-, 24-, 25-, 26-, 27-, 28-, 29-, 30-, 31-, 32-, 33-, 34-, 35-, 36-, 37-, 38-, 39-, 40-, 41-, 42-, 43-, 44-, 45-, 46-, 47-, 48-, 49-, 50-, 51-, 52-, 53-, 54-, 55-, 56-, 57-, 58-, 59-, 60-, 61-, 62-, 63-, 64-, 65-, 66-, 67-, 68-, 69-,
- condition relates to reaction conditions such as substrate concentration, enzyme concentration, reaction period and/or temperature.
- the successful development of a bioconversion process for making (-)-Ambrox from homofamesol in a recombinant strain of E. coli comprising a nucleotide sequence encoding a WT/reference SHC or a SHC/HAC derivative can offer a low cost and industrially economical process for (-)-Ambrox production.
- reaction products made by the processes described herein.
- the reaction products may, for example, comprise, consist essentially of of consist of (-)-Ambrox and one or more further compounds, for example one or more of a compound of formula (II), a compound of formula (III) and a compound of formula (IV).
- Ambrox includes (-)-Ambrox of formula (I) below as well as (-)-Ambrox in isomerically pure form or in a mixture with one or more of the following molecules of formula (II), (III), and/or (IV),
- the nomenclature for the reaction products of formulae (I), (II), (III), and (IV) is set out below. Table 13. Nomenclature for the reaction products of formulae (I), (II), (III) and (IV).
- (-)-Ambrox is known commercially as Ambrox (Firmenich), Ambroxan (Henkel), Ambrofix (Givaudan), Amberlyn (Quest), Cetalox Laevo (Firmenich), Ambermor (Aromor) and/or Norambrenolide Ether ( Pacific).
- (-)-Ambrox is an industrially important aroma compound and has been used in the fragrance industry for a long time.
- the special desirable sensory benefits from (-)-Ambrox come from the (- ) isomer rather than the (+) one.
- the odour of the (-) isomer is described as musk-like, woody, warm or ambery whereas the (+)-Ambrox enantiomer has a relatively weak odour note.
- the odour and odour thresholds for Ambrox like products are also different. While various (-)-Ambrox enriched materials are available commercially, it is desirable to produce highly enriched (-)- Ambrox materials, ideally pure (-)-Ambrox.
- the processes described herein may make (-)-Ambrox of formula (I) alone or in a mixture with by-products such as the compounds shown in formulae (II), (III) and/or (IV) above.
- (-)- Ambrox can be produced from sclareolide according to the production process as described below. Sclareol is a product extracted from the natural plant clary sage.
- (-)-Ambrox may also be synthesized from homofarnesol using different routes.
- homofarnesol can be obtained by brominating, cyanating, and hydrolysing nerolidol to give homofarnesylic acid, followed by reduction.
- homofarnesol may be obtained from farnesol, farnesylchloride, beta-farnesene or other substrates.
- the processes described herein may make (-)-Ambrox of formula (I) alone or in a mixture with by-products such as the compound shown in formulae (II), (III) and/or (IV).
- other stereoisomers of formula (I) may be made by the processes described herein.
- compositions described herein for example the compositions obtained by obtainable by the processes described herein may comprise homofarnesol (e.g. EEH, for example in addition to the compound of formula (I) and/or compounds of formula (II), (III) and/or (IV)). Any remaining homofarnesol may be separated from the other reaction products such that the (-)-Ambrox product does not comprise homofarnesol. In other embodiments, all of the homofarnesol starting material is converted to (-)-Ambrox of formula (I) or a by-product of the reaction by the processes described herein.
- homofarnesol e.g. EEH
- Any remaining homofarnesol may be separated from the other reaction products such that the (-)-Ambrox product does not comprise homofarnesol.
- all of the homofarnesol starting material is converted to (-)-Ambrox of formula (I) or a by-product of the reaction by the processes described herein.
- compositions described herein may comprise, consist essentially of or consist of one or more of a compound of formula (I), a compound of formula (II), a compound of formula (III), a compound of formula (IV), homofarnesol starting material (e.g. EEH) and other stereoisomers of the compound of formula (I).
- the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and one or more of a compound of formula (II), a compound of formula (III) and a compound of formula (IV).
- the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and of a compound of formula (II) and a compound of formula (III).
- the compound of formula (IV) when only the EE homofarnesol isomer is present in the bioconversion reaction, the compound of formula (IV) is not detectable even though no isolation/purification/ downstream processing steps has been carried out.
- the compositions described herein may comprise, consist essentially of or consist of a compound of formula (I) and a compound of formula (III). Therefore, in an embodiment, when the EE/ EZ homofarnesol isomers are present in the bioconversion reaction the compound of formula (II) and (IV) are not detectable even though no purification/ downstream processing steps had been carried out.
- compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).
- compositions described herein may comprise equal to or greater than about 55 wt% or equal to or greater than about 60 wt% or equal to or greater than about 65 wt% or equal to or greater than about 70 wt% or equal to or greater than about 75 wt% or equal to or greater than about 80 wt% or equal to or greater than about 85 wt% or equal to or greater than about 90 wt% or equal to or greater than about 95 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).
- compositions described herein may, for example, comprise equal to or less than about 100 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).
- the mixture may comprise equal to or less than about 99 wt% or equal to or less than about 98 wt% or equal to or less than about 97 wt% of the compound of formula (I) based on the total weight of compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).
- compositions described herein may comprise from about 50 wt% to about 100 wt% or from about 60 wt% to about 99 wt% or from about 70 wt% to about 98 wt% or from about 80 wt% to about 97 wt% or from about 90 wt% to about 97 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV).
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) in the compositions described herein may, for example, range from about 60:40 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II), the compound of formula (III) and the compound of formula (IV) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.
- the compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II) and the compound of formula (III).
- compositions described herein may comprise equal to or greater than about 55 wt% or equal to or greater than about 60 wt% or equal to or greater than about 65 wt% or equal to or greater than about 70 wt% or equal to or greater than about 75 wt% or equal to or greater than about 80 wt% or equal to or greater than about 85 wt% or equal to or greater than about 90 wt% or equal to or greater than about 95 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II) and the compound of formula (III).
- compositions described herein may, for example, comprise equal to or less than about 100 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II) and the compound of formula (III).
- the mixture may comprise equal to or less than about 99 wt% or equal to or less than about 98 wt% or equal to or less than about 97 wt% of the compound of formula (I) based on the total weight of compound of formula (I), the compound of formula (II) and the compound of formula (III).
- compositions described herein may comprise from about 50 wt% to about 100 wt% or from about 60 wt% to about 99 wt% or from about 70 wt% to about 98 wt% or from about 80 wt% to about 97 wt% or from about 90 wt% to about 97 wt% of the compound of formula (I) based on the total weight of the compound of formula (I), the compound of formula (II) and the compound of formula (III).
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II) and the compound of formula (III) in the compositions described herein may, for example, range from about 60:40 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II) and the compound of formula (III) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (II) and the compound of formula (III) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.
- the compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt% of the compound of formula (I) based on the total weight of the compound of formula (I) and the compound of formula (III).
- compositions described herein may comprise equal to or greater than about 55 wt% or equal to or greater than about 60 wt% or equal to or greater than about 65 wt% or equal to or greater than about 70 wt% or equal to or greater than about 75 wt% or equal to or greater than about 80 wt% or equal to or greater than about 85 wt% or equal to or greater than about 90 wt% or equal to or greater than about 95 wt% of the compound of formula (I) based on the total weight of the compound of formula (I) and the compound of formula (III).
- compositions described herein may, for example, comprise equal to or less than about 100 wt% of the compound of formula (I) based on the total weight of the compound of formula (I) and the compound of formula (III).
- the mixture may comprise equal to or less than about 99 wt% or equal to or less than about 98 wt% or equal to or less than about 97 wt% of the compound of formula (I) based on the total weight of compound of formula (I) and the compound of formula (III).
- compositions described herein may comprise from about 50 wt% to about 100 wt% or from about 60 wt% to about 99 wt% or from about 70 wt% to about 98 wt% or from about 80 wt% to about 97 wt% or from about 90 wt% to about 97 wt% of the compound of formula (I) based on the total weight of the compound of formula (I) and the compound of formula (III).
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (III) in the compositions described herein may, for example, range from about 60:40 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (III) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1.
- the weight ratio of the compound of formula (I) to the total weight of the compound of formula (III) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.
- the weight ratio of the compound of formula (I) to homofarnesol (e.g. EEH) in the compositions described herein may, for example, range from about 90:10 to about 100:0.
- the weight ratio of the compound of formula (I) to homofarnesol (e.g. EEH) in the compositions described herein may range from about 92:8 to about 100:0 or from about 94:6 to about 100:0 or from about 95:5 to about 100:0 or from about 96:4 to about 99.5:0.5 or from about 97:3 to about 99.0:1.0 or from about 98:2 to about 99.0:1.0.
- the amount of the compound of formula (I), the compound of formula (II), the compound of formula (III) and the compound of formula (IV) in a mixture of stereoisomers may, for example, be quantified by gas chromatography and/or identified by NMR spectroscopy.
- (-)-Ambrox as synthesized by the processes described herein e.g. using SHC/HAC enzymes or variants thereof and optionally recombinant host cells
- the solid form may be amorphous form or in crystalline form.
- the (-)-Ambrox produced by the methods described herein e.g.
- SHC/HAC enzymes or variants thereof and optionally recombinant host cells may be isolated by steam extraction/distillation or organic solvent extraction using a non-water miscible solvent (to separate the reaction products and unreacted substrate from the biocatalyst which stays in the aqueous phase) followed by subsequent evaporation of the solvent to obtain a crude reaction product as determined by gas chromatographic (GC) analysis.
- GC gas chromatographic
- (-)-Ambrox is present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase (of the reaction mixture (eg unreacted homofarnesol and/or by products (II and/or III and/or IV) and/or reaction buffer) by means of filtration (eg using a belt filter or press filters or any filter of appropriate mesh size).
- the solid phase of the reaction mixture that may comprise (-)-Ambrox can be separated from the liquid phase by, for example, centrifugation.
- (-)-Ambrox may be extracted from the solid phase (eg cell material, debris and (-)-Ambrox crystals) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene).
- a water miscible solvent for example ethanol
- a non-water miscible solvent for example toluene
- the resulting (-)-Ambrox may be extracted from the solid phase of the reaction mixture using a mixture of solvents (eg water miscible and non water miscible solvents).
- (-)-Ambrox can also be extracted from the whole reaction mixture where it is extracted with a non- water miscible solvent (for example toluene).
- Suitable water miscible and non-water miscible organic solvents suitable for use in the extraction and/or selective crystallization of (-)-Ambrox include but are not limited to aliphatic hydrocarbons, preferably those having 5 to 8 carbon atoms, such as pentane, cyclopentane, hexane, cyclohexane, heptane, octane or cyclooctane, halogenated aliphatic hydrocarbons, preferably those having one or two carbon atoms, such as dichloromethane, chloroform, carbon tetrachloride, dichloroethane or tetrachloroethane, aromatic hydrocarbons, such as benzene, toluene, the xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic and cyclic ethers or alcohols, preferably those having 4 to 8 carbon atoms, such as ethanol, isopropan
- the solvents which are especially preferably used are the abovementioned heptane, Methyl tert-butyl ether (also known as MTBE, tert-butyl methyl ether, tertiary butyl methyl ether and tBME), diisopropyl ether, tetrahydrofuran, ethyl acetate and/or mixtures thereof.
- a water miscible solvent such as ethanol is used for the extraction of (-)-Ambrox from the solid phase of the reaction mixture.
- ethanol is advantageous because it is easy to handle, it is non-toxic and it is environmentally friendly.
- the resulting (-)-Ambrox may be extracted from the whole reaction mixture using an organic solvent such as a non-water miscible solvent (for example toluene).
- a non-water miscible solvent for example toluene
- the resulting (-)-Ambrox may be extracted from the solid phase of the reaction mixture (obtained by, for example, centrifugation or filtration) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene).
- the resulting (-)-Ambrox may be extracted from the solid phase of the reaction mixture using a mixture of solvents.
- (-)-Ambrox is present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase also by means of filtration.
- the (-)-Ambrox may form an oil layer on top of aqueous phase, which oil layer can be removed and collected.
- an organic solvent may be added to the aqueous phase containing the biomass in order to extract any residual (-)-Ambrox contained in, or on or about the biomass.
- the organic layer can be combined with the oil layer, before the whole is further processed to isolate and purify (-)-Ambrox.
- the (-)-Ambrox may be further selectively crystallised to remove by-products (II), (IV) and (III) and any unreacted homofarnesol substrate from the final (-)-Ambrox product.
- selective crystallization refers to a process step whereby (-)-Ambrox is caused to crystallise from a solvent whilst the compounds (II), (III) and (IV) remain dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only (-)-Ambrox product, or if it contains any of the other compounds (II), (III) or (IV), then they are present only in olfactory acceptable amounts.
- the (-)-Ambrox may, for example, be free or substantially free of by-products (II), (III) and (IV).
- the selective crystallisation step may use a water miscible solvent such as ethanol or the like.
- the selective crystallisation of (-)-Ambrox may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of (-)-Ambrox to the other detectable by-products (II), (III) and/or (IV). Even if only 10% conversion of the homofarnesol substrate to (-)-Ambrox is obtained, the selective crystallisation of (-)-Ambrox is still possible. In the event that by-products (II) and/or (IV) may not be produced, the (-)-Ambrox may be further selectively crystallised to remove all or substantially all of by-product (III) and any unreacted homofarnesol substrate from the final (-)-Ambrox product.
- selective crystallization refers to a process step whereby (-)-Ambrox is caused to crystallise from a solvent whilst the compound (III) remains dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only (-)-Ambrox product, or if it contains compound (III), then it is present only in olfactory acceptable amounts.
- the (-)-Ambrox may, for example, be free or substantially free of by-products (III).
- the selective crystallisation step may use a water miscible solvent such as ethanol or the like.
- the selective crystallisation of (-)-Ambrox may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of (-)-Ambrox to the other detectable by-product (III), Even if only 10% conversion of the homofarnesol substrate to (-)- Ambrox is obtained, the selective crystallisation of (-)-Ambrox is still possible.
- the olfactive purity of the final (-)-Ambrox product may be determined using a 10% ethanol extract in water or by testing the crystalline material. The final (-)-Ambrox product is tested against a commercially available reference of (-)-Ambrox product for its olfactive purity, quality and its sensory profile.
- the (-)-Ambrox material is also tested in application studies by experts in order to determine if the material meets the specifications with respect to its organoleptic profile.
- the term “olfactively pure” as it is used in relation to (-)-Ambrox is intended to mean that (-)- Ambrox is free of compounds (II), (III) or (IV), or any other material found in the reaction mixture, or that if such compounds or materials should be present, they are present in olfactory acceptable amounts, as that term is defined herein.
- (-)-Ambrox in olfactively pure form contains less than 5% by weight of any of the compounds (II), (III) and/or (IV).
- (-)-Ambrox in olfactively pure form contains less than 5% by weight of any of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture.
- (-)-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight of each of the compounds (II), (III) and/or (IV).
- (-)-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight of each of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture.
- (-)-Ambrox in olfactively pure form contains less than 4%, less than 3%, less than 2%, less than 1%, less than 0.9%, less than 0.8%, less than 0.7%, less than 0.6%, less than 0.5%, less than 0.4%, less than 0.3%, less than 0.2%, less than 0.1%, or less than 0.05% by weight but greater than 0% of each of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture
- the quality of separation of (-)-Ambrox from the mixture of the compounds (II), (III) and/or (IV) by selective crystallization may be influenced by the composition of the mixture from which it is separated.
- the quality of the separation of (-)-Ambrox from a mixture of compounds (II), (III) and/or (IV) by crystallization was improved when the weight ratio of (-)- Ambrox to the other compounds (II), (III) and (IV) in the mixture was greater than 70:30, more particularly 80:20, more particularly 90:10, still more particularly 95:5, and more particularly still 97:3.
- the quality of separation of (-)-Ambrox from the mixture of the compounds (II), (III), (IV) and/or any other material found in the reaction mixture by selective crystallization may be influenced by the composition of the mixture from which it is separated.
- the quality of the separation of (-)-Ambrox from a mixture of compounds (II), (III), (IV) and/or any other material found in the reaction mixture by crystallization was improved when the weight ratio of (-)-Ambrox to the other compounds (II), (III), (IV) and any other material found in the reaction mixture in the mixture was greater than 70:30, more particularly 80:20, more particularly 90:10, still more particularly 95:5, and more particularly still 97:3.
- the quality of the separation of (-)-Ambrox by crystallization may be influenced by the amount of unreacted homofarnesol present in the mixture from which it is separated.
- the quality of separation is improved when the level of unreacted homofarnesol is less than 30% by weight, more particularly less than 20 wt %, more particularly less than 10% by weight, more particularly still less than 5 wt % and still more particularly less than 3% by weight, still more particularly less than 2% by weight, and more particularly still less than 1% by weight, based on the weight of the mixture from which (-)-Ambrox is crystallized.
- the reagents and reaction conditions employed in the bioconversion process of the present invention are such that the reaction proceeds with 100% conversion of homofarnesol, or substantially so, thus leaving no unreacted homofarnesol in the bioconversion medium.
- homofarnesol if unreacted homofarnesol is present, although economically disadvantageous, it can be separated from (-)-Ambrox and other by-products by distillation, or washing crystals of (-)-Ambrox with a suitable solvent, for example. Accordingly, in a particular embodiment of the invention, there is provided a method of isolating and purifying (-)-Ambrox from a mixture comprising one or more of the compounds (II), (III) and (IV), which mixture is free, or substantially free, of homofarnesol.
- the isolation and purification of (-)-Ambrox from a mix-ture comprising one or more of the compounds (II), (III) and (IV), and free or substantially free of homofarnesol is achieved by the selective crystallization of (-)-Ambrox.
- (-)-Ambrox obtained according to a method of the present invention is obtained in olfacti-vely pure form.
- Olfactively pure (-)-Ambrox forms another aspect of the present invention.
- isolated refers to a bioconversion product such as (-)-Ambrox which has been separated or purified from components which accompany it.
- an entity that is produced in a cellular system different from the source from which it naturally originates is "isolated", because it will necessarily be free of components which naturally accompany it.
- the degree of isolation or purity can be measured by any appropriate method, e.g. gas chromatography (GC), HPLC or NMR analysis.
- GC gas chromatography
- HPLC HPLC
- NMR nuclear magnetic resonance
- the end product ((-)-Ambrox) is isolated and purified to homogeneity (e.g.
- the amount of (-)-Ambrox produced can be from about 1 mg/l to about 20,000 mg/1 (20g/l) or higher such as from about 20g/l to about 200g/l or from 100- 200g/l, preferably about 125g/l or 150g/l or about 188g/l or about 200g/l or about 250g/l or about 300g/l or about 350g/l or about 400g/l or about 450g/l.
- the amount of (-)-Ambrox produced can be from about 1 mg/l to about 20,000 mg/1 (20g/l) or higher such as from about 20g/l to about 200g/l or from 100- 200g/l, preferably about 125g/l or 150g/l or about 188g/l or about 200g/l or about 250g/l or about 300g/l or about 350g/l or about 400g/l or about 450g/l.
- At least 125g/l (-)-Ambrox may be produced in a bioconversion reaction using a recombinant E. coli host cell producing a SHC/HAC enzyme or enzyme variant over about 2 days.
- biocatalyst with improved activity and/or selectivity may improve or maintain productivity using less biomass or increasing substrate concentration which is advantageous with respect to mixing efficiencies.
- (-)-Ambrox at a concentration of at least 100g/l is produced within a period of time of from 48 to 72 hours.
- (-)-Ambrox at a concentration of about 150g/l is produced within a time period of from about 48 to 72 hours.
- (-)-Ambrox at a concentration of about 200g/l is produced within a time period of from about 48 to 72 hours.
- (-)-Ambrox at a concentration of about 250g/l is produced within a time period of from about 48 to 72 hours.
- (-)-Ambrox at a concentration of about 300g/l is produced within a time period of from about 48 to 72 hours.
- (-)-Ambrox at a concentration of about 400g/l is produced within a time period of from about 48 to 72 hours.
- (-)-Ambrox at a concentration of about 450g/l is produced within a time period of from about 48 to 72 hours.
- the bioconversion of homofarnesol to (-)-Ambrox according to the present disclosure produces (-)-Ambrox as a predominant compound but may also produce compounds other than (-)-Ambrox which may or may not impart pleasant olfactive notes to the bioconversion mixture and so may contribute in a positive or negative manner to the sensory character of the (-)-Ambrox end product. Accordingly, a sensory analysis is carried out using well established sensory tests utilized by trained Experts (e.g.
- (-)-Ambrox examples include but are not limited to a fine fragrance or a consumer product such as fabric care, toiletries, beauty care and cleaning products, detergent products, and soap products, including essentially all products where the currently available Ambrox ingredients are used commercially, including but not limited to: Ambrox (Firmenich), Ambroxan (Henkel), Ambrofix (Givaudan), Amberlyn (Quest), Cetalox Laevo (Firmenich), Ambermor (Aromor) and Norambrenolide Ether (Pacific) products.
- Ambrox Firmenich
- Ambroxan Hexan
- Ambrofix Gaudan
- Amberlyn Quest
- Cetalox Laevo Firmenich
- Ambermor Aromor
- Norambrenolide Ether Pacific
- a product comprising (-)-Ambrox obtained by or obtainable by a process described herein.
- the product may, for example, be a fragrance or a cosmetic or a consumer product.
- AMBRA OXIDE AND USES THEREOF there is further provided herein the reaction products made by the processes described herein.
- the reaction products may, for example, comprise, consist essentially of of consist of Ambra oxide and one or more further compounds, for example one or more of a compound of formula (XI), a compound of formula (XII) and a compound of formula (XIII).
- Ambra oxide includes Ambra oxide of formula (X) below as well as Ambra oxide of formula (X) in isomerically pure form or in a mixture with one or more of the following molecules of formula (XI), (XII) and/or (XIII),
- the nomenclature for the reaction products of formulae (X), (XI), (XII) and (XIII) is set out below. Table 14. Nomenclature for the reaction products of formulae (X), (XI), (XII) and (XIII).
- Ambra oxide can be produced from (+)-Larixol as described in Bolster et al., Tetrahedron, 2002, 58(26), pages 5275-5285.
- compositions described herein for example the compositions obtained by obtainable by the processes described herein may comprise bishomofarnesol (e.g. bisEEH, for example in addition to the compound of formula (X) and/or compounds of formula (XI), (XII) and/or (XIII)). Any remaining homofarnesol may be separated from the other reaction products such that the Ambra oxide product does not comprise bishomofarnesol. In other embodiments, all of the bishomofarnesol starting material is converted to Ambra oxide of formula (X) or a by-product of the reaction by the processes described herein.
- bishomofarnesol e.g. bisEEH, for example in addition to the compound of formula (X) and/or compounds of formula (XI), (XII) and/or (XIII)
- Any remaining homofarnesol may be separated from the other reaction products such that the Ambra oxide product does not comprise bishomofarnesol.
- all of the bishomofarnesol starting material is converted to
- compositions described herein may comprise, consist essentially of or consist of one or more of a compound of formula (X), a compound of formula (XI), a compound of formula (XII), a compound of formula (XIII), bishomofarnesol starting material (e.g. bisEEH) and other stereoisomers of the compound of formula (X).
- the compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and one or more of a compound of formula (XI), a compound of formula (XII) and a compound of formula (XIII).
- compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and one or more of a compound of formula (XI), a compound of formula (XII).
- compositions described herein may comprise, consist essentially of or consist of a compound of formula (X) and a compound of formula (XII)
- Example 12 demonstrates that the SHC/HAC variants described herein exhibit: - an increased substrate specificity for E,E-Bis-homofarnesol (see Figure 10), when a bis- homofarnesol substrate is used - an increased product selectivity for the E,E isomer of Bis-homofarnesol, when a bis- homofarnesol substrates are used, - an increased degree of conversion of BisEEH) as well as an increased conversion rate of BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6 hours) of the reaction, compared to the reference SHC enzyme (e.g.
- wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18,19,20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131
- compositions described herein may therefore comprise equal to or greater than about equal to or greater than about 50 wt% of the compound of formula(X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).
- compositions described herein may comprise equal to or greater than about 55 wt% or equal to or greater than about 60 wt% or equal to or greater than about 65 wt% or equal to or greater than about 70 wt% or equal to or greater than about 75 wt% or equal to or greater than about 80 wt% or equal to or greater than about 85 wt% or equal to or greater than about 90 wt% or equal to or greater than about 95 wt% of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).
- compositions described herein may, for example, comprise equal to or less than about 100 wt% of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).
- the mixture may comprise equal to or less than about 99 wt% or equal to or less than about 98 wt% or equal to or less than about 97 wt% of the compound of formula (X) based on the total weight of compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).
- compositions described herein may comprise from about 50 wt% to about 100 wt% or from about 60 wt% to about 99 wt% or from about 70 wt% to about 98 wt% or from about 80 wt% to about 97 wt% or from about 90 wt% to about 97 wt% of the compound of formula (X) based on the total weight of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII).
- the weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) in the compositions described herein may, for example, range from about 60:40 to about 99:1.
- the weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) may range from about 65:35 to about 99:1 or from about 70:30 to about 99:1 or from about 75:25 to about 99:1 or from about 80:20 to about 99:1 or from about 85:15 to about 99:1 or from about 90:10 to about 99:1 or from about 95:5 to about 99:1.
- the weight ratio of the compound of formula (X) to the total weight of the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) may range from about 65:35 to about 98:2 or from about 70:30 to about 97:3 or from about 75:25 to about 96:4 or from about 80:20 to about 95:5 or from about 85:15 to about 90:10.
- the weight ratio of the compound of formula (X) to bishomofarnesol (e.g. bisEEH) in the compositions described herein may, for example, range from about 90:10 to about 100:0.
- the weight ratio of the compound of formula (X) to bishomofarnesol e.g.
- bisEEH in the compositions described herein may range from about 92:8 to about 100:0 or from about 94:6 to about 100:0 or from about 95:5 to about 100:0 or from about 96:4 to about 99.5:0.5 or from about 97:3 to about 99.0:1.0 or from about 98:2 to about 99.0:1.0.
- the amount of the compound of formula (X), the compound of formula (XI), the compound of formula (XII) and the compound of formula (XIII) in a mixture of stereoisomers may, for example, be quantified by gas chromatography and/or identified by NMR spectroscopy. Ambra oxide synthesized by the processes described herein (e.g.
- SHC/HAC enzymes or variants thereof and optionally recombinant host cells may, for example, be present in the solid phase. It may be in amorphous form or crystalline form.
- the Ambra oxide produced by the methods described herein e.g. using SHC/HAC enzymes or variants thereof and recombinant host cells
- GC gas chromatographic
- the resulting Ambra oxide may be extracted from the whole reaction mixture using an organic solvent such as a non-water miscible solvent (for example toluene).
- the resulting Ambra oxide may be extracted from the solid phase of the reaction mixture (obtained by, for example, centrifugation or filtration) using a water miscible solvent (for example ethanol) or a non-water miscible solvent (for example toluene).
- Ambra oxide is formed as solid. It may be present in the solid phase as crystals or in amorphous form and can be separated from the remaining solid phase (cell material or debris thereof) and the liquid phase also by means of filtration.
- the Ambra oxide may form an oil layer on top of aqueous phase, which oil layer can be removed and collected.
- an organic solvent may be added to the aqueous phase containing the biomass in order to extract any residual Ambra oxide contained in, or on or about the biomass.
- the organic layer can be combined with the oil layer, before the whole is further processed to isolate and purify Ambra oxide.
- the Ambra oxide may be further selectively crystallised to remove by-products (XI), (XII) and (XIII) and any unreacted bishomofarnesol substrate from the final Ambra oxide product.
- selective crystallization refers to a process step whereby Ambra oxide is caused to crystallise from a solvent whilst the compounds (XI), (XII) and (XIII) remain dissolved in the crystallising solvent to such an extent that isolated crystalline material contains only Ambra oxide product, or if it contains any of the other compounds (X), (XII) or (XIII), then they are present only in olfactory acceptable amounts.
- the Ambra oxide may, for example, be free or substantially free of by-products (XI), (XII) and (XIII).
- the selective crystallisation step may use a water miscible solvent such as ethanol or the like.
- the selective crystallisation of Ambra oxide may be influenced by the presence of unreacted homofarnesol substrate and also the ratio of Ambra oxide to the other detectable by-products (XI), (XII) and/or (XIII). Even if only 10% conversion of the homofarnesol substrate to Ambra oxide is obtained, the selective crystallisation of Ambra oxide is still possible.
- the olfactive purity of the final Ambra oxide product may be determined using a 10% ethanol extract in water or by testing the crystalline material. The final Ambra oxide product is tested against a commercially available reference of Ambra oxide product for its olfactive purity, quality and its sensory profile.
- suitable water miscible and non-water miscible organic solvents suitable for use in the extraction and/or selective crystallization of Ambra oxide include but are not limited to aliphatic hydrocarbons, preferably those having 5 to 8 carbon atoms, such as pentane, cyclopentane, hexane, cyclohexane, heptane, octane or cyclooctane, halogenated aliphatic hydrocarbons, preferably those having one or two carbon atoms, such as dichloromethane, chloroform, carbon tetrachloride, dichloroethane or tetrachloroethane, aromatic hydrocarbons, such as benzene, toluene, the xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic and
- the solvents which are especially preferably used are the abovementioned heptane, Methyl tert-butyl ether (also known as MTBE, tert-butyl methyl ether, tertiary butyl methyl ether and tBME), diisopropyl ether, tetrahydrofuran, ethyl acetate and/or mixtures thereof.
- Methyl tert-butyl ether also known as MTBE, tert-butyl methyl ether, tertiary butyl methyl ether and tBME
- diisopropyl ether diisopropyl ether
- tetrahydrofuran ethyl acetate
- a water miscible solvent such as ethanol is used for the extraction of Ambra oxide from the solid phase of the reaction mixture.
- ethanol is advantageous because it is easy to handle, it is non-toxic and it is environmentally friendly.
- isolated refers to a bioconversion product such as Ambra oxide which has been separated or purified from components which accompany it.
- An entity that is produced in a cellular system different from the source from which it naturally originates is “isolated", because it will necessarily be free of components which naturally accompany it.
- the degree of isolation or purity can be measured by any appropriate method, e.g. gas chromatography (GC), HPLC or NMR analysis.
- GC gas chromatography
- HPLC HPLC
- NMR nuclear magnetic resonance
- the amount of Ambra oxide produced can be from about 1 mg/l to about 20,000 mg/1 (20g/l) or higher such as from about 20g/l to about 200g/l or from 100- 200g/l, preferably about 125g/l or 150g/l or about 188g/l.
- Ambra oxide at a concentration of at least 100g/l is produced within a period of time from 48 to 72 hours.
- Ambra oxide at a concentration of about 150g/l is produced within a time period of from about 48 to 72 hours.
- Ambra oxide at a concentration of about 200g/l is produced within a time period of from about 48 to 72 hours.
- Ambra oxide at a concentration of about 250g/l is produced within a time period of from about 48 to 72 hours.
- the bioconversion of bishomofarnesol to Ambra oxide produces Ambra oxide as a predominant compound but may also produce compounds other than Ambra oxide which may or may not impart pleasant olfactive notes to the bioconversion mixture and so may contribute in a positive or negative manner to the sensory character of the Ambra oxide end product. Accordingly, a sensory analysis is carried out using well established sensory tests utilized by trained Experts (e.g. Perfumers) so that the testing can assist in determining if a chemically relevant product is also an olfactively relevant end product relative to a reference product.
- the removal of one of more by-product compounds from Ambra oxide can improve the odor of the remaining compound (Ambra oxide) even if the removed compounds are actually odorless compounds per se.
- an Ambra oxide odor enhancement may be observed in the absence of compounds XI, XII and XIII.
- Various applications for Ambra oxide include but are not limited to a fine fragrance or a consumer product such as fabric care, toiletries, beauty care and cleaning products, detergent products, and soap products, including essentially all products where the currently available Ambra oxide ingredients are used commercially.
- a use of Ambra oxide obtained by or obtainable by a process described herein as part of a fragrance or a cosmetic or a consumer product there is also provided herein a product comprising Ambra oxide obtained by or obtainable by a process described herein.
- the product may, for example, be a fragrance or a cosmetic or a consumer product.
- fragrance composition comprising one or more compounds of formula (I) or (X).
- a “fragrance composition” may, for example, be any composition comprising one or more compounds of formula (I) or (X) and a base material.
- the “base material” includes all known fragrance ingredients selected from the extensive range of natural products, and synthetic molecules currently available, such as essential oils, alcohols, aldehydes and ketones, ethers and acetals, esters and lactones, macrocycles and heterocycles, and/or in admixture with one or more ingredients or excipients conventionally used in conjunction with odorants in fragrance compositions, for example, carrier materials, diluents, and other auxiliary agents commonly used in the art.
- Fragrance ingredients known to the art are readily available commercially from the major fragrance manufacturers. Non-limiting examples of such ingredients include: – essential oils and extracts, e.g.
- cinnamic alcohol ((E)-3-phenylprop-2-en-1-ol); cis-3-hexenol ((Z)-hex-3-en- 1-ol); citronellol (3,7-dimethyloct-6-en-1-ol); dihydro myrcenol (2,6-dimethyloct-7-en-2- ol); Ebanol TM ((E)-3-methyl-5-(2,2,3-trimethylcyclopent-3-en-1-yl)pent-4-en-2-ol); eugenol (4-allyl-2-methoxyphenol); ethyl linalool ((E)-3,7-dimethylnona-1,6-dien-3-ol); farnesol ((2E,6Z)-3,7,11-trimethyldodeca-2,6,10-trien-1-ol); geraniol ((E)-3,7- dimethylocta-2,6
- anisaldehyde (4-methoxybenzaldehyde); alpha amyl cinnamic aldehyde (2-benzylideneheptanal); Georgywood TM (1-(1,2,8,8-tetramethyl- 1,2,3,4,5,6,7,8-octahydronaphthalen-2-yl)ethanone); Hydroxycitronellal (7-hydroxy-3,7- dimethyloctanal); Iso E Super ⁇ (1-(2,3,8,8-tetramethyl-1,2,3,4,5,6,7,8- octahydronaphthalen-2-yl)ethanone); Isoraldeine ⁇ ((E)-3-methyl-4-(2,6,6- trimethylcyclohex-2-en-1-yl)but-3-en-2-one); 3-(4-isobutyl-2-methylphenyl)propanal; maltol; methyl cedryl ketone; methylionone; verbenone; and/or van
- Ambrox ® (3a,6,6,9a-tetramethyl-2,4,5,5a,7,8,9,9b-octahydro-1H- benzo[e][1]benzofuran); geranyl methyl ether ((2E)-1-methoxy-3,7-dimethylocta-2,6- diene); rose oxide (4-methyl-2-(2-methylprop-1-en-1-yl)tetrahydro-2H-pyran); and/ or Spirambrene ® (2',2',3,7,7-pentamethylspiro[bicyclo[4.1.0]heptane-2,5'-[1,3]dioxane]) ; – macrocycles, e.g.
- Ambrettolide ((Z)-oxacycloheptadec-10-en-2-one); ethylene brassylate (1,4-dioxacycloheptadecane-5,17-dione); and / or Exaltolide ® (16-oxacyclohexadecan-1- one); and – heterocycles, e.g. isobutylquinoline (2-isobutylquinoline).
- carrier material means a material which is practically neutral from an odorant point of view, i.e. a material that does not significantly alter the organoleptic properties of odorants.
- auxiliary agent refers to ingredients that might be employed in a fragrance composition for reasons not specifically related to the olfactive performance of said composition.
- an auxiliary agent may be an ingredient that acts as an aid to processing a fragrance ingredient or ingredients, or a composition containing said ingredient(s), or it may improve handling or storage of a fragrance ingredient or composition containing same, such as anti-oxidant adjuvant.
- Said anti-oxidant may be selected, for example, from Tinogard ® TT (BASF), Tinogard ® Q (BASF), Tocopherol (including its isomers, CAS 59-02-9; 364-49-8; 18920-62-2; 121854-78-2), 2,6- bis(1,1-dimethylethyl)-4-methylphenol (BHT, CAS 128-37-0) and related phenols, hydroquinones (CAS 121-31-9). It might also be an ingredient that provides additional benefits such as imparting colour or texture. It might also be an ingredient that imparts light resistance or chemical stability to one or more ingredients contained in a fragrance composition.
- Tinogard ® TT BASF
- Tinogard ® Q BASF
- Tocopherol including its isomers, CAS 59-02-9; 364-49-8; 18920-62-2; 121854-78-2
- BHT 2,6- bis(1,1-dimethylethyl)-4-methylphenol
- hydroquinones CAS
- auxiliary agent commonly used in fragrance compositions containing same cannot be exhaustive, but it has to be mentioned that said ingredients are well known to a person skilled in the art.
- a consumer product comprising a compound or a composition or fragrance composition as described herein, including any embodiment thereof.
- the consumer product may, for example, be a cosmetic product (e.g. an eau de perfume or eau de toilette), a cleaning product, a detergent product, or a soap product.
- Paragraph 1 A protein with the enzymatic activity of a Squalene-hopene-cyclase (SHC) comprising a) a mutated amino acid sequence relative to the wild type SHC of Alicyclobacillus acidocaldarius (wild type AacSHC) of SEQ ID No.1, wherein the W at position 169 of SEQ ID No.
- SHC Squalene-hopene-cyclase
- mutated amino acid sequence 1 is replaced by one amino acid selected from the group consisting of G, A and V or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38,0 to 99,9 % to the amino acid sequence of the mutated amino acid sequence or b) a mutated amino acid sequence relative to a wild type SHC (WT-SHC), wherein the W at a position in the amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by an amino acid selected from the group consisting of G, A and V or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38,0 to 99,9 % to the amino acid sequence of the mutated amino acid sequence.
- WT-SHC wild type SHC
- Paragraph 2 The protein of paragraph 1, wherein the mutated amino acid sequence relative to the wild type AacSHC of SEQ ID No.1 is the amino acid sequence of SEQ ID Nos 315, 316 or 317
- Paragraph 3 The protein of paragraph 1, wherein the WT-SHC is selected from the group consisting of WT-SHC of Acetobacter pasteurianus (ApaSHC1, SEQ ID No.
- Burkholderia ambifaria BamSHC1, SEQ ID No.28, BamSHC2, SEQ ID No.29
- Bradyrhizobium japonicum BjaSHC or BjpSHC SEQ ID No.119
- Pelobacter carbinolicus or Syntrophotalea carbinolica DSM 2380 PcaSHC2, SEQ ID No.30
- Rhodopseudomonas palustris RpaSHC1, SEQ ID No. 31
- Streptomyces coelicolor ScoSHC, SEQ ID No.32
- Syntrophobacter fumaroxidans SfuSHC1, SEQ ID No. 33
- Teredinibacter turnerae TtuSHC, SEQ ID No.
- Paragraph 4 The protein of paragraph 1 or 3, wherein the mutated amino acid sequence relative to a WT-SHC of SEQ ID Nos 13, 14,15, 23-24,28, 29, 30, 31, 32, 33, 34 is the amino acid sequence of SEQ ID Nos 302, 303, 304.
- Paragraph 5 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 305) or b) wherein the W at position 172 in the amino acid sequence of the wild type TelSHC (SEQ ID No. 23) corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No. 302, 304).
- Paragraph 6 The protein of one of the preceding paragraphs , comprising a mutated amino acid sequence, wherein a) the G at position 600 of the wild type AacSHC of SEQ ID No.1 is replaced by one amino acid selected from the group consisting of A, V, L, I and M (SEQ ID Nos 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 305) or b) wherein the amino acid, in particular G, at a position in the amino acid sequence of the WT-SHC corresponding to G600 in the wild type AacSHC of SEQ ID No.1 is replaced by an amino acid selected from the group consisting of A, V, L, I and M.
- Paragraph 7 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the A at position 306 of the wild type AacSHC of SEQ ID No.1 is replaced by V (SEQ ID Nos 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346,347, 350, 351,352) or b) wherein the amino acid, in particular P or C, at a position in the amino acid sequence of the WT-SHC corresponding to A306 in the wild type AacSHC of SEQ ID No.1 is replaced by V.
- Paragraph 8 the protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335, 336,337, 350, 305) or b) wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S.
- Paragraph 9 The protein of one of the preceding paragraphs comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 10 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 11 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by A (SEQ ID No.316, 323, 324, 325, 326,327, 338, 339, 340, 341,342, 351) or b), wherein the W at the position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by A and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S.
- Paragraph 12 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by A and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 13 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by A, the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 14 A nucleic acid sequence, which encodes a protein of one of the preceding claims, in particular as identified in SEQ ID No.349.
- Paragraph 15 An expression cassette, comprising the nucleic acid sequence of paragraph 14.
- Paragraph 16 A vector, comprising the nucleic acid sequence of paragraph 14 or the expression cassette of claim 15.
- Paragraph 17 A host cell, comprising the vector of paragraph 16 or the expression cassette of paragraph 15 or the nucleic acid sequence of paragraph 14.
- Paragraph 18 A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: a) providing the host cell of paragraph 17, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 1 to 13, b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and c) obtaining the biocatalyst, in particular the expressed protein or a host cell comprising the expressed protein.
- Paragraph 19 A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: a) providing the host cell of paragraph 17, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 1 to 13, b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and c) obtaining the biocatalyst, in particular the expressed protein or a host cell comprising
- biocatalyst in particular prepared according to the process of paragraph 18, wherein the biocatalyst is the protein according to any one of paragraph 1 to 13, a host cell comprising the protein according to any one of paragraph 1 to 13, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 1 to 13.
- Paragraph 20 wherein the biocatalyst is the protein according to any one of paragraph 1 to 13, a host cell comprising the protein according to any one of paragraph 1 to 13, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 1 to 13.
- a process for preparing a composition comprising (–)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 19, y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 19 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox.
- Paragraph 21 comprising the following steps: x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 19, y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 19 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox. Paragraph 21.
- a process for preparing an aroma for human or animal use comprising the following steps: i) performing a process according to paragraph 20, j) admixing the composition comprising (–)-Ambrox obtained in step i) and at least one further component and l) obtaining an aroma for human or animal use comprising the composition and at least one further component.
- a biocatalyst comprising up to two or two or more SHC active site mutations and/or up to two or two or more site mutations other than SHC active site mutations wherein the active site mutations are selected from the active site amino acid positions (based on AacSHC) listed in Table 10 comprising active site positions 36, 168, 169, 261, 306, 307, 312, 365, 366, 420, 489, 600, 607, 609, and/or 612, preferably 169, 261, 312, 365, 489, 600, 609 and/or 612 and wherein the mutations other than active site mutations are selected from the site mutations listed in Table 7 and/or Table 8 and/or Table 9 and/or Table 18 disclosed herein, preferably comprising M132R and/or I432T or functional equivalents, thereof wherein the biocatalyst is a protein, a host cell comprising the protein, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein
- Figure 19 of WO2016/170099 shows the location of the non-active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, I432T and A224V) on the SHC Crystal Structure.
- a CAVER analysis of the AacSHC crystal structure can be performed to identify useful active site mutations and site mutations other than active site mutations useful for the preparation of a product of interest using an SHC variant comprising such beneficial active site mutations and site mutations other than active site mutations as described herein.
- Paragraph 23 shows the location of the non-active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, I432T and A224V) on the SHC Crystal Structure.
- a process for preparing a composition comprising (–)-Ambrox or a mixture comprising (-)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 22, y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 22 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox. Paragraph 24.
- a process for preparing a composition comprising (–)-Ambrox or a mixture comprising (-)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and a biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 y) mixing the provided homofarnesol with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox.
- Paragraph 25 Paragraph 25.
- a process for preparing a composition comprising Amberketal, or a mixture comprising Amberketal comprising the following steps: x) providing hydroxyfarnesylacetone, a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 y) mixing the provided hydroxyfarnesylacetone with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the hydroxyfarnesylacetone with the biocatalyst under reaction conditions so as to convert the hydroxyfarnesylacetone to (–)- Amberketal and z) obtaining a composition comprising Amberketal.
- Paragraph 26 The following steps: x) providing hydroxyfarnesylacetone, a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 y) mixing the provided hydroxyfarnesylacetone with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7,
- a process for preparing a composition comprising Ambra oxide or a mixture comprising Ambra oxide comprising the following steps: x) providing (2-E)-Bishomofarnesol (BisEEH), a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 y) mixing the provided BisEEH with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the BisEEH with the biocatalyst under reaction conditions so as to convert the BisEEH to Ambra oxide and z) obtaining a composition comprising Ambra oxide.
- Paragraph 27 A process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox, wherein (3E,7E)-homofarnesol (EEH) or a mixture of stereoisomers comprising EEH is enzymatically converted to (-)-Ambrox or a mixture comprising (-)-Ambrox wherein the enzymatic conversion is carried out using an SHC/HAC enzyme under reaction conditions suitable for the production of (- )-Ambrox and wherein the mixture of stereoisomers comprising EEH consists essentially of homofarnesol isomers selected from one or more of the following groups consisting of [(3E,7E) and [(3Z,7E)] and/or [(3E,7E) and (3E,7Z)] and/or [(3Z,7E), (3E,7E) and (3E,7Z)] also designated as [EE:EZ], [EE:ZE] and [EE:EZ:ZE] respectively and wherein the S
- SEQ ID No. 1 represents the amino acid sequence of the wild type SHC from Alicyclobacillus acidocaldarius (wild type AacSHC).
- SEQ ID No. 24 represents the amino acid sequence of WT-SHC of Acetobacter pasteurianus (ApaSHC).
- SEQ ID No.28 represents the amino acid sequence of WT- SHC of Burkholderia ambifaria (BamSHC1).
- SEQ ID No.29 represents the amino acid sequence of WT-SHC of Burkholderia ambifaria (BamSHC2) SEQ ID No.
- SEQ ID No. 16 represents the amino acid sequence of WT-SHC of Bradyrhizobium japonicum (BjaSHC or BjpSHC).
- SEQ ID No. 30 represents the amino acid sequence of WT-SHC of Pelobacter carbinolicus (PcaSHC) or Syntrophotalea carbinolica DSM 2380.
- SEQ ID No.31 represents the amino acid sequence of WT-SHC of Rhodopseudomonas palustris (RpaSHC).
- SEQ ID No.32 represents the amino acid sequence of WT-SHC of Streptomyces coelicolor (ScoSHC).
- SEQ ID No.33 represents the amino acid sequence of WT-SHC of Syntrophobacter fumaroxidans (SfuSHC).
- SEQ ID No. 34 represents the amino acid sequence of WT-SHC of Teredinibacter turnerae (TtuSHC).
- SEQ ID No.13 represents the amino acid sequence of WT-SHC of Zymomonas mobilis (ZmoSHC1).
- SEQ ID No.15 represents the amino acid sequence of WT-SHC of Zymomonas mobilis (ZmoSHC2).
- SEQ ID No. 23 represents the amino acid sequence of WT-SHC of Thermosynechococcus elongatus (TelSHC, SEQ ID No. 13).
- SEQ ID No. 315 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G).
- SEQ ID No.316 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A).
- SEQ ID No. 317 represents the mutated amino acid sequence of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V).
- SEQ ID No.318 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by A (G600A).
- SEQ ID No. 319 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by V (G600V).
- SEQ ID No. 321 represents the mutated amino acid sequence of a functional equivalent of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by I (G600I).
- SEQ ID No.322 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G) and G600 is exchanged by M (G600M).
- SEQ ID No. 323 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by A (G600A).
- SEQ ID No. 324 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by V (G600V).
- SEQ ID No. 325 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by L (G600L).
- SEQ ID No.326 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by I (G600I).
- SEQ ID No.327 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A) and G600 is exchanged by M (G600M).
- SEQ ID No.328 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.
- SEQ ID No.329 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by V (G600V).
- SEQ ID No.330 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by L (G600L).
- SEQ ID No.331 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by I (G600I).
- SEQ ID No.332 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V) and G600 is exchanged by M (G600M).
- SEQ ID No.333 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.
- SEQ ID No. 334 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by G (W169G), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V).
- SEQ ID No.335 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V).
- SEQ ID No. 336 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G), G600 is exchanged by I (G600I) and A306 is exchanged by V (A306V).
- SEQ ID No.337 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V).
- SEQ ID No.338 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by A (G600A) and A306 is exchanged by V (A306V).
- SEQ ID No. 339 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by A (W169A), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V).
- SEQ ID No.340 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V).
- SEQ ID No.341 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A), G600 is exchanged by I (G600I) and A306 is exchanged by V (A306V).
- SEQ ID No.342 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V).
- SEQ ID No.343 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by A (G600A) and A306 is exchanged by V (A306V).
- SEQ ID No. 344 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No. 1), wherein W169 is exchanged by V (W169V), G600 is exchanged by V (G600V) and A306 is exchanged by V (A306V).
- SEQ ID No.345 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V), G600 is exchanged by L (G600L) and A306 is exchanged by V (A306V).
- SEQ ID No. 346 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V), G600 is exchanged by I (G600I) and A306 is exchanged by V (A306V).
- SEQ ID No.347 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V), G600 is exchanged by M (G600M) and A306 is exchanged by V (A306V).
- SEQ ID No.348 represents the mutated amino acid sequence of the benchmark SHC from wild type AacSHC (SEQ ID No. 1), wherein M132 is exchanged by R (M132R), A224 is exchanged by V (A224V) and I432 is exchanged by T (I432T).
- SEQ ID No.349 represents the nucleotide sequence of the wild type SHC from Alicyclobacillus acidocaldarius (wild type AacSHC, SEQ ID No. 1).
- SEQ ID No. 350 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G) and A306 is exchanged by V (A306V).
- SEQ ID No.351 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by A (W169A) and A306 is exchanged by V (A306V).
- SEQ ID No. 352 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by V (W169V) and A306 is exchanged by V (A306V).
- SEQ ID No. 302 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type TelSHC (SEQ ID No.23), wherein W172 is exchanged by G (W172G), P311 is exchanged by A (P311A), F425 is exchanged by Y (F425Y) and G609 is exchanged by A (G609A).
- SEQ ID No.303 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type ZmoSHC1 (SEQ ID No.13), wherein Q221 is exchanged by S (Q221S), W222 is exchanged by G (W222G), A368 is exchanged by V (A368V), F486 is exchanged by Y (F486Y) and G667 is exchanged by A (G667A).
- SEQ ID No.304 represents the mutated amino acid sequence of a mutant SHC from wild type TelSHC (SEQ ID No.23), wherein W172 is exchanged by G (W172G).
- 305 represents the mutated amino acid sequence of a functional equivalent of a mutant SHC from wild type AacSHC (SEQ ID No.1), wherein W169 is exchanged by G (W169G), G600 is exchanged by M (G600M), M132 is exchanged by R (M132R), A224 is exchanged by V (A224V) and I432 is exchanged by T (I432T).
- Figure 19 of WO2016/170099 and Figure 1 of Eichhorn et al Adv.Synth.Catal (2016) 360:2339- 2351 show the location of the site mutations other than active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, I432T and A224V) on the SHC Crystal Structure (in colour): red for variant 215G2; purple (wine red) for variant 101A10 and green for variant 111C8.
- the side-chains are highlighted in yellow in the co-crystallized substrate analog.
- Other mutations for identified variants with no improved activity are marked in blue.
- a reference to “a gene” or “an enzyme” is a reference to "one or more genes” or “one or more enzymes”.
- the verb "to comprise” and its conjugations is used in its non- limiting sense to mean that items following the word are included, but items not specifically mentioned are not excluded.
- the verb “to consist” may be replaced by “to consist essentially of” meaning that a composition as described herein may comprise additional component(s) than the ones specifically identified, said additional component(s) not altering the unique characteristics of the invention.
- the verb “to consist” may be replaced by “to consist essentially of” meaning that a method or use as described herein may comprise additional step(s) than the ones specifically identified, said additional step(s) not altering the unique characteristic of the invention.
- the verb “to consist” may be replaced by “to consist essentially of” meaning that a nucleotide or amino acid sequence as described herein may comprise additional nucleotides or amino acids than the ones specifically identified, said additional nucleotides or amino acids not altering the unique characteristics of the invention.
- with “at least" a particular value means that particular value or more.
- “at least 2” is understood to be the same as “2 or more” i.e., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, ..., etc.
- the word “about” or “approximately” when used in association with a numerical value preferably means that the value may be the given value (of 10) more or less 1% of the value.
- the term “and/or” is understood to mean that all members of a group connected by the term “and/or” are represented both cumulatively with respect to each other in any combination, and alternatively with respect to each other.
- the expression “A, B and/or C” the following disclosure is to be understood thereunder: i) (A or B or C), or ii) (A and B), or iii) (A and C), or iv) (B and C), or v) (A and B and C), or vi) (A and B or C), or vii) (A or B and C), or viii) (A and C or B).
- the term “substantially free of” is understood to mean that a compound or composition is largely free of other components but is not guaranteed to be 100% pure as trace amounts of other not deliberately added components may be present. The term allows for the presence of other components provided that they do not affect the basic characteristics of a claimed compound or composition.
- a total reaction mass of e.g.150 g (as for examplein Example 4) does not translate into a reaction volume of 150 ml. Nonetheless the concentrations of the individual components in the bioconversion reaction mixtures are indicated in mass per volume (for example g/l or (w/v) %) and thus do not take into account that a total reaction mass of e.g.150 g (as for example in. Example 4) does not correspond exactly to a reaction volume of 150 ml (as for example in Example 4).
- all reference to EEH in the Examples, the Figures and the legends to the Figures is a reference to the EE isomer of homofarnesol.
- the EEH used is taken from a homofarnesol stock comprising an EE:EZ isomer mixture in a weight ratio of 80:20.
- the examples described herein are illustrative of the present disclosure and are not intended to be limitations thereon. Different embodiments of the present disclosure have been described according to the present disclosure. Many modifications and variations may be made to the techniques described and illustrated herein without departing from the spirit and scope of the disclosure. Accordingly, it should be understood that the examples are illustrative only and are not limiting upon the scope of the disclosure.
- Paragraph 28 A process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox, the process comprising enzymatically converting (3E,7E)-homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)-Ambrox using a SHC/HAC enzyme variant,wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 %, IIdentity or similarity to SEQ ID NO: 1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379,
- Sequence identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or 100%
- Paragraph 29 A process for preparing Ambra oxide or a mixture comprising Ambra oxide, the process comprising enzymatically converting (2,E)-Bishomofarnesol (BisEEH) or a mixture of isomers of bishomofarnesol comprising BisEEH to Ambra oxide or a mixture comprising Ambra oxide using a SHC/HAC enzyme variant, wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 % identity or similarity to SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62,
- Sequence identity or similarity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or 100%
- Paragraph 30 A process according to paragraph 28 or 29, wherein: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, and/or - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 3
- the process according to paragraph 30, is such that: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G or a functional equivalent thereof, and/or - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379,
- the process according to paragraph 30 is such that: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G, A or V or a functional equivalent thereof, preferably wherein the W at position 169 is replaced by G, and/or - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373
- the process according to paragraph 30 is such that: - the W at position 169 of SEQ ID NO: 1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383 is replaced by G or a functional equivalent thereof and/or - the A at position 306 of SEQ ID NO:1, 2, 3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53, 54361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 38
- Paragraph 31 A process according to any one of the preceding paragraphs, wherein the amino acid at position 168 of SEQ ID NO:1, 2,3, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47, 48, 49, 50, 51, 52, 53,54, 361, 362, 363, 364, 365, 366, 367, 368, 369, 370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382 or 383, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
- Paragraph 32 A process according to any one of the preceding paragraphs, wherein - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 1, 4, 5, 6 or 350 and has at least one of the following mutations: W169G, A306V and G600M or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 7, 8, 9 or 386 and has the following mutations: M132R, A224V, I432T, A557T, R613S, and has at least one of the following mutations: W169G, A306V and G600Mor - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 10, 11, 12 or 385and has the following mutations: M132R, A224V, I432T and has at least one of the following mutations: W169G, A306V and G600M.
- Sequence identity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the polypeptide
- Paragraph 33 A process according to any one of the preceding paragraphs, wherein - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 23, 304, 359 or 360 and has at least one of the following mutations: W172G, A311V and G609M (Tel SHC/HAC variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO: 32, 311, 357, or 358 and has the following mutations: W196G, A335V and G629M (Sco SHC/HAC variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0 % identity to SEQ ID NO:13, 312, 353 or 354 and has at least one of the following mutations: W222G, A368V and G667M (Zmo SHC1 variant) or - the SHC/HAC enzyme variant has an amino acid sequence having at least 70.0
- Sequence identity may be of at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the polypeptide
- Paragraph 34 A process according to any one of the preceding paragraphs, wherein the SHC/AHC enzyme variant has an amino acid sequence comprising or consisting of or essentially consisting of SEQ ID NO: 4, 5, 6, 7, 8, 9, 10, 11,12, 305, 306, 304, 302, 311, 312, 313, 353, 354, 355, 356, 357, 358, 359, 360, 315, 316, 317, 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346, 347, 350, 351 or 352.
- Paragraph 35 A process according to any one of the preceding paragraphs, wherein, the SHC/HAC enzyme variant disclosed herein exhibits: - an increased substrate specificity for EEH (or for BisEEH) when homofarnesol or bis- homofarnesol substrates are used, - an increased product selectivity for (-)-Ambrox (or Ambra oxide) when homofarnesol or bis- homofarnesol substrates are used, - an increased specificity for a particular isomer of substrates when substrates other than homofarnesol or bis-homofarnesol are used (eg ethyl-homofarnesol, hydroxyfarnesylacetone and the like – see, for example WO2021/110858 and WO2021/209482 respectively) - an increased productivity and/or - an increased degree of conversion of EEH (or BisEEH) as well as an increased conversion rate of EEH (or BisEEH) over the first 3 to 6 hours (or over the first 4, 5, or 6
- wild-type SHC such as those represented by SEQ ID NO:1, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 , 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78 ,79, 80, 81, 82, 83, 84 , 85, 86 ,87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131,
- Paragraph 36 A SHC/HAC enzyme variant as defined in any one of the preceding paragraphs, preferably wherein the variant comprises: a G atposition 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3; a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and a V at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3; or a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and an M at position 600 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3; or a G at position 169 or corresponding to position 169 of SEQ ID NO: 1, 2 or 3 and a V at position 306 or corresponding to position 306 of SEQ ID NO: 1, 2 or 3 and an M at position 600 or corresponding to position 600 of SEQ ID NO: 1, 2 or 3, And/or wherein the G at position 600 or corresponding to 600 of SEQ ID NO: 1, 2 or 3 is replaced
- Paragraph 37 A process according to any one of the preceding paragraphs except paragraph 36, wherein the enzymatic conversion takes place at a temperature in the range of about 300C to about 500C, for example from about 400 to about 500C, and/or at a pH in the range of about 5 to about 6.
- Paragraph 38 A process according to any one of the preceding paragraphs except paragraph 36, wherein the process comprises culturing a recombinant host cell that produces the SHC/HAC enzyme variant.
- Paragraph 39 A process according to paragraph 38, wherein the recombinant host cells comprise a nucleic acid sequence selected from SEQ ID NO: 38, 39, 40, 41, 42, 43, 44, 45 and/or 46.
- Paragraph 40 A process according to any one of the preceding paragraphs except paragraph 36, wherein the mixture of isomers of homofarnesol comprising EEH is an EE:EZ isomer mixture, preferably wherein the EE: EZ isomer mixture is in a weight ratio of 80:20.
- Paragraph 41 A process according to any one of the preceding paragraphs except paragraph 36, wherein the weight ratio of the recombinant host cell producing the SHC/HAC enzyme variant to EEH or a mixture of isomers of homofarnesol comprising EEH in an EE:EZ isomer mixture in a weight ratio of 80:20 is about 2:1, 1:1 or about 0.5:1 or about 0.1:1.
- Paragraph 42 (-)-Ambrox obtained by or obtainable by the process of any preceding paragraphs except paragraph 36, in a solid form in an amorphous or crystalline form.
- Paragraph 43 Use of (-)-Ambrox of claim 15 as part of a fragrance or a cosmetic or a consumer product such as fabric care, toiletry, beauty care, a cleaning product, a detergent product, and/or a soap product.
- Paragraph 44 A fragrance or a cosmetic or a consumer product comprising (-)-Ambrox of paragraph 42.
- Paragraph 45 A nucleic acid sequence encoding the SHC/HAC enzyme variant of paragph 36.
- Paragraph 46 A construct comprising the nucleic acid sequence of paragraph 45.
- Paragraph 47 A recombinant host cell comprising the nucleic acid sequence of paragraph 45or the construct of paragraph 46.
- Paragraph 48 A process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox according to any one of paragraphs 28, 29 or 31, the process comprising enzymatically converting (3E,7E)- homofarnesol (EEH) or a mixture of isomers of homofarnesol comprising EEH to (-)-Ambrox or a mixture comprising (-)-Ambrox using a SHC/HAC enzyme variant,wherein the SHC/HAC enzyme variant has an amino acid sequence having at least 30.0 %, identity or similarity to SEQ ID NO: 1-12, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 47-54, 55-296, 301- 313, 315-353, 354-383 wherein the W at position 169 or corresponding to position 169 of SEQ ID NO: 1, is replaced by G
- Sequence identity or similarity may be at least 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%.
- bioconversion volume is at least about 100L, more preferably in the range of about 1000L to about 3000L, even more preferably about 10,000L, even more preferably about 100,000L, or even about 250,000L.
- Paragraph 49 A protein with the enzymatic activity of a Squalene-hopene-cyclase (SHC) comprising a) a mutated amino acid sequence relative to the wild type SHC of Alicyclobacillus acidocaldarius (wild type AacSHC) of SEQ ID No.1, wherein the W at position 169 of SEQ ID No.
- SHC Squalene-hopene-cyclase
- mutated amino acid sequence 1 is replaced by amino acid G, or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38,0 to 99,9 % to the amino acid sequence of the mutated amino acid sequence or b) a mutated amino acid sequence relative to a wild type SHC (WT-SHC), wherein the W at a position in the amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by amino acid G, or a functional equivalent of the mutated amino acid sequence, wherein the functional equivalent of the mutated amino acid sequence has an amino acid sequence identity from 38,0 to 99,9 % to the amino acid sequence of the mutated amino acid sequence.
- WT-SHC wild type SHC
- Sequence identity may be of at least 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%,70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, 99.9% or 100% identity to the polypeptide identified.
- Paragraph 50 The protein of paragraph 49, wherein the mutated amino acid sequence relative to the wild type AacSHC of SEQ ID No.1 is the amino acid sequence of SEQ ID Nos 315.
- Paragraph 51 The protein of paragraph 49, wherein the WT-SHC is selected from the group consisting of WT-SHC of Acetobacter pasteurianus (ApaSHC1, SEQ ID No.
- Burkholderia ambifaria BamSHC1, SEQ ID No.28, BamSHC2, SEQ ID No.29
- Bradyrhizobium japonicum BjaSHC or BjpSHC SEQ ID No.119
- Pelobacter carbinolicus or Syntrophotalea carbinolica DSM 2380 PcaSHC2, SEQ ID No.30
- Rhodopseudomonas palustris RpaSHC1, SEQ ID No. 31
- Streptomyces coelicolor ScoSHC, SEQ ID No.32
- Syntrophobacter fumaroxidans SfuSHC1, SEQ ID No. 33
- Teredinibacter turnerae TtuSHC, SEQ ID No.
- Paragraph 52 The protein of paragraph 49 or 51, wherein the mutated amino acid sequence relative to a WT-SHC of SEQ ID Nos 13, 14,15, 23-24,28, 29, 30, 31, 32, 33, 34 is the amino acid sequence of SEQ ID Nos 302, 303, 304.
- Paragraph 53 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 305) or b) wherein the W at position 172 in the amino acid sequence of the wild type TelSHC (SEQ ID No. 23) corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No. 302, 304).
- Paragraph 54 The protein of one of the preceding paragraphs , comprising a mutated amino acid sequence, wherein a) the G at position 600 of the wild type AacSHC of SEQ ID No.1 is replaced by amino acid selected from the group consisting of A, V, L, I and M (SEQ ID Nos 318, 319, 320, 321, 322, 323, 324, 325, 326, 327, 328, 329, 330, 331, 332, 305) or b) wherein the amino acid, in particular G, at a position in the amino acid sequence of the WT-SHC corresponding to G600 in the wild type AacSHC of SEQ ID No.1 is replaced by amino acid selected from the group consisting of A, V, L, I and M.
- Paragraph 55 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the A at position 306 of the wild type AacSHC of SEQ ID No.1 is replaced by V (SEQ ID Nos 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 343, 344, 345, 346,347, 350, 351,352) or b) wherein the amino acid, in particular P or C, at a position in the amino acid sequence of the WT-SHC corresponding to A306 in the wild type AacSHC of SEQ ID No.1 is replaced by V.
- Paragraph 56 the protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335, 336,337, 350, 305) or b) wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S.
- Paragraph 57 The protein of one of the preceding paragraphs comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No. 1 is replaced by G and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 58 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 59 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein a) the W at position 169 of the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 305) ( or b), wherein the W at the position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G and the amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S.
- Paragraph 60 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 305) and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- Paragraph 61 The protein of one of the preceding paragraphs, comprising a mutated amino acid sequence, wherein the W at a position in an amino acid sequence of the WT-SHC corresponding to W169 in the wild type AacSHC of SEQ ID No.1 is replaced by G (SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 305) amino acid, in particular Y, Q, A or C, at the position in the amino acid sequence of the WT-SHC corresponding to S168 of the wild type AacSHC of SEQ ID No.1 is replaced by S and the amino acid, in particular F, at the position in the amino acid sequence of the WT-SHC corresponding to Y420 of the wild type AacSHC of SEQ ID No.1 is replaced by Y.
- G SEQ ID No.315, 318, 319, 320, 321,322, 333, 334, 335336,337, 350, 30
- Paragraph 62 A nucleic acid sequence, which encodes a protein of one of the preceding paragraphs s, in particular as identified in SEQ ID No.349.
- Paragraph 63 An expression cassette, comprising the nucleic acid sequence of paragraph 62.
- Paragraph 64 A vector, comprising the nucleic acid sequence of paragraph 62 or the expression cassette of claim 63.
- Paragraph 65 A host cell, comprising the vector of paragraph 64 or the expression cassette of paragraph 63 or the nucleic acid sequence of paragraph 62.
- Paragraph 66 A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: a) providing the host cell of paragraph 65, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 49 to 61, b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and c) obtaining the biocatalyst, in particular the expressed protein or a host cell comprising the expressed protein.
- Paragraph 67 A process for preparing a biocatalyst with the enzymatic activity of a SHC, comprising the following steps: a) providing the host cell of paragraph 65, comprising a nucleic acid sequence encoding a protein according to any one of paragraphs 49 to 61, b) cultivating the host cell of step a) in a culture medium under conditions, which allow the expression of the protein and c) obtaining the biocatalyst, in particular the expressed
- biocatalyst in particular prepared according to the process of paragraph 66, wherein the biocatalyst is the protein according to any one of paragraph 49 to 61, a host cell comprising the protein according to any one of paragraph 49 to 61, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 49 to 61.
- Paragraph 68 the biocatalyst is the protein according to any one of paragraph 49 to 61, a host cell comprising the protein according to any one of paragraph 49 to 61, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein according to any one of paragraph 49 to 61.
- a process for preparing a composition comprising (–)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 67, y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 19 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox.
- Paragraph 69 Paragraph 69.
- a process for preparing an aroma for human or animal use comprising the following steps: i) performing a process according to paragraph 68, j) admixing the composition comprising (–)-Ambrox obtained in step i) and at least one further component and l) obtaining an aroma for human or animal use comprising the composition and at least one further component.
- Paragraph 70 A process for preparing an aroma for human or animal use comprising the following steps: i) performing a process according to paragraph 68, j) admixing the composition comprising (–)-Ambrox obtained in step i) and at least one further component and l) obtaining an aroma for human or animal use comprising the composition and at least one further component.
- a biocatalyst comprising up to two or two or more SHC active site mutations and/or up to two or two or more site mutations other than SHC active site mutations wherein the active site mutations are selected from the active site amino acid positions (based on AacSHC) listed in Table 10 comprising active site positions 36, 168, 169, 261, 306, 307, 312, 365, 366, 420, 489, 600, 607, 609, and/or 612, preferably 169, 261, 312, 365, 489, 600, 609 and/or 612 and wherein the mutations other than active site mutations are selected from the site mutations listed in Table 7 and/or Table 8 and/or Table 9 and/or Table 18 disclosed herein, preferably comprising M132R and/or I432T or functional equivalents, thereof wherein the biocatalyst is a protein, a host cell comprising the protein, a host cell lysate, freeze dried host cell, host cell extract or host cell fraction comprising the protein
- Figure 19 of WO2016/170099 shows the location of the non-active site mutations identified in SHC/HAC variants 101A10, 111C8 and 215G2 (comprising M132R, I432T and A224V) on the SHC Crystal Structure.
- a CAVER analysis of the AacSHC crystal structure can be performed to identify useful active site mutations and site mutations other than active site mutations useful for the preparation of a product of interest using an SHC variant comprising such beneficial active site mutations and site mutations other than active site mutations as described herein.
- Paragraph 71 is a CAVER analysis of the AacSHC crystal structure.
- a process for preparing a composition comprising (–)-Ambrox or a mixture comprising (-)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and the biocatalyst of paragraph 70, y) mixing the provided homofarnesol with the reaction medium and the biocatalyst of paragraph 22 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox. Paragraph 72.
- a process for preparing a composition comprising (–)-Ambrox or a mixture comprising (-)-Ambrox comprising the following steps: x) providing homofarnesol, a reaction medium and a biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9, 16 and/or 18 y) mixing the provided homofarnesol with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the homofarnesol with the biocatalyst under reaction conditions so as to convert the homofarnesol to (–)-Ambrox and z) obtaining a composition comprising (–)-Ambrox.
- Paragraph 73 Paragraph 73.
- a process for preparing a composition comprising Amberketal, or a mixture comprising Amberketal comprising the following steps: x) providing hydroxyfarnesylacetone, a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 y) mixing the provided hydroxyfarnesylacetone with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the hydroxyfarnesylacetone with the biocatalyst under reaction conditions so as to convert the hydroxyfarnesylacetone to (–)- Amberketal and z) obtaining a composition comprising Amberketal.
- Paragraph 74 Paragraph 74.
- a process for preparing a composition comprising Ambra oxide or a mixture comprising Ambra oxide comprising the following steps: x) providing (2-E)-Bishomofarnesol (BisEEH), a reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 y) mixing the provided BisEEH with the reaction medium and the biocatalyst disclosed in any one of Tables 2, 3, 7, 8, 9,16 and/or 18 and reacting the BisEEH with the biocatalyst under reaction conditions so as to convert the BisEEH to Ambra oxide and z) obtaining a composition comprising Ambra oxide.
- Paragraph 75 A process for preparing (-)-Ambrox or a mixture comprising (-)-Ambrox, wherein (3E,7E)-homofarnesol (EEH) or a mixture of stereoisomers comprising EEH is enzymatically converted to (-)-Ambrox or a mixture comprising (-)-Ambrox wherein the enzymatic conversion is carried out using an SHC/HAC enzyme under reaction conditions suitable for the production of (- )-Ambrox and wherein the mixture of stereoisomers comprising EEH consists essentially of homofarnesol isomers selected from one or more of the following groups consisting of [(3E,7E) and [(3Z,7E)] and/or [(3E,7E) and (3E,7Z)] and/or [(3Z,7E), (3E,7E) and (3E,7Z)] also designated as [EE:EZ], [EE:ZE] and [EE:EZ:ZE] respectively and wherein the S
- EXAMPLE 1 Biocatalyst production For squalene hopene cyclase enzyme production in Escherichia coli the gene coding for the desired wild-type or variant SHC enzyme was inserted into plasmid pET-28a(+) (commercially available (for example from Merck Millipore) and as disclosed in SEQ ID NO:179 of figure 21 of WO 2016/170099), where it is under the control of an IPTG inducible T7 promotor. The plasmid was transformed into E. coli strain BL21(DE3) (commercially available) using a standard heat- shock transformation procedure.
- Cultivation medium The minimal medium used for biocatalyst production contained: • 10 % 10x citric acid/phosphate buffer (133 g/l KH 2 PO 4 , 40 g/l (NH 4 ) 2 HPO 4 , 17 g/l citric acid.H2O in deionized water, with pH adjusted to 6.8 using 32 % NaOH), • 2.43 % MgSO 4 solution (50 % w/v MgSO4.7H2O in deionized water), • 0.01 % trace elements solution (50 g/l Na2EDTA.2H 2 O, 20 g/l FeSO 4 .7H 2 O, 3 g/l H 3 BO 3 , 0.9 g/l MnSO 4 .2H 2 O, 1.1 g/l CoCl 2 , 80 g/l CuCl2, 240 g/l NiSO4.7H2O, 100 g/l KI, 1.4 g/l (NH 4 ) 6 Mo 7 O 24 .4H
- citric acid/phosphate buffer was first sterilized by autoclaving, the other ingredients added afterwards from sterile solutions sterilized either by autoclaving or filter-sterilization (0.2 ⁇ m). Fermentation Fermentations were run in 750 ml InforsHT reactors. To the fermentation vessel was added 168 ml deionized water. The reaction vessel was equipped with all required probes (pO2, pH, sampling, antifoam), C + N feed and sodium hydroxide bottles and autoclaved.
- a seed culture was grown in LB medium (+ Kanamycin) at 37 °C, 220 rpm for 8 h.
- the fermenter was inoculated to an OD 650nm of 0.4-0.5 from this seed culture.
- the fermentation was run first in batch mode for 11.5 h, where after was started the C+ N feed with a feed solution (sterilized glucose solution (143 ml H 2 O + 35 g glucose) to which had been added after sterilization: 17.5 ml (NH4)2SO4 solution, 1.8 ml MgSO 4 solution, 0.018 ml trace elements solution, 0.360 ml Thiamine solution, 0.180 ml kanamycin solution.
- the feed was run at a constant flow rate of approx.4.2 ml/h.
- EXAMPLE 2 Setting optimized reaction conditions for SHC variants The reaction conditions for the SHC variants were individually optimized with regard to temperature, pH and SDS concentration. Biocatalysts were prepared by fermentation as described in Example 1 and used is whole cell reactions. The Homofarnesol feedstock used was of EEH:EZH ratio 80:20.
- AacSHC variants having several mutations exhibit an improved substrate specificity for EEH and/or a product selectivity for (-)-Ambrox which result in an improved EEH conversion rate.
- These mutations are: Mutation W169G is introduced in P1 variants Mutations W169G and G600M are introduced in P2 variants Mutations W169G, A306V and G600M are introduced in P3 variants (these positions correspond to positions in SEQ ID NO:1) The mutations of the P1, P2 or P3 variants had been introduced in: - The wild type Aac SHC being represented by SEQ ID NO:1 leading to: o AaC SHC P1 variant represented by SEQ ID NO: 4, o AaC SHC P2 variant represented by SEQ ID NO: 5, o AaC SHC P3 variant represented by SEQ ID NO: 6, - The SHC#65 variant being represented by SEQ ID NO:2 leading to: o SHC#65 P1 variant represented by SEQ ID NO: 7, o SHC#
- EXAMPLE 3 Relative performance of SHC variants in E,E-Homofarnesol cyclization reactions The influence of the mutations of P1, P2 and P3 variants on E,E-Homofarnesol conversion was investigated when introduced in wild type AacSHC and 215G2SHC background. Reactions were run in 4 ml volume with constant agitation (Heidolph Synthesis 1 Liquid 16, 800 rpm) applying individually optimized reaction conditions (T, pH, SDS).
- the Homofarnesol feedstock used was of EEH:EZH ratio 80:20.
- P1, P2 and P3 variants of AacSHC was EEH conversion dramatically increased over that of the parent wild type enzyme (see Figure 1).
- P1, P2, and P3 variants of 215G2SHC showed a significantly increased EEH conversion over 215G2SHC (see Figure 1).
- EXAMPLE 4 Substrate specificity and product selectivity of P1, P2, and P3 SHC variants (homofarnesol) The influence of P1, P2 and P3 variants on substrate specificity and product selectivity was investigated when introduced in wild type AacSHC, 215G2SHC, and SHC#65.
- Reactions (4 ml volume), contained 8 g/l EEH and cells to an OD650nm of 10, and were run with constant agitation (Heidolph Synthesis 1 Liquid 16, 800 rpm) applying individually optimized reaction conditions (T, pH, SDS).
- the Homofarnesol feedstock used was a mixture of isomers with an EEH:EZH ratio of 80:20.
- Figure 2 shows the reaction products produced when Homofarnesol consisting of a mixture of EE and EZ isomers is cyclized with SHC as published in Eichhorn et al. Adv. Synth. Catal. (2016), 360, 2339-2351 and in WO2016/170099.
- the P1, P2, and P3 variants of 215G2SHC showed also a significantly increased substrate selectivity towards E,E-Homofarnesol and product selectivity towards (-)-Ambrox.
- Introducing the mutations for P1, P2, and P3 variants in SHC#65 strongly increased substrate specificity towards E,E-Homofarnesol and product selectivity towards (-)-Ambrox, this selectivity remaining almost same within the three SHC#65 variants.
- EXAMPLE 5 Performance of P1, P2, and P3 AacSHC variants in 125 g/l E,E-Homofarnesol bioconversion
- Biocatalysts produced by fermentation of the E. coli strains transformed with the plasmid carrying the gene coding for the selected SHC enzyme were used in 125 g/l E,E-Homofarnesol bioconversions.
- the Homofarnesol stock used was of EEH:EZH ratio 80:20.
- the cell concentration of the cell suspensions used was determined by centrifuge an approx.1 g aliquot of the cell suspension in a tabletop centrifuge (13’000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). 25 ml reactions were run in Radleys Carousel Plus/Monoblock 16. They contained 125 g/l E,E- Homofarnesol, 250 g/l cells, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer. Temperature, pH, and SDS concentration (SDS:cells ratio) were set according to the conditions defined individually as optimal for each variant.
- the Homofarnesol stock used was of EEH:EZH ratio 80:20.
- the cell concentration of the cell suspensions used was determined by centrifuge an approx.1 g aliquot of the cell suspension in a tabletop centrifuge (13’000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). 25 ml reactions were run in Radleys Carousel Plus/Monoblock 16. They contained 125 g/l E,E- Homofarnesol, 250 g/l cells, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:cells ratio).
- coli strains transformed with the plasmid carrying the gene coding for the selected SHC enzyme were used in 125 g/l E,E-Homofarnesol bioconversions.
- the Homofarnesol stock used was of EEH:EZH ratio 80:20.25 ml reactions were run in Radleys Carousel Plus/Monoblock 16.
- the cell concentration of the cell suspensions used was determined by centrifuge an approx.1 g aliquot of the cell suspension in a tabletop centrifuge (13’000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate).
- the reactions contained 125 g/l E,E-Homofarnesol, 250 g/l cells, and were run under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:Cells ratio) in 0.1 M succinic acid or citric acid/sodium phosphate buffer.
- the pH of the reaction was measured at an externally calibrated pH electrode and adjusted manually with appropriately diluted phosphoric acid as required.
- Figure 6 shows the composition of the reaction product, E,E-Homofarnesol and E,Z- Homofarnesol conversion with each of the variants tested.
- the cell concentration of the cell suspensions used was determined by centrifuge an approx.1 g aliquot of the cell suspension in a tabletop centrifuge (13’000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). 20 ml reactions were run in Radleys Carousel Plus/Monoblock 16 (constant agitation). They contained 250 g/l E,E-Homofarnesol, 250 g/l cells that had produced SHC variants SHC#65 or SHC#65 P2, and were run in 0.1 M succinic acid or citric acid/sodium phosphate buffer under conditions defined as optimal regarding temperature, pH, and SDS concentration (SDS:cells ratio).
- the cell concentration of the cell suspensions used was determined by centrifuge an approx.1 g aliquot of the cell suspension in a tabletop centrifuge (13’000 rpm), carefully discarding the supernatant, and weighing the mass of the cell pellet (triplicate). Reactions with SHC variant SHC#65 were run in 300 ml volume in a DASBox Fermenter (constant agitation), reactions with SHC#65 P2 SHC variant were run in 20 ml reactions in Radleys Carousel Plus/Monoblock 16 flasks (constant agitation).
- Source microorganisms and amino acid sequence accession numbers for squalene hopene cyclase enzymes are listed in Table 16.
- Table 16 Squalene hopene cyclase enzymes. Source microorganisms and amino acid sequence accessionnumbers. Accession number is Genbank when not otherwise mentioned. 1 UniProtKB Figure 9 shows an amino acid sequence alignment of the squalene hopene cyclase enzymes listed in Table 3 prepared with CLUSTAL O (1.2.4). The amino acids at positions 169, 306, and 600 of the Alicyclobacillus acidocaldarius (AacSHC) sequence are highlighted in white on a black background. W at position 169 is almost strictly conserved as is G at position 600 throughout the amino acid sequences aligned: 15 out of 16 sequences, one single conservative substitution. Amino acids at position 306 are less conserved (9 out of 16 sequences).
- the reaction with SHC#65 was run at pH 5.6 and 45°C in presence of 0.07 % SDS.
- the reaction with SHC#65 P2 was run at pH 6.2 and 35°C in presence of 0.03 % SDS.
- the reactions were sampled over time, extracted with MTBE and their content in E,E-Bis- homofarnesol, E,Z-Bis-homofarnesol, compounds X, XI, XII, and XIII (reaction products as shown in Table 12) analysed by GC-FID. Conversion was calculated as indicated in Example 10 for Homofarnesol.
- the new variants comprising P2 mutations in the SHC#65 background exhibit increased conversion of E,E-Bis-homofarnesol (see Figure 10).
- a higher specificity for the E,E isomer of Bis-homofarnesol and a higher product specificity towards Ambra oxide of the SHC#65 P2 variant was observed compared to SH#65.
- E,E-Bis- homofarnesol was preferentially converted over E,Z-Bis-homofarnesol with SHC#65 P2.
- the proportion of Ambra oxide (X) in the reaction products arising from E,E-Bis-homofarnesol cyclization (X + XII) was increased: approx.
- AaC SHC P1 variant (W169G mutation) represented by SEQ ID NO: 4, o ZmoSHC1 P1 variant (W222G mutation) represented by SEQ ID NO:312 o ZmoSCH2 P1 variant (W177G mutation) represented by SEQ ID NO:313 o TelSHC P1 variant (W172G mutation) represented by SEQ ID NO: 304 o ScoSHC P1 variant (W196G mutation) represented by SEQ ID NO:311 Reactions (0.5 ml volume) contained 2.36 g/l Homofarnesol, cells that had produced the SHC enzyme to an OD 650nm of 6 and were run in deionized water at 30°C (constant agitation).
- EXAMPLE 14 The table below is identical with Table 10 earlier depicted. This table shows a set of conserved amino acids at the active site for five wild type SHC enzymes Table 10. Set of conserved amino acids at the active site of 5 wt SHC enzymes. conserveed positions can be seen for amino acid positions 169, 261, 312, 365, 489, 600, 609 and 612 for five different WT SHC enzymes. Differences in hydrogen binding pocket can be seen for Q, Y and C in ZmoSHC1, ZmoSHC2 and ScoSHC for the amino acid position 168.
- EXAMPLE 15 Substrate specificity and product selectivity of additional SHC variants (eg SEQ ID NO: 306, or a combination of the mutations in SEQ ID NO: 5 and SEQ ID NO: 369)
- the mutations of the P1, P2 or P3 variants are introduced in: -
- the wild type Aac SHC being represented by SEQ ID NO:1 leading to: o AaC SHC P4 variant represented by SEQ ID NO: 5 and SEQ ID NO: 369 o AaC SHC P4 variant represented by SEQ ID NO:306
- the introduction of the P4 variants show a significant influence on enzymatic activity.
- EXAMPLE 16 Reducing cells:substrate ratio with SHC#65 P2 SHC at increased EEH concentration
- the EE:EZ ratio of the Homofarnesol stock used was 80:20.
- the cell concentration of the cell suspension used was determined as outlined in Example 9. Reactions were run in a total volume of 25 g (“25 ml reactions”) in Radleys Monoblock Flask (200 rpm, constant agitation) using cells that had produced SHC variant SHC#65 P2. They contained 400 g/l E,E-Homofarnesol and the appropriate amount of cells for a [cells]:[EEH] ratio of 0.6, 0.5, 0.4, or 0.3.
- EXAMPLE 17 Increased volumetric productivity
- the EE:EZ ratio of the Homofarnesol stock used was 80:20.
- the cell concentration of the cell suspension used was determined as outlined in Example 9. Reactions were run in a total volume of 25 g (“25 ml reactions”) in Radleys Monoblock Flask (200 rpm, constant agitation) using cells that had produced SHC variant SHC#65 P2.
- Reactions were run in a total volume of 1.1 kg (“1.1 litre reaction”) in a 1.5 litre sulfonation flask (230 rpm, constant agitation) placed in a water bath.
- the reaction contained 400 g/l E,E- Homofarnesol and 200 g/l cells that had produced SHC variant SHC#65 P2 ([cells]:[EEH] ratio of 0.5).
- the reaction was run at 35°C and pH 5.8 in 0.1 M succinic acid buffer in presence of 5 g/l SDS ([SDS]:[cells] ratio of 0.025).
- the pH of the reaction was measured at an externally calibrated pH electrode and adjusted as required manually with appropriately diluted phosphoric acid.
- EEH conversion was ⁇ 97.1 % after 72 hours as judged from GC-FID analysis results.
- the reaction broth was treated as described e.g. in WO 2017182542 or WO2022023464 prior to filtration over a 500 mesh filter.
- the filter cake was washed with deionized water and dried under vacuum (approx. 80 mbar, 60°C). 428.6 g crude (-).-ambrox were recovered (white-brownish, slightly sticky crystalline material).
- AacSHC P1 variant SEQ ID NO: 4 MAEQLVEAPAYARTLDRAVEYLLSCQKDEGYWWGPLLSNVTMEAEYVLLCHILDRVDRMEKIRRYLLHEQREDGT WALYPGGPPDLDTTIEAYVALKYIGMSRDEEPMQKALRFIQSQGGIESSRVFTRMWLALVGEYPWEKVPMVPPEIMFL GKRMPLNIYEFGSGARATVVALSIVMSRQPVFPLPERARVPELYETDVPPRRRGAKGGGGWIFDALDRALHGYQKLSV HPFRRAAEIRALDWLLERQAGDGSWGGIQPPWFYALIALKILDMTQHPAFIKGWEGLELYGVELDYGGWMFQASISP VWDTGLAVLALRAAGLPADHDRLVKAGEWLLDRQITVPGDWAVKRPNLKPGGFAFQFDNVYYPDVDDTAVVVWAL NTLRLPDERRRRDAMTKGFRWIVGMQSSNGGWGAYDVDNTSD
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- General Chemical & Material Sciences (AREA)
- Dermatology (AREA)
- Epidemiology (AREA)
- Birds (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Cosmetics (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202380037737.8A CN119137269A (zh) | 2022-03-17 | 2023-03-17 | Shc酶和酶变体 |
| MX2024011115A MX2024011115A (es) | 2022-03-17 | 2023-03-17 | Enzimas escualeno-hopeno-ciclasa (shc) y variantes de enzimas. |
| EP23710377.5A EP4493685A1 (en) | 2022-03-17 | 2023-03-17 | Shc enzymes and enzyme variants |
| JP2024555120A JP2025509737A (ja) | 2022-03-17 | 2023-03-17 | Shc酵素および酵素バリアント |
| US18/847,838 US20260043058A1 (en) | 2022-03-17 | 2023-03-17 | Shc enzymes and enzyme variants |
| IL315567A IL315567A (en) | 2022-03-17 | 2023-03-17 | SHC enzymes and enzyme variants |
| CONC2024/0013848A CO2024013848A2 (es) | 2022-03-17 | 2024-10-15 | Enzimas escualeno-hopeno-ciclasa (shc) y variantes de enzimas |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP22162848.0 | 2022-03-17 | ||
| EP22162848 | 2022-03-17 | ||
| EP22168607 | 2022-04-14 | ||
| EP22168607.4 | 2022-04-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023175123A1 true WO2023175123A1 (en) | 2023-09-21 |
Family
ID=85569892
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2023/056842 Ceased WO2023175123A1 (en) | 2022-03-17 | 2023-03-17 | Shc enzymes and enzyme variants |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20260043058A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4493685A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2025509737A (cg-RX-API-DMAC7.html) |
| CN (1) | CN119137269A (cg-RX-API-DMAC7.html) |
| CO (1) | CO2024013848A2 (cg-RX-API-DMAC7.html) |
| IL (1) | IL315567A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024011115A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023175123A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024112870A1 (en) * | 2022-11-23 | 2024-05-30 | Conagen Inc. | Conversion of homofarnesol to ambroxide |
| WO2024256473A3 (en) * | 2023-06-12 | 2025-03-27 | Firmenich Sa | Polypeptides for preparing terpenoid compounds |
| EP4563705A1 (en) * | 2023-11-30 | 2025-06-04 | Universität Stuttgart | Biocatalytic stereocontrolled production of 1-(r)-cis-pmd |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6524831B2 (en) | 1996-11-29 | 2003-02-25 | Haarmann & Reimer Gmbh | Synthetic enzymes for the production of coniferyl alcohol, coniferylaldehyde, ferulic acid, vanillin and vanillic acid and their use |
| US20030092143A1 (en) | 1999-12-14 | 2003-05-15 | Jurgen Rabenhorst | Enzymes and genes used for producing vanillin |
| JP2009060799A (ja) | 2007-09-04 | 2009-03-26 | Kao Corp | (−)−アンブロキサンの製造方法 |
| WO2010139719A2 (de) | 2009-06-05 | 2010-12-09 | Basf Se | Biokatalytische herstellung von ambroxan |
| WO2012066059A2 (de) | 2010-11-17 | 2012-05-24 | Basf Se | Verfahren zur biokatalytischen cyclisierung von terpenen und darin einsetzbare cyclase-mutanten |
| US20130273619A1 (en) | 2012-04-16 | 2013-10-17 | Basf Se | Process for the Preparation of (3E, 7E)-Homofarnesol |
| WO2013156398A1 (de) | 2012-04-16 | 2013-10-24 | Basf Se | Verbessertes verfahren zur herstellung von (3e, 7e)-homofarnesol |
| WO2016170099A1 (en) | 2015-04-24 | 2016-10-27 | Givaudan Sa | Enzymes and applications thereof |
| WO2017182542A1 (en) | 2016-04-22 | 2017-10-26 | Givaudan Sa | A solid form of (-)-ambrox formed by a bioverversion of homofarnesol in the presence of a biocatalyst |
| WO2018157021A1 (en) | 2017-02-24 | 2018-08-30 | International Flavors & Fragrances Inc. | Squalene hopene cyclase and use thereof for producing ambroxan |
| WO2021110848A1 (en) | 2019-12-04 | 2021-06-10 | Givaudan Sa | Squalene hopene cyclase (shc) variants |
| WO2021110858A1 (en) | 2019-12-04 | 2021-06-10 | Givaudan Sa | Enzyme mediated process |
| WO2021209482A1 (en) | 2020-04-15 | 2021-10-21 | Givaudan Sa | Enzyme-mediated process for making amberketal and amberketal homologues |
| WO2022023464A1 (en) | 2020-07-30 | 2022-02-03 | Givaudan Sa | Method for purifying (-)-ambrox |
| WO2022106522A1 (en) * | 2020-11-18 | 2022-05-27 | Universität Stuttgart | Enzymatic monocyclization of acyclic monoterpenoids |
-
2023
- 2023-03-17 CN CN202380037737.8A patent/CN119137269A/zh active Pending
- 2023-03-17 JP JP2024555120A patent/JP2025509737A/ja active Pending
- 2023-03-17 WO PCT/EP2023/056842 patent/WO2023175123A1/en not_active Ceased
- 2023-03-17 IL IL315567A patent/IL315567A/en unknown
- 2023-03-17 MX MX2024011115A patent/MX2024011115A/es unknown
- 2023-03-17 US US18/847,838 patent/US20260043058A1/en active Pending
- 2023-03-17 EP EP23710377.5A patent/EP4493685A1/en active Pending
-
2024
- 2024-10-15 CO CONC2024/0013848A patent/CO2024013848A2/es unknown
Patent Citations (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6524831B2 (en) | 1996-11-29 | 2003-02-25 | Haarmann & Reimer Gmbh | Synthetic enzymes for the production of coniferyl alcohol, coniferylaldehyde, ferulic acid, vanillin and vanillic acid and their use |
| US20030092143A1 (en) | 1999-12-14 | 2003-05-15 | Jurgen Rabenhorst | Enzymes and genes used for producing vanillin |
| JP2009060799A (ja) | 2007-09-04 | 2009-03-26 | Kao Corp | (−)−アンブロキサンの製造方法 |
| US8759043B2 (en) | 2009-06-05 | 2014-06-24 | Basf Se | Biocatalytic production of ambroxan |
| WO2010139719A2 (de) | 2009-06-05 | 2010-12-09 | Basf Se | Biokatalytische herstellung von ambroxan |
| US20120135477A1 (en) | 2009-06-05 | 2012-05-31 | Basf Se | Biocatalytic Production of Ambroxan |
| WO2012066059A2 (de) | 2010-11-17 | 2012-05-24 | Basf Se | Verfahren zur biokatalytischen cyclisierung von terpenen und darin einsetzbare cyclase-mutanten |
| WO2013156398A1 (de) | 2012-04-16 | 2013-10-24 | Basf Se | Verbessertes verfahren zur herstellung von (3e, 7e)-homofarnesol |
| US20130273619A1 (en) | 2012-04-16 | 2013-10-17 | Basf Se | Process for the Preparation of (3E, 7E)-Homofarnesol |
| WO2016170099A1 (en) | 2015-04-24 | 2016-10-27 | Givaudan Sa | Enzymes and applications thereof |
| WO2017182542A1 (en) | 2016-04-22 | 2017-10-26 | Givaudan Sa | A solid form of (-)-ambrox formed by a bioverversion of homofarnesol in the presence of a biocatalyst |
| WO2018157021A1 (en) | 2017-02-24 | 2018-08-30 | International Flavors & Fragrances Inc. | Squalene hopene cyclase and use thereof for producing ambroxan |
| WO2021110848A1 (en) | 2019-12-04 | 2021-06-10 | Givaudan Sa | Squalene hopene cyclase (shc) variants |
| WO2021110858A1 (en) | 2019-12-04 | 2021-06-10 | Givaudan Sa | Enzyme mediated process |
| WO2021209482A1 (en) | 2020-04-15 | 2021-10-21 | Givaudan Sa | Enzyme-mediated process for making amberketal and amberketal homologues |
| WO2022023464A1 (en) | 2020-07-30 | 2022-02-03 | Givaudan Sa | Method for purifying (-)-ambrox |
| WO2022106522A1 (en) * | 2020-11-18 | 2022-05-27 | Universität Stuttgart | Enzymatic monocyclization of acyclic monoterpenoids |
Non-Patent Citations (36)
| Title |
|---|
| "A multilingual glossary of biotechnological terms: (IUPAC Recommendations", 1995, HELVETICA CHIMICA ACTA |
| "Biocomputing: Informatics and Genome Projects", 1993, ACADEMIC PRESS |
| "Computer Analysis of Sequence Data", 1994, HUMANA PRESS |
| "Current Protocols in Molecular Biology", 1991, JOHN WILEY & SONS |
| "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| BOLSTER ET AL., TETRAHEDRON, vol. 58, no. 26, 2002, pages 5275 - 5285 |
| BRUDNO M, BIOINFORMATICS, vol. 19, 2003, pages 154 - 162 |
| CARILLO, H.LIPMAN, D., SIAM J. APPLIED MATH, vol. 48, 1988, pages 1073 |
| CAS , no. 35826- 67-6 |
| DATABASE Geneseq [online] 18 October 2018 (2018-10-18), "Gluconobacter morbifer mutant squalene hopene cyclase (SHC) #11.", XP002807725, retrieved from EBI accession no. GSP:BFQ23453 Database accession no. BFQ23453 * |
| DATABASE Geneseq [online] 18 October 2018 (2018-10-18), "Gluconobacter morbifer mutant squalene hopene cyclase (SHC) #48.", XP002807724, retrieved from EBI accession no. GSP:BFQ23490 Database accession no. BFQ23490 * |
| DATABASE Geneseq [online] 18 October 2018 (2018-10-18), "Gluconobacter morbifer mutant squalene hopene cyclase (SHC) #49.", XP002807723, retrieved from EBI accession no. GSP:BFQ23491 Database accession no. BFQ23491 * |
| DATABASE Geneseq [online] 23 June 2022 (2022-06-23), "A. acidocaldarius SHC protein A306V/Y420F/G600T/L607A, SEQ ID 6.", XP002807734, retrieved from EBI accession no. GSP:BKZ34169 Database accession no. BKZ34169 * |
| DATABASE Geneseq [online] 23 June 2022 (2022-06-23), "SHC protein mutant G600T/L607A/Y420F/A306V/D436I, SEQ ID 2.", XP002807733, retrieved from EBI accession no. GSP:BKZ34165 Database accession no. BKZ34165 * |
| EICHHORN ERIC ET AL: "Alicyclobacillus acidocaldarius Squalene-Hopene Cyclase: The Critical Role of Steric Bulk at Ala306 and the First Enzymatic Synthesis of Epoxydammarane from 2,3-Oxidosqualene", vol. 360, no. 12, 2 May 2018 (2018-05-02), pages 2339 - 2351, XP055777821, ISSN: 1615-4150, Retrieved from the Internet <URL:https://api.wiley.com/onlinelibrary/tdm/v1/articles/10.1002%2Fadsc.201800132> DOI: 10.1002/adsc.201800132 * |
| EICHHORN ET AL., ADV. SYNTH. CATAL., vol. 360, 2018, pages 2339 - 2351 |
| EICHHORN ET AL., ADV.SYNTH.CATAL, vol. 360, 2018, pages 2339 - 2351 |
| FUKUDA YORIYUKI ET AL: "Mutated variants of squalene-hopene cyclase: enzymatic syntheses of triterpenes bearing oxygen-bridged monocycles and a new 6,6,6,6,6-fusded pentacyclic scaffold, named neogammacerane, from 2,3-oxidosqualene", ORGANIC & BIOMOLECULAR CHEMISTRY, vol. 16, no. 37, 6 September 2018 (2018-09-06), pages 8365 - 8378, XP055970191, ISSN: 1477-0520, DOI: 10.1039/C8OB02009D * |
| HENTIKOFFHENTIKOFF, PROC. NATL. ACAD. SCI. USA., vol. 89, 1992, pages 10915 - 10919 |
| IDENO NATSUMI ET AL: "Alicyclobacillus acidocaldarius Squalene-Hopene Cyclase: The Critical Role of Steric Bulk at Ala306 and the First Enzymatic Synthesis of Epoxydammarane from 2,3-Oxidosqualene", vol. 19, no. 17, 17 June 2018 (2018-06-17), pages 1873 - 1886, XP055970189, ISSN: 1439-4227, Retrieved from the Internet <URL:https://onlinelibrary.wiley.com/doi/full-xml/10.1002/cbic.201800281> DOI: 10.1002/cbic.201800281 * |
| J MOL BIOL, vol. 286, 1999, pages 175 - 187 |
| KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
| LIU ET AL., A NOVEL SOLUBLE SQUALENE-HOPENE CYCLASE AND ITS APPLICATION IN EFFICIENT SYNTHESIS OF HOPENE, FRONTIERS IN BIOENGINEERING AND BIOTECHNOLOGY, vol. 8, 2020, Retrieved from the Internet <URL:https://doi.org/10.3389/fbioe.2020.00426> |
| MYERSMILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
| NEUMANNSIMON, BIOL CHEM HOPPE-SEYLER, vol. 367, 1986, pages 723 - 729 |
| OCHS ET AL., J BACTERIOL, vol. 174, 1990, pages 298 - 302 |
| REIPEN ET AL., MICROBIOLOGY, vol. 141, 1995, pages 155 - 161 |
| SCHAEFER, CHEMIE UNSERERZEIT, vol. 45, 2011, pages 374 - 388 |
| SECKLERPORALLA, BIOCHEM BIOPHYS ACT, 1986, pages 356 - 363 |
| SEITZ ET AL., J MOLECULAR CATALYSIS B: ENZYMATIC, vol. 84, 2012, pages 72 - 77 |
| SEITZ, PHD THESIS, 2012, Retrieved from the Internet <URL:http://elib.uni-stuttqart.de/handle/11682/1400> |
| THOMPSON, J. D.HIGGINS, D. G.GIBSON, T. J., NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 80 |
| WENDT ET AL., SCIENCE, vol. 277, 1997, pages 1811 - 1815 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024112870A1 (en) * | 2022-11-23 | 2024-05-30 | Conagen Inc. | Conversion of homofarnesol to ambroxide |
| WO2024256473A3 (en) * | 2023-06-12 | 2025-03-27 | Firmenich Sa | Polypeptides for preparing terpenoid compounds |
| EP4563705A1 (en) * | 2023-11-30 | 2025-06-04 | Universität Stuttgart | Biocatalytic stereocontrolled production of 1-(r)-cis-pmd |
Also Published As
| Publication number | Publication date |
|---|---|
| CO2024013848A2 (es) | 2025-03-27 |
| JP2025509737A (ja) | 2025-04-11 |
| IL315567A (en) | 2024-11-01 |
| US20260043058A1 (en) | 2026-02-12 |
| EP4493685A1 (en) | 2025-01-22 |
| MX2024011115A (es) | 2024-09-18 |
| CN119137269A (zh) | 2024-12-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12071645B2 (en) | Enzymes and applications thereof | |
| US12584153B2 (en) | Enzyme-mediated process for making Amberketal and Amberketal homologues | |
| US20260043058A1 (en) | Shc enzymes and enzyme variants | |
| US20250361536A1 (en) | Squalene hopene cyclase (shc) variants | |
| US11965195B2 (en) | Enzyme mediated process | |
| RU2829857C1 (ru) | Варианты скваленгопенциклазы (shc) | |
| RU2829857C9 (ru) | Варианты скваленгопенциклазы (shc) | |
| BR122023025399A2 (pt) | Enzimas de esqualeno hopeno ciclase (sch) e suas variantes, produtos de conversão enzimática, seus processos de preparação e produtos derivados | |
| RU2836734C1 (ru) | Ферменты и их применение |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23710377 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 315567 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2024/011115 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024555120 Country of ref document: JP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024018671 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417077773 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2024/0013848 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024130379 Country of ref document: RU Ref document number: 2023710377 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023710377 Country of ref document: EP Effective date: 20241017 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202405485R Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380037737.8 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112024018671 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240911 |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2024/0013848 Country of ref document: CO |