WO2023173132A1 - Anti-glp1r antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof - Google Patents
Anti-glp1r antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof Download PDFInfo
- Publication number
- WO2023173132A1 WO2023173132A1 PCT/US2023/064203 US2023064203W WO2023173132A1 WO 2023173132 A1 WO2023173132 A1 WO 2023173132A1 US 2023064203 W US2023064203 W US 2023064203W WO 2023173132 A1 WO2023173132 A1 WO 2023173132A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- set forth
- sequence set
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2869—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
Definitions
- the present disclosure relates to antibody-tethered drug conjugates, pharmaceutical compositions, and methods of treating GLP1 -associated conditions therewith.
- Diabetes is a chronic disease of abnormal glucose metabolism. 425 million people are estimated to be living with diabetes worldwide.
- Global diabetes drugs include insulin, DPP-4 inhibitors, glucagon-like peptide 1 receptor (GLP1 R) agonists, but most patients do not achieve combined treatment goal to manage hyperglycaemia and cardiovascular risk factors.
- GLP1 R glucagon-like peptide 1 receptor
- GLP1R Glucagon-Like Peptide 1 Receptor
- GLP1 R is the receptor for glucagon-like peptide 1 (GLP1) and is expressed in the pancreatic beta cells. GLP1 R is also expressed in the brain where it functions in the control of appetite, memory and learning. GLP1 R is a member of the secretin family (Class B) of G protein-coupled receptors (GPCRs). Upon binding of its ligand, GLP1, GLP1 R initiates a downstream signaling cascade through Gas G-proteins that raises intracellular cyclic AMP (cAMP) levels, which leads to the transcriptional regulation of genes (Donnelly 2011). Activation of GLP1 R results in increased insulin synthesis and release of insulin.
- GLP1R and GLP1 are highly validated targets for obesity and type 2 diabetes. Marketed GLP1 R agonists increase insulin secretion, thereby lowering blood glucose levels, but they require weekly or more frequent administration.
- the present invention provides an antibody-tethered drug conjugate (ATDC) having a structure of Formula (A):
- BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i);
- L is a non-cleavable linker; optionally, wherein the heavy chain immunoglobulin of the BA does not comprise a C-terminal lysine or lysine and glycine;
- P is a payload having the structure selected from the group consisting of:
- Tr is a triazole moiety; n is 0 or 1 ;
- X4 is selected from -NH 2 , -OH and -N(H)(phenyl);
- X 5 is selected from
- X 6 is independently at each occurrence selected from H, -OH, -CH 3 , and -CH 2 OH; m is an integer from 1 to 4 or a pharmaceutically acceptable salt thereof.
- the present invention also provides an ATDC having a structure of Formula (I):
- BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203;
- a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i);
- L is a non-cleavable linker; optionally, wherein the heavy chain immunoglobulin of the BA does not comprise the C-terminal lysine or lysine and glycine;
- P is a payload having the structure selected from the group consisting of: wherein is the point of attachment of the payload P to L;
- X 3 is selected from -(CH2)2-e-NH- and -(CH2)2-e-Tr-, where Tr is a triazole moiety; n is 0 or 1 ;
- X 4 is selected from H and phenyl
- X5 is selected from
- X 6 is independently at each occurrence selected from H, -OH, -CH 3 , and -CH 2 OH; or a pharmaceutically acceptable salt thereof.
- the BA of the ATDC is an antibody that binds specifically to GLP1 R which is antibody 5A10, 9A10, AB9433-I, h38C2, PA5-111834, NLS1205, MAB2814, EPR21819, or glutazumab; or an antigen binding fragment thereof.
- the linker L is attached to one or both heavy chains of the BA. In some embodiments, the linker L is attached to one or both heavy chain variable domains of the BA. In some embodiments, the linker L is attached to one or both light chains of the BA. In some embodiments, the linker L is attached to one or both light chain variable domains of the BA. [00013] In some embodiments of the invention, the linker L is attached to BA via a glutamine residue on the BA. In some embodiments, the glutamine residue is introduced to the N-terminus of one or both heavy chains of the BA. In some embodiments of the invention, the glutamine residue is introduced to the N-terminus of one or both light chains of the BA.
- the glutamine residue is naturally present in a CH2 or CH3 domain of the BA. In some embodiments of the invention, the glutamine residue is introduced to the BA by modifying one or more amino acids. In some embodiments of the invention, the glutamine residue is Q295 or N297Q.
- the linker L is attached to BA via a lysine residue.
- the heavy chain immunoglobulin of the BA does not comprise the C-terminal lysine or lysine and glycine. In some embodiments, the heavy chain immunoglobulin of the BA does not comprise a C-terminal lysine. In some embodiments, the heavy chain immunoglobulin does not comprise C-terminal lysine and glycine.
- the heavy chain immunoglobulin that does not comprise C-terminal lysine and glycine also means the heavy chain immunoglobulin that does not comprise lysine and glycine at the C-terminal.
- the antibody or antigen-binding fragment thereof is aglycosylated. In some embodiments of the invention, the antibody or antigen-binding fragment thereof is deglycosylated. In some embodiments of the invention, the antigen-binding fragment is an Fab fragment.
- m is 1. In an embodiment, m is an integer from 2 to 4. In one embodiment of the invention, m is 2.
- more than one L-P is attached to the BA. In some embodiments, two L-Ps are attached to the BA.
- the linker L has the structure of formula (L’):
- Y is a group comprising a triazole
- Lp is absent or a second linker covalently attached to the P, wherein when Lp is absent, Y is also absent.
- Y has a structure selected from the group consisting of: wherein Q is C or N.
- Lp comprises a polyethylene glycol (PEG) segment having 1 to 36 -CH 2 CH 2 O- (EG) units.
- the PEG segment comprises between 2 and 30 EG units.
- the PEG segment comprises between 4 and 24 EG units.
- the PEG segment comprises 4 EG units, or 8 EG units, or 12 EG units, or 24 EG units.
- the PEG segment comprises 4 EG units.
- the PEG segment comprises 8 EG units.
- Y-Lp has a structure selected from the group consisting of: triazole regioisomer thereof, wherein p is an integer from 1 to 36.
- the Lp comprises one or more amino acids selected from glycine, serine, glutamic acid, alanine, valine, and proline and combinations thereof. In some embodiments, the Lp comprises 1 to 10 glycines. In some embodiments, the Lp comprises 1 to 6 serines. In some embodiments of the invention, the Lp comprises 1 to 10 glycines and 1 to 6 serines. In some embodiments of the invention, the Lp comprises 4 glycines and 1 serine.
- the Lp is selected from the group consisting of Gly- Gly-Gly-Gly-Ser (G 4 S) (SEQ ID NO: 1), Ser-Gly-Gly-Gly-Gly (SG 4 ) (SEQ ID NO: 2), and Gly-Gly- Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser (G 4 S-G 4 S) (SEQ ID NO: 3).
- the Lp comprises a combination of a PEG segment having 1 to 36 EG units and one or more amino acids selected from glycine, serine, glutamic acid, alanine, valine, and proline and combinations thereof.
- the serine residue comprises a carbohydrate group.
- the serine residue comprises a glucose group.
- Lp has a structure selected from the group consisting of: wherein Y is the group comprising a triazole and P is the payload, and wherein Rc is selected from H and glucose, g is an integer from 1 to 10 and s is an integer from 0 to 4.
- Y-Lp has a structure selected from the group consisting of:
- La comprises a polyethylene glycol (PEG) segment having 1 to 36 -CH2CH2O- (EG) units.
- the PEG segment comprises 4 EG units, or 8 EG units, or 12 EG units, or 24 EG units.
- the PEG segment comprises 8 EG units.
- La has a structure selected from the group consisting of
- La comprises one or more amino acids selected from glycine, threonine, serine, glutamine, glutamic acid, alanine, valine, leucine, and proline and combinations thereof. In some embodiments of the invention, La comprises 1 to 10 glycines and 1 to 6 serines. In some embodiments of the invention, La comprises 4 glycines and 1 serine.
- La is selected from the group consisting of Gly-Gly- Gly-Gly-Ser (G4S), Ser-Gly-Gly-Gly-Gly (SG4), Gly-Gly-Ser-Gly-Gly-Ser-Gly-Gly (G2S-G2S-G2), and Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Gly (G4S-G4).
- La comprises a combination of a PEG segment having 1 to 36 EG units and one or more amino acids selected from glycine, threonine, serine, glutamine, glutamic acid, alanine, valine, leucine, and proline and combinations thereof.
- La is selected from the group consisting of:
- La comprises a -(CH2)2-24- chain. In some embodiments, La comprises a combination of a -(CH 2 )2-24- chain, a PEG segment having 1 to 36 EG units and one or more amino acids selected from glycine, threonine, serine, glutamine, glutamic acid, alanine, valine, leucine, and proline and combinations thereof. La is selected from the group consisting of: [00031] In various embodiments of the invention, P has the structure
- Tr is a triazole moiety
- n is 1
- X 4 is H.
- n 1 ;
- X4 is H;
- Xe is independently at each occurrence selected from H and -
- Tr is a triazole moiety
- X3 is -(CH 2 ) 2 -6-NH-; n is 1 ; X 4 is H, and X 8 is H.
- n 1 ;
- X 4 is H;
- Xe is H at each occurrence;
- Xi is independently at each occurrence selected from H and -CH3; [00041] In some embodiments of the invention, Xi ; X 2 is
- n is 1
- X 4 is H
- n 1 ;
- X 4 is phenyl
- P has the structure
- P has the structure selected from the group consisting of:
- the ATDC of the present invention has a half life of longer than 7 days in plasma.
- the ATDC of the present invention does not bind to G protein-coupled receptors (GPCRs) other than GLP1 R.
- GPCRs G protein-coupled receptors
- a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof or ATDC, wherein at least about 80% of the antibody or antigen-binding fragment thereof or ATDC does not comprise a C-terminal lysine or lysine and glycine in any of the heavy chains.
- the antibody or antigen-binding fragment thereof or ATDC does not comprise a C-terminal lysine. In some embodiments, the antibody or antigen-binding fragment thereof or ATDC does not comprise C-terminal lysine and glycine.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, at least about 90% of the antibody or antigen-binding fragment thereof or ATDC does not comprise a C-terminal lysine or lysine and glycine in any of the heavy chains.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, about 90% of the antibody or antigenbinding fragment thereof or ATDC does not comprise a C-terminal lysine or lysine and glycine in any of the heavy chains.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, at least about 95% of the antibody or antigen-binding fragment thereof or ATDC does not comprise a C-terminal lysine or lysine and glycine in any of the heavy chains.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, at least about 99% of the antibody or antigen-binding fragment thereof or ATDC does not comprise a C-terminal lysine or lysine and glycine in any of the heavy chains.
- the heavy chain immunoglobulin described above that does not comprise a C-terminal lysine comprises the amino acid sequence set forth in SEQ ID NO: 414, or 416, or a variant thereof.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, less than about 20% of the antibody or antigen-binding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, less than about 10% of the antibody or antigen-binding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, about 10% of the antibody or antigen- binding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, less than about 5% of the antibody or antigen-binding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, less than abouit 1% of the antibody or antigen-binding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the pharmaceutical composition comprises the antibody or antigen-binding fragment thereof or ATDC, about 10% of the antibody or antigenbinding fragment or ATDC comprises a C-terminal lysine or lysine and glycine in at least one heavy chain.
- the at least one heavy chain that comprises a C- terminal lysine or lysine and glycine described above comprises the amino acid sequence set forth in SEQ ID NO: 42; 62; 82; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271 ; 291 ; 311 ; 331; 351 ; 371 ; 391 ; or 411 ; or a variant thereof.
- the at least one heavy chain that comprises a C- terminal lysine described above comprises the amino acid sequence set forth in SEQ ID NO: 82.
- a pharmaceutical composition comprising the antibody or antigen-binding fragment therof or ATDC and a pharmaceutically acceptable carrier.
- a pharmaceutical dosage form comprising an antibody or antigen-binding fragment thereof or ATDC described herein.
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1 R comprises: (a) the heavy chain immunoglobulin or variable region thereof comprises an amino acid sequence having at least 90% amino acid sequence identity to the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271 ; 291 ; 311; 331; 351 ; 371 ; 391 ; or 411 ; and/or (b) the light chain immunoglobulin or variable region thereof comprises an amino acid sequence having at least 90% amino acid sequence identity to the amino acid
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1 R comprises: (a) the heavy chain immunoglobulin or variable region thereof comprises the CDR-H1 , CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof comprising an amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371 ; 391; or 411 , and at least 90% amino acid sequence identity to the amino acid sequence set
- the light chain immunoglobulin or variable region thereof comprises the CDR-L1 , CDR-L2 and CDR-L3 of a light chain immunoglobulin or variable region thereof comprising an amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283; 303; 323; 343; 363; 383; 403; 44; 64; 84; 104; 124; 144; 164; 184; 205; 225; 245; 265; 269; 273; 293
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1 R comprises: the heavy chain immunoglobulin or variable region thereof comprises: (i) a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 28, or a variant thereof; a CDR-H2 comprising the amino acid sequence set forth in SEQ ID NO: 30, or a variant thereof; a CDR-H3 comprising the amino acid sequence set forth in SEQ ID NO: 32, or a variant thereof; (ii) a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 48, or a variant thereof; a CDR-H2 comprising the amino acid sequence set forth in SEQ ID NO: 50, or a variant thereof; a CDR-H3 comprising the amino acid sequence set forth in SEQ ID NO: 52, or a variant thereof; (iii) a CDR-H1 comprising the amino acid
- a CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO: 217, or a variant thereof; a CDR-L2 comprising the amino acid sequence set forth in SEQ ID NO: 219, or a variant thereof; a CDR-L3 comprising the amino acid sequence set forth in SEQ ID NO: 221 , or a variant thereof; (k) a CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO: 237, or a variant thereof; a CDR-L2 comprising the amino acid sequence set forth in SEQ ID NO: 239, or a variant thereof; a CDR-L3 comprising the amino acid sequence set forth in SEQ ID NO: 241 , or a variant thereof; (I) a CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO: 257, or a variant thereof; a CDR-L2 comprising the amino acid sequence set forth in SEQ ID NO: 259, or a variant thereof; a CDR
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1 R comprises: (1) the heavy chain immunoglobulin or variable region thereof comprises a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 28, or a variant thereof; a CDR-H2 comprising the amino acid sequence set forth in SEQ ID NO: 30, or a variant thereof; and a CDR-H3 comprising the amino acid sequence set forth in SEQ ID NO: 32 ; and the light chain immunoglobulin or variable region thereof comprises a CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO: 36, or a variant thereof; a CDR-L2 comprising the amino acid sequence set forth in SEQ ID NO: 38, or a variant thereof; and a CDR-L3 comprising the amino acid sequence set forth in SEQ ID NO: 40, or a variant thereof; (2) the heavy chain immunoglobulin or variable region thereof comprises a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 28, or
- H2 comprising the amino acid sequence set forth in SEQ ID NO: 379, or a variant thereof; a CDR-
- the heavy chain immunoglobulin or variable region thereof comprises a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 397, or a variant thereof; a CDR-H2 comprising the amino acid sequence set forth in SEQ ID NO: 399, or a variant thereof; a CDR-H3 comprising the amino acid sequence set forth in SEQ ID NO: 401, or a variant thereof; and the light chain immunoglobulin or variable region thereof comprises a CDR-L1 comprising the amino acid sequence set forth in SEQ ID NO: 385, or a variant thereof; a CDR-L2 comprising the amino acid sequence set forth in SEQ ID NO: 387, or a variant thereof; a CDR-L3 comprising the amino acid sequence set forth in SEQ ID NO: 389, or a variant thereof; or (19) the heavy chain immunoglobulin or variable region thereof comprises a CDR-H1 comprising the amino acid sequence set forth in SEQ ID NO: 397, or a variant thereof; a CDR
- the antibody or antigenbinding fragment thereof that binds specifically to GLP1 R comprises: (a) the heavy chain immunoglobulin or variable region thereof comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247;
- the light chain immunoglobulin or variable region thereof comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283; 303; 323; 343; 363; 383; 403; 44; 64; 84; 104; 124; 144; 164; 184; 205; 225; 245; 265; 269; 273; 293; 313; 333; 353; 373; 393; or 413, or a variant thereof
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1 R comprises: (a) the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 26, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 34; (b) the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 46, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 54; (c) the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 66, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 74; (d) the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 86, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO:
- the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 315, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 323;
- the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 335, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 343;
- the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 355, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 363;
- the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 375, and the light chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 383; and/or (s) the heavy chain immunoglobulin variable region comprises the amino acid sequence set forth in SEQ ID NO: 395, and the light chain immunoglobulin variable
- the antibody or antigen-binding fragment thereof that binds specifically to GLP1R comprises: (a) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 42, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 44; (b) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 62, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 64; (c) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 82, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 84; (d) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 102, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 104; (e) the heavy chain immunoglobulin comprises the
- the present invention provides an antibody-tethered drug conjugate comprising a Glucagon-like peptide-1 receptor (GLP1 Retargeting antibody or an antigen-binding fragment thereof comprising: (a) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 42, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 44; (b) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 62, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 64; (c) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 82, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 84; (d) the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 102, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 104; (e) the heavy chain immunoglob
- the present invention provides an antibody-tethered drug conjugate comprising a Glucagon-like peptide-1 receptor (GLP1 Retargeting antibody or an antigen-binding fragment thereof comprising:
- the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 42, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 44;
- the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 62, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 64;
- the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 82, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 84;
- the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 102, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 104;
- the heavy chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 122, and the light chain immunoglobulin comprises the amino acid sequence set forth in SEQ ID NO: 124;
- the heavy chain immunoglobulin comprises the amino acid sequence
- the present invention also provides an antibody-tethered drug conjugate (ATDC) comprising an antibody or antigen-binding fragment thereof that binds specifically to GLP1 R and a payload that is conjugated to a linker which is conjugated to one or both of two immunoglobulin heavy chains or variable regions thereof and/or one or both of two immunoglobulin light chains or variable regions thereof of the antibody or fragment which is characterized by the structure:
- ATDC antibody-tethered drug conjugate
- immunoglobulin wherein immunoglobulin is the immunoglobulin chain of the antibody or fragment (e.g., the light chain immunoglobulin);
- Linker is a linker as discussed herein;
- CapAib is 3-((2-(1 H-imidazol-5-yl)ethyl)amino)-2,2-dimethyl-3-oxopropanoic acid;
- E* is (S)-2-amino-3-(2H-tetrazol-5-yl)propanoic acid;
- G is glycine
- T is threonine
- F* is (S)-2-amino-3-(2-fluorophenyl)-2-methylpropanoic acid
- AA2 is (S)-2-amino-3-(4'-(4-(4-(4-(25-amino-2,5,8,11 ,14,17,20,23-octaoxapentacosyl)-1 H-1 ,2,3- triazol-1-yl)butoxy)-2'-ethyl-[1,1'-biphenyl]-4-yl)propanoic acid [AA2 includes linker]; and
- AA1 (S)-2-amino-5-(3,5-dimethylphenyl)pentanamide.
- the structure includes, for example, G-T or CapAib-E*, which indicates that these residues are joined by a bond, e.g., a peptide bond.
- the antibody or fragment includes a Qtag including the amino acid sequence LLQGSG (SEQ ID NO: 18) in both of the immunoglobulin light chains.
- H2N-L-P is a linker-payload having an -NH2 group.
- Aminylation refers to the process by which primary amines, e.g., of a linker-payload, are covalently coupled to a peptide-bound glutamine residue by a transglutaminase.
- transglutaminase When transglutaminase is in the vicinity of a peptide Gin residue, and there are primary amine substrates available (e.g., a linker-payload having a primary amine, such as M3190), the enzyme catalyzes the incorporation of the primary amino group to glutamine resulting in the formation of a gamma-glutamyl-amine bond.
- the result of such a reaction may be referred to herein as a “aminylation product”.
- An aminylation product may, but not necessarily, be the product of the catalysis of two molecules by a transglutaminase enzyme.
- an aminylation product may be the result of chemical synthesis without use of a transglutaminase enzyme. See Lai et al., Tissue transglutaminase (TG2) and mitochondrial function and dysfunction, Frontiers in Bioscience-Landmark. 2017. 22(7); 1114-1137.
- the present invention also provides a method of selectively targeting GLP1 R on the surface of a cell (e.g. , in the body of a subject or in vitro) for delivery of a payload (e.g. , L11 , L30 or L32) with an ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN15869; REGN18121; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426; REGN5203; REGN5204;
- the linker-payload is LP11 , LP30 or LP32
- the method comprises the step of administering the ATDC or a pharmaceutical composition thereof, to a subject in whose body the cell exists.
- the cell is a mammalian cell. In some embodiments, the cell is a human cell.
- the cell is a pancreatic cell, a brain cell, a heart cell, a vascular tissue cell, a kidney cell, an adipose tissue cell, a liver cell, or a muscle cell.
- the present invention provides a method of enhancing GLP1 R activity in a subject in need thereof comprising administering to the subject an effective amount of the ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN15869; REGN18121 ;
- the linker-payload is LP11 , LP30 or LP32), the composition described herein, or the dosage form described herein.
- the subject suffers from a GLP1 R-associated condition (e.g., obesity and/or diabetes (type 1 or type 2)).
- a method of lowering blood glucose levels in a subject in need thereof comprising administering to the subject an effective amount of ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN15869;
- the linker-payload is LP11, LP30 or LP32), the composition described herein, or the dosage form described herein.
- the subject suffers from a GLP1 R-associated condition (e.g., obesity and/or diabetes (type 1 or type 2)).
- a method of lowering body weight in an individual in need thereof comprising administering to the individual an effective amount of ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN 15869; REGN18121 ; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426; REGN5203; REGN5204; REGN5617;
- ATDC any of the embodiments described herein
- the linker-payload is LP11 , LP30 or LP32
- the composition described herein, or the dosage form described herein e.g., wherein the linker-payload is LP11 , LP30 or LP32
- the linker-payload is LP11 , LP30 or LP32
- the composition described herein, or the dosage form described herein e.g., the subject suffers from a GLP1 R-associated condition (e.g., obesity and/or diabetes (type 1 or type 2)).
- a GLP1 R-associated condition e.g., obesity and/or diabetes (type 1 or type 2)
- a method of treating a GLP1 R-associated condition in a subject in need thereof comprising administering to the subject an effective amount of ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN 15869; REGN18121 ; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619;
- an effective amount of ATDC of any of the embodiments described herein (e.g., REGN7990; REGN9268; REGN 15869; REGN18121 ; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619;
- the GLP1 R-associated condition is type II diabetes, obesity, liver disease, coronary artery disease, or kidney disease. In some embodiments, the GLP1 R-associated condition is type II diabetes and/or obesity.
- the ATDC, the composition, or the dosage form of the present disclosure e.g., REGN7990; REGN9268;
- linker-payload is LP11 , LP30 or LP32
- the linker-payload is administered subcutaneously, intravenously, intradermally, intraperitoneally, or intramuscularly.
- BA-(L-P) m A
- the method comprising the steps of: a) contacting, in the presence of a transglutaminase, the BA comprising at least m glutamine residues Gin with at least m equivalents of compound L-P, and b) isolating the produced ATDC of Formula (A); wherein BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- BA-L-P (I) the method comprising the steps of: a) contacting, in the presence of a transglutaminase, the BA comprising at least one glutamine residue Gin with a compound L-P, and b) isolating the produced ATDC of Formula (I); wherein, BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- Y is a group comprising a triazole
- Lp is a second linker covalently attached to the P, the method comprising the steps of: a) contacting, in the presence of a transglutaminase, the BA comprising at least m glutamine residues Gin with the first linker La comprising an azide or an alkyne moiety; b) contacting the product of step a) with at least m equivalents of compound Lp-P, wherein the second linker Lp comprises an azide or an alkyne moiety, wherein La and Lp are capable of reacting to produce a triazole, and c) isolating the produced ATDC of Formula (A); wherein BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- Y is a group comprising a triazole
- Lp is a second linker covalently attached to the P, the method comprising the steps of: a) contacting, in the presence of a transglutaminase, the BA comprising at least one glutamine residue Gin with the first linker La comprising an azide or an alkyne moiety; b) contacting the product of step a) with a compound Lp-P, wherein the second linker Lp comprises an azide or an alkyne moiety, wherein La and Lp are capable of reacting to produce a triazole, and c) isolating the produced ATDC of Formula (I); wherein BA is an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); which is conjugated, e g., by a linker, to a compound having a structure selected from the group consisting of Formula (P-l B), Formula (P-IIB), and Formula (P- IIIB):
- X 4 is selected from -NH 2 , -OH and -N(H)(phenyl);
- X5 is selected from
- Xe is independently at each occurrence selected from H, -OH, -CH3, and -CH 2 OH; m is an integer from 1 to 4 or a pharmaceutically acceptable salt thereof; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC that includess an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203;
- a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); which is conjugated, e.g., by a linker, to a compound having a structure of Formula (II):
- X3 is selected from -(CH2)2-e-NH2, -(CI-hh-e-Ns, and -CH3, with the proviso that when X3 is -CH3, n is 1 and Ra in at least one occurrence is selected from -(CH 2 )2-6-NH 2 and -(CH ⁇ h-e-Ns; n is 0 or 1 ; m is an integer from 0 to 3;
- Ra is independently at each occurrence selected from -CH 3 , -(CH 2 )2-6-NH 2 , and -(CH 2 ) 2.6 -N3;
- X4 is selected from H and phenyl
- X 5 is selected from
- X 6 is independently at each occurrence selected from H, -OH, -CH 3 , and -CH 2 OH; and pharmaceutically acceptable salts thereof; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- P (Payload) in an ATDC that is set forth herein has a structure selected from the group consisting of:
- P payload
- an antibody or an antigen-binding fragment thereof that binds specifically to GLP1R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i).; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203;
- a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); which is conjugated to a compound having a structure of Formula (C):
- L p is absent or a linker comprising one or more carbamate group; a cyclodextrin; a polyethylene glycol (PEG) segment having 1 to 36 -CH 2 CH 2 O- (EG) units; a - (CH 2 ) 2.2 4- chain; a triazole; one or more amino acids selected from glycine, serine, glutamic acid, alanine, valine, and proline, and combinations thereof;
- X 3 is selected from -CH 3 , -(CH 2 ) 2-6 -NH 2 , -(CH 2 ) 2-6 -N 3 , and -(CH 2 ) 2 .6-Tr-( CH 2 )I-6-NH 2 , where Tr is a triazole moiety; n is 0 or 1 ;
- X4 is selected from -NH 2 , -OH and -N(H)(phenyl);
- X 5 is selected from
- X 6 is independently at each occurrence selected from H, -OH, -CH 3 , and -CH 2 OH;
- n is an integer from 1 to 4 or a pharmaceutically acceptable salt thereof; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); which is conjugated to a compound having a structure of Formula wherein:
- L p is absent or a linker comprising one or more carbamate group; a cyclodextrin; a polyethylene glycol (PEG) segment having 1 to 36 -CH2CH2O- (EG) units; one or more amino acids selected from glycine, serine, glutamic acid, alanine, valine, and proline, and combinations thereof;
- PEG polyethylene glycol
- Q is a moiety selected from - where A is C or N;
- X3 is selected from -(CH2)2-6-NH2, -(CH2)2-e-Ns, and -CH3, with the proviso that when X3 is -CH3, n is 1 and Ra in at least one occurrence is selected from -(CH2)2-6-NH2 and -(CHs -e-Ns; n is 0 or 1 ;
- Ra is independently at each occurrence selected from H, -CH 3 , -(CH 2 )2-6-NH 2 , and -(CH 2 )2-6-N 3 ;
- X 4 is selected from H and phenyl
- X 5 is selected from
- X 6 is independently at each occurrence selected from H, -OH, -CH 3 , and -CH 2 OH; and pharmaceutically acceptable salts thereof; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- the present invention provides an ATDC that includes an antibody or an antigenbinding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207;
- a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); that is conjugated to a compound having a structure selected from the group consisting of:
- the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- the present invention includes an ATDC that includes an antibody or an antigenbinding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); that is conjugated, optionally through a linker, to a payload having the structure selected from the group consisting of:
- the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207;
- a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 34; 54; 74; 94; 114; 134; 154; 174; 195; 215; 235; 255; 283;
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); which is conjugated to a payload having the structure: wherein is the point of attachment of the payload to the antibody or the antigen-binding fragment thereof directly or through a linker; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- the payload on an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); has the structure: optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- an ATDC comprising a Glucagon-like peptide-1 receptor (GLP1 Retargeting antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); and a linker-payload having the structure: wherein 5 js the point of attachment of the linker-payload to the antibody or the antigenbinding fragment thereof; optionally, wherein the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- the linker-payload of an ATDC that includes an antibody or an antigen-binding fragment thereof that binds specifically to GLP1 R and, e.g., that
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- (ii) is an antibody or antigen-binding fragment thereof that competes for binding to GLP1 R with said antibody or fragment of (i);
- (iii) is an antibody or antigen-binding fragment thereof that binds to the same epitope of GLP1 R as said antibody or fragment of (i); has the structure:
- the heavy chain immunoglobulin does not comprise a C-terminal lysine or lysine and glycine.
- FIG. 1A shows a schematic representation of an exemplary antibody-tethered drug conjugate (ATDC) design and its mechanism of action.
- ATDC antibody-tethered drug conjugate
- Figure 1 B shows a schematic representation of a conventional antibody-drug conjugate (ADC) design and its mechanism of action.
- Figure 2 shows a model of an antibody-tethered drug conjugate having an antibody binding to extracellular domain (ECD) and a payload binding to the transmembrane domain (TMD).
- Figure 3A shows a schematic representation of GLP1 (7-36) amide (SEQ ID NO: 4). The numbers above the sequence correspond to the amino acid positions in the proglucagon propeptide. The arrow between position 8 and position 9 indicates the dipeptidyl peptidase-4 (DPP-IV) cleavage site.
- DPP-IV dipeptidyl peptidase-4
- the arrows between position 9 and position 10, between position 11 and position 12, between position 15 and position 16, between position 17 and position 18, between position 18 and position 19, between position 27 and position 28, between position 28 and position 29, and between position 31 and position 32 indicate the neutral endopeptidase (NEP) cleavage sites.
- the dashed arrows between position 30 and position 31 and between 32 and 33 indicate cleavage sites by unknown endoprotease(s).
- the residues at positions 7, 10, 13, 15, 28, and 29 are amino acids which, when substituted, reduce GLP1 R binding and cAMP production.
- the residues at positions 9, 12, 32, and 36 are amino acids which, when substituted, reduce GLP1 R binding.
- Figure 3B shows a structure of GLP1 R bound to GLP1 (Protein Data Bank ID: 3IOL). References of this structure may be found in Zhang et al. Nature 2017, Chepurny et al. JBC 2019, De Graaf et al. Pharmacological reviews 2016, and Manandhar and Ahn Journal of Medical Chemistry 2014, each of which is incorporated herein by reference in its entirety.
- Figure 4A shows the sequence and structure of a GLP1 peptidomimetic, Peptide 5 (SEQ ID NO: 5). The numbers above the sequence correspond to the amino acid positions in the proglucagon propeptide.
- Figure 4B shows superimposed structures of GLP1 R bound to Peptide 5 (Protein Data Bank ID: 5NX2) and GLP1 R bound to GLP1 (Protein Data Bank ID: 3IOL) using the GLP1 R in 5NX2 as the template.
- 5NX2 structure can be found in Jazayeri A, et al. Nature volume 546, pages 254-258 (2017), which is incorporated herein by reference in its entirety.
- Figure 5 shows a synthetic scheme for making GLP1 peptidomimetic payloads of the present disclosure. Solid Phase Peptide Synthesis on resin was established which efficiently generated the payloads of the present disclosure with good yields. Additional GLP1R peptidomimetic payloads were generated via systematic R1/R2/R3-modifications.
- Figures 6A-6D demonstrate that the GLP1R peptidomimetic payloads of the present disclosure showed no activation in related GPCRs bioassays.
- Figures 7A-7B show that shorter linker GLP1 R ATDCs showed greater potency over the control ATDCs.
- Figure 8 shows that the lead linker-payload showed optimal in vitro ADME profile with no in vitro cardiotoxicity and mutagenic potential and its ATDC is highly stable in plasmas.
- Figure 9A shows two methods for conjugating linker-payloads to an antibody of the present disclosure.
- Figure 9B shows a representative hydrophobic interaction chromatography (HIC) graph of anti-GLP1 R ATDC drug loading profile.
- HIC hydrophobic interaction chromatography
- Figure 10 shows CRE-dependent luciferase reporter activity by anti-GLP1 R
- Anti-GLP1 R ATDCs showed better in vitro potency than isotype control ATDCs.
- Unconjugated mAbs did not activate hGLPI R cells (not shown).
- ATDCs did not activate Glucagon- like peptide-2 receptor (GLP2R), glucagon receptor (GCGR), or gastric inhibitory polypeptide receptor (GIPR) (not shown).
- GLP2R Glucagon- like peptide-2 receptor
- GCGR glucagon receptor
- GIPR gastric inhibitory polypeptide receptor
- Figure 11A shows cyclic AMP response element (CRE)-dependent luciferase reporter activity by anti-GLP1 R ATDCs in the presence of unconjugated anti-GLP1 R antibodies. It shows that the unconjugated anti-GLP1 R mAb concentrations ⁇ 10 nM had no impact on anti- GLP1R ATDC activity. 100 nM unconjugated anti-GLP1 R mAb reduced anti-GLP1 R ATDC potency by 3.8-fold. The assay was performed by adding unconjugated anti-GLP1 R mAb first, then immediately adding anti-GLP1 R ATDC, and incubating for 4 hours.
- CRE cyclic AMP response element
- Figure 11B shows the data corresponding to the graphs in Figure 11 A.
- Figure 12 shows a schematic representation of an exemplary GLP1 R Q-tag mAb -
- Figure 13 shows a general synthetic scheme for preparing GLP1 peptidomimetics according to the disclosure.
- Figure 14 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P1 and P8 according to the disclosure.
- Figure 15 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P2 and P9 according to the disclosure.
- Figure 16 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P3, P4, P5, P6, P7, P11 , P13, P14, P15, P16 and P17 according to the disclosure.
- Figures 17A and 17B show a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P10, P12, P18, P19, P25, P26, P27, P28, P29, P30, P31 , P36, P37, and P38 according to the disclosure.
- Figure 18 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P20 and P21 according to the disclosure.
- Figure 19 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P22 and P23 according to the disclosure.
- Figure 20 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payload P24 according to the disclosure.
- Figure 21 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payloads P32, P33, P34 and P35 according to the disclosure.
- Figure 22 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payload P39 according to the disclosure.
- Figure 23 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payload P40 according to the disclosure.
- Figure 24 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payload P41 according to the disclosure.
- Figure 25 shows a sequence for solid-supported synthesis of GLP1 peptidomimetic payload P42 according to the disclosure.
- Figure 26 shows a synthetic route for preparation of Linker-Payloads LP1, LP2, LP3, LP4 and LP5 according to the disclosure.
- Figure 27 shows a synthetic route for preparation of Linker-Payloads LP6 and LP7 according to the disclosure.
- Figure 28 shows a synthetic route for preparation of Linker-Payloads LP8, LP9, LP10 and LP11 according to the disclosure.
- Figure 29 shows a synthetic route for preparation of Linker-Payload LP12 according to the disclosure.
- Figure 30 shows a synthetic route for preparation of Linker-Payloads LP13 and LP14 according to the disclosure.
- Figure 31 shows a synthetic route for preparation of Linker-Payloads LP15 and LP18 according to the disclosure.
- Figure 32 shows a synthetic route for preparation of Linker-Payload LP17 according to the disclosure.
- Figure 33 shows a synthetic route for preparation of Linker-Payloads LP18 and LP20 according to the disclosure.
- Figure 34 shows a synthetic route for preparation of Linker-Payload LP19 according to the disclosure.
- Figure 35 shows a synthetic route for preparation of Linker-Payload LP21 according to the disclosure.
- Figure 36 shows a synthetic route for preparation of Linker-Payload LP22 according to the disclosure.
- Figure 37 shows a synthetic route for preparation of Linker-Payload LP23 according to the disclosure.
- Figure 38 shows a synthetic route for preparation of Linker-Payload LP24 according to the disclosure.
- Figure 39 shows a synthetic route for preparation of Linker-Payload LP25 according to the disclosure.
- Figure 40 shows a synthetic route for preparation of Linker-Payload LP26 according to the disclosure.
- Figure 41 shows a synthetic route for preparation of Linker-Payloads LP27 and LP28 according to the disclosure.
- Figure 42 shows a synthetic route for preparation of Linker-Payload LP29 according to the disclosure.
- Figure 43 shows a synthetic route for preparation of Linker-Payload LP30 according to the disclosure.
- Figure 44 shows a synthetic route for preparation of Linker-Payload LP31 according to the disclosure.
- Figure 45 shows a synthetic route for preparation of Linker-Payload LP32 according to the disclosure.
- Figure 46 shows a synthetic route for preparation of Linker-Payload LP33 according to the disclosure.
- Figure 47 shows a synthetic route for preparation of Linker-Payload LP34 according to the disclosure.
- Figure 48 shows a synthetic route for preparation of Linker-Payload LP35 according to the disclosure.
- Figure 49 shows a synthetic route for preparation of Linker-Payloads LP36, LP37, LP38, LP39, LP40, and LP41 according to the disclosure.
- Figure 50 shows a synthetic route for preparation of Linker-Payload LP42 according to the disclosure.
- Figure 51 shows a synthetic route for preparation of Linker-Payload LP43 according to the disclosure.
- Figure 52 shows a synthetic route for preparation of Linker-Payload LP44 according to the disclosure.
- Figure 53 shows a synthetic route for preparation of Linker-Payload LP45 according to the disclosure.
- Figure 54 shows a schematic of a general two-step conjugation procedure for the preparation of site-specific antibody-drug conjugates.
- Figure 55 shows a schematic of a general one-step conjugation procedure for the preparation of site-specific antibody-drug conjugates.
- Figure 56 shows the commander voltage protocol for electrophysiological study. From a holding potential of -80 mV, the voltage was first stepped to -50 mV for 80 ms for leak subtraction, and then stepped to +20 mV for 4800 ms to open hERG channels. After that, the voltage was stepped back down to -50 mV for 5000 ms, causing a "rebound" or tail current, which was measured and collected for data analysis. Finally, the voltage was stepped back to the holding potential (-80 mV, 1000 ms). Voltage command protocol was repeated every 20 sec and performed continuously during the test (vehicle control and test compound).
- Figure 57 shows in vitro stability of anti-GLP1 R mAB2-LP11 over a 7-day, 37°C incubation in mouse, monkey and human plasma.
- Figure 58 shows the effects of GLP1 R ATDCs on percent body weight changes in obese GLP1 R humanized mice.
- Figure 59 shows the effects of GLP1 R ATDCs on blood glucose levels in obese GLP1R humanized mice.
- Figure 60 is a schematic representation of a GLP1 R ATDC according to an exemplary embodiment of the disclosure. Such ATDCs form part of the present invention, including those wherein the antibody is REGN15869, REGN18121 or REGN18123.
- FIG 61 is a diagram of an anti-GLP1R antibody appended, via the glutamine residues (Q) in Qtags (LLQGSG (SEQ ID NO: 18)) on each LCVR, with a linker payload (LP) which is M3190.
- the bond between the glutamine side chain and the linker is shown; and the bond between the N-terminal LCVR residue and the C-terminal Qtag glycine is shown.
- ] point of attachment of antibody Qtag Gin to linker of M3190.
- Such ATDCs form part of the present invention, including those wherein the antibody is REGN15869, REGN18121 or REGN18123.
- Figure 62 is a comparison between GLP1 (top) and an ATDC comprising an anti- GLP1R antibody, having a LLQGSG (SEQ ID NO: 18) Qtag, conjugated to a linker-payload which is M3190 (bottom).
- E* is (S)-2-amino-3-(2H-tetrazol-5-yl)propanoic acid
- F* is (S)-2-amino-3-(2- fluorophenyl)-2-methylpropanoic acid
- Cap-Aib is 3-((2-(1 H-imidazol-5-yl)ethyl)amino)-2,2- dimethyl-3-oxopropanoic acid
- AA2 is (S)-2-amino-3-(4'-(4-(4-(4-(25-amino-2, 5, 8, 11 ,14,17,20,23- octaoxapentacosyl)-1 H-1 ,2,3-triazol-1-yl)butoxy)-2'-ethyl-[1 ,1'-biphenyl]-4-yl)propanoic acid
- AA1 (S)-2-amino-5-(3,5-d
- Figure 63 shows CryoEM reconstructions and epitope of GLP-
- Figure 64 shows CryoEM reconstructions and epitope of GLP- 1 R/REGN15869/M3190 complexes.
- A shows CryoEM reconstruction of REGN15869- M3190 Fab bound to GLP-1 R/Gs (‘tethered’ complex).
- B shows CryoEM reconstruction of REGN15869 Fab bound to GLP1 R/Gs/M3190 (‘untethered’ complex).
- Locations of GLP-1 R domains and complex components are labeled in (A), (B), and (C),
- (C) shows an Expanded view of REGN15869/GLP-1 R interface. GLP-1 R contact residues (within 4 A of REGN15869) are shown as stick and labeled.
- the present disclosure provides, in some aspects, antibody-drug conjugates that specifically bind the glucagon-like peptide 1 receptor (GLP1 R) protein.
- GLP1 R glucagon-like peptide 1 receptor
- GLP1 R and its ligand GLP1 are highly validated targets for obesity and type 2 diabetes.
- no direct agonist antibodies have been identified for type 2 diabetes treatment.
- Single peptides with agonist activities on GLP1 R are effective therapeutic agents for glucose control and body weight loss, but in-line peptide-antibody fusions are susceptible to proteolysis.
- antibody-drug conjugates were generated that combine an antibody, or antigen-binding fragment thereof, specifically targeting the extracellular domain of GLP1 R, with a GLP1 peptidomimetic functionally activating GLP1 R.
- antibody-drug conjugates of the present disclosure have a longer drug duration with comparable or better weight and glucose reducing efficacy and minimized off-target side effects.
- salts include, but are not limited to, acid derived, base derived, organic, inorganic, amine, and alkali or alkaline earth metal salts, including but not limited to calcium salts, magnesium salts, potassium salts, sodium salts, salts of hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methane sulfonic acid, ethane sulfonic acid, p toluene sulfonic acid, salicylic acid, and the like.
- a payload described herein comprises a tertiary amine, where the nitrogen atom in the tertiary amine is the atom through which the payload is bonded to a linker or a linker-spacer.
- bonding to the tertiary amine of the payload yields a quaternary amine in the linker-payload molecule.
- the positive charge on the quaternary amine can be balanced by a counter ion (e.g., chloro, bromo, iodo, or any other suitably charged moiety such as those described herein).
- Ranges can be expressed herein as from “about” or “approximately” one particular value and/or to “about” or “approximately” another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value.
- alkyl is given its ordinary meaning in the art and may include saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl substituted cycloalkyl groups, and cycloalkyl substituted alkyl groups.
- a straight chain or branched chain alkyl has about 1-20 carbon atoms in its backbone (e.g., C1-C20 for straight chain, C2-C20 for branched chain), and alternatively, about 1-10 carbon atoms, or about 1 to 6 carbon atoms.
- a cycloalkyl ring has from about 3-10 carbon atoms in their ring structure where such rings are monocyclic or bicyclic, and alternatively about 5, 6 or 7 carbons in the ring structure.
- an alkyl group may be a lower alkyl group, wherein a lower alkyl group comprises 1-4 carbon atoms (e.g., C1-C4 for straight chain lower alkyls).
- alkenyl refers to an alkyl group, as defined herein, having one or more double bonds.
- alkynyl refers to an alkyl group, as defined herein, having one or more triple bonds.
- heteroatom means one or more of oxygen, sulfur, nitrogen, phosphorus, or silicon (including, any oxidized form of nitrogen, sulfur, phosphorus, or silicon; the quaternized form of any basic nitrogen or; a substitutable nitrogen of a heterocyclic ring.
- halogen means F, Cl, Br, or I;
- halide refers to a halogen radical or substituent, namely -F, -Cl, -Br, or -I.
- adduct e.g., “a Diels-Alder adduct” of the present disclosure encompasses any moiety comprising the product of an addition reaction, e.g., a Diels-Alder reaction, independent of the synthetic steps taken to produce the moiety.
- covalent attachment means formation of a covalent bond, i.e., a chemical bond that involves sharing of one or more electron pairs between two atoms. Covalent bonding may include different interactions, including but not limited to o-bonding, ir-bonding, metal-to-metal bonding, agostic interactions, bent bonds, and three-center two-electron bonds.
- first group is said to be “capable of covalently attaching” to a second group, this means that the first group is capable of forming a covalent bond with the second group, directly or indirectly, e.g., through the use of a catalyst or under specific reaction conditions.
- Non-limiting examples of groups capable of covalently attaching to each other may include, e.g., an amine and a carboxylic acid (forming an amide bond), a diene and a dienophile (via a Diels-Alder reaction), a maleimide and a thiol (forming a thio-maleimide), and an azide and an alkyne (forming a triazole via a 1 ,3-cycloaddition reaction).
- compounds of the disclosure may contain “optionally substituted” moieties.
- substituted whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
- an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
- Combinations of substituents envisioned by this disclosure are preferably those that result in the formation of stable or chemically feasible compounds.
- stable refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.
- structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, (Z) and (E) double bond isomers, and (Z) and (E) conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the disclosure.
- cyclic adducts e.g., products of a cycloaddition reaction, e.g., an azide-acetylene cycloaddition reaction or a Diels-Alder reaction
- regioisomers i.e., structural isomers that differ only in the position of a functional group or a substituent.
- the following structures represent triazole regioisomers, which differ only in the position of the substituent on the triazole ring:
- structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms.
- compounds having the present structures except for the replacement of hydrogen by deuterium or tritium, or the replacement of a carbon by a 11 C- or 13 C- or 14 C -enriched carbon are within the scope of this disclosure.
- crystalline forms of the compounds of the disclosure and salts thereof are also within the scope of the disclosure.
- the compounds of the disclosure may be isolated in various amorphous and crystalline forms, including without limitation forms which are anhydrous, hydrated, non-solvated, or solvated.
- Example hydrates include hemihydrates, monohydrates, dihydrates, and the like.
- the compounds of the disclosure are anhydrous and non-solvated.
- anhydrous is meant that the crystalline form of the compound contains essentially no bound water in the crystal lattice structure, i.e., the compound does not form a crystalline hydrate.
- crystalline form is meant to refer to a certain lattice configuration of a crystalline substance. Different crystalline forms of the same substance typically have different crystalline lattices (e.g., unit cells) which are attributed to different physical properties that are characteristic of each of the crystalline forms. In some instances, different lattice configurations have different water or solvent content.
- the different crystalline lattices can be identified by solid state characterization methods such as by X-ray powder diffraction (PXRD). Other characterization methods such as differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), dynamic vapor sorption (DVS), solid state NMR, and the like further help identify the crystalline form as well as help determine stability and solvent/water content.
- Crystalline forms of a substance include both solvated (e.g., hydrated) and nonsolvated (e.g., anhydrous) forms.
- a hydrated form is a crystalline form that includes water in the crystalline lattice.
- Hydrated forms can be stoichiometric hydrates, where the water is present in the lattice in a certain water/molecule ratio such as for hemihydrates, monohydrates, dihydrates, etc. Hydrated forms can also be non-stoichiometric, where the water content is variable and dependent on external conditions such as humidity.
- the compounds of the disclosure are substantially isolated.
- substantially isolated is meant that a particular compound is at least partially isolated from impurities.
- a compound of the disclosure comprises less than about 50%, less than about 40%, less than about 30%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 2.5%, less than about 1 %, or less than about 0.5% of impurities.
- Impurities generally include anything that is not the substantially isolated compound including, for example, other crystalline forms and other substances.
- GLP1 R refers to the glucagon-like peptide 1 receptor and includes recombinant GLP1 R protein or a fragment thereof. GLP1 R has a sequence of 463 residues. Donnelly, Br J Pharmacol, 166(1):27-41 (2011). Glucagon-like peptide 1 (GLP1) is a 31-amino acid peptide hormone released from intestinal L cells following nutrient consumption.
- GLP1 The binding of GLP1 to GLP1 R potentiates glucose-induced secretion of insulin from pancreatic beta cells, increases insulin expression, inhibits beta-cell apoptosis, promotes beta-cell neogenesis, reduces glucagon secretion, delays gastric emptying, promotes satiety and increases peripheral glucose disposal.
- An antibody-tethered drug conjugate (ATDC) or antibody-drug conjugate (ADC) refers to an antibody or antigen-binding fragments thereof tethered, by a linker or without a linker, to a payload (e.g., a GLP1 peptidimimetic).
- An antibody-payload conjugate refers to such an antibody or fragment linked to a payload whereas an antibody-linker-payload conjugate refers to an antibody or fragment conjugated to a payload via a linker.
- An antibody or antigen-binding fragment referred to herein includes embodiments wherein said antibody or fragment is be conjugated to a payload or linker-payload.
- the present invention provides antigen-binding proteins, such as antibodies and antigenbinding fragments thereof, that bind specifically to GLP1 R which may be conjugated to a payload, e.g., by a linker (a linker-payload) (e.g., REGN7990; REGN9268; REGN15869; REGN18121; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426; REGN5203; REGN5204; REGN5617; REGN5619; REGN7987; REGN9270; REGN9278; REGN9279; or REGN9280, e.g., wherein the linker-payload is LP11 , LP30 or LP32).
- the anti-GLP1 R antibody or antigenbinding fragment tethered to a payload has the following structure:
- BA is the anti-GLP1 R antibody or antigen-binding fragment thereof:
- (i) comprises a heavy chain immunoglobulin or variable region thereof that comprises CDR-H1, CDR-H2 and CDR-H3 of a heavy chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in SEQ ID NO: 26; 46; 66; 86; 106; 126; 146; 166; 187; 207; 227; 247; 275; 295; 315; 335; 355; 375; 395; 42; 62; 82; 414; 416; 102; 122; 142; 162; 182; 203; 223; 243; 263; 267; 271; 291 ; 311 ; 331 ; 351 ; 371; 391 ; or 411; or a variant thereof; and/or a light chain immunoglobulin or variable region thereof that comprises CDR-L1 , CDR-L2 and CDR- L3 of a light chain immunoglobulin or variable region thereof that comprises the amino acid sequence set forth in S
- L is a non-cleavable linker
- P is the payload (e.g., a drug payload such as a GLP1 peptidomimetic); and m is 1, 2, 3 or 4.
- Anti-GLP1 R antibodies and antigen-binding fragments thereof refer to antibodies and fragments that bind to GLP1 R with a KD of about 1-2 nM or a greater affinity.
- an "agonist” antibody or antigen-binding fragment thereof as used herein is an antibody or fragment that increases or enhances at least one biological activity of GLP1R. Such increase or enhancement may be mediated by the antibody itself or by the payload or linker-payload of an ATDC.
- the agonist antibody or fragment may elicit stimulation of the adenylate cyclase pathway resulting in increased synthesis of cyclic AMP and release of insulin if the cell is a mammalian pancreatic beta cell.
- GLP1 R may be cAMP-dependent activation of protein kinase A (PKA) and/or cAMP-regulated guanine nucleotide exchange factor 2 (Epac2).
- PKA protein kinase A
- Epac2 cAMP-regulated guanine nucleotide exchange factor 2
- An agonist antibody or fragment may also reduce glucose levels or reduce body weight upon administration to a subject in need thereof.
- a “neutral” antibody or a “neutral” binder with respect to an anti-GLP1 R antibody or antigen-binding fragment thereof refers to an antibody or fragment that binds to GLP1 R but does not significantly activate biological activity of GLP1 R (e.g., stimulation of adenylate cyclase pathway).
- protein or “polypeptide” means any amino acid polymer having amino acids covalently linked via peptide bonds.
- Protein includes biotherapeutic proteins, recombinant proteins used in research or therapy, trap proteins and other Fc-fusion proteins, chimeric proteins, antibodies, monoclonal antibodies, human antibodies, bispecific antibodies, antibody fragments, nanobodies, recombinant antibody chimeras, scFv fusion proteins, cytokines, chemokines, peptide hormones, and the like.
- Proteins can be produced using recombinant cell-based production systems, such as the insect bacculovirus system, yeast systems (e.g., Pichia sp, such as Pichia pastoris), mammalian systems (e.g., CHO cells and CHO derivatives like CHO-K1 cells).
- yeast systems e.g., Pichia sp, such as Pichia pastoris
- mammalian systems e.g., CHO cells and CHO derivatives like CHO-K1 cells.
- a polynucleotide includes DNA and RNA.
- GLP1 R means human GLP1 R unless specified as being from a non-human species, e.g., “mouse GLP1 R,” “monkey GLP1 R,” etc.
- amino acid sequence of an antibody or antigen-binding fragment thereof can be numbered using any known numbering schemes, including those described by Kabat et al., ("Kabat” numbering scheme); Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948 ("Chothia” numbering scheme); MacCallum et al., 1996, J. Mol. Biol. 262:732-745 ("Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Pluckthun, J. Mol. Biol., 2001 , 309:657-70 (“AHo” numbering scheme).
- the CDRs of an anti-GLP1 R antibody or antigen-binding fragment e.g., REGN7990; REGN9268; REGN15869; REGN18121; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426;
- REGN9279 or REGN9280, e.g., wherein the linker-payload is LP11 , LP30 or LP32) heavy or light chain immunoglobulin are as defined by Kabat, Chohia, Contact, IMGT or AHo.
- the anti-GLP1R antibodies and antigen-binding fragments of the present invention may be glutaminyl-modified.
- glutaminyl-modified antibody refers to an antibody (e.g., REGN7990; REGN9268; REGN15869; REGN18121 ; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071;
- the linker-payload is LP11 , LP30 or LP32) with at least one covalent linkage from a glutamine side chain (from the glutamine (Q) residue in LLQGSG (SEQ ID NO: 18)) to a primary amine compound (e.g., a Payload or Linker-Payload) of the present disclosure.
- the primary amine compound is linked through an amide linkage on the glutamine side chain.
- the glutamine is an endogenous glutamine.
- the glutamine is an endogenous glutamine made reactive by polypeptide engineering (e.g., via amino acid deletion, insertion, substitution, or mutation on the polypeptide).
- the glutamine is polypeptide engineered with an acyl donor glutamine-containing tag (e.g., glutamine-containing peptide tags, Q-tags or TGase recognition tag).
- Transglutaminase is an enzyme that catalyzes transamidation reactions of glutamine (Q) residues in a recognition sequence (the ‘Q-tag’ or “Qtag” or “TGase recognition tag”) over other glutamines, e.g., in heavy chains of IgGs, thus facilitating site-specific modification.
- the antibody or antigen-binding fragment thereof has been modified to comprise a TGase recognition tag.
- Suitable TGase recognition tags include those described herein.
- the TGase is microbial transglutaminase, e.g., Streptomyces transglutaminase.
- TGase recognition tag refers to a sequence of amino acids comprising an acceptor glutamine residue and that when incorporated into (e.g. appended to) a polypeptide sequence, under suitable conditions, is recognized by a TGase (transglutaminase) and leads to cross-linking by the TGase through a reaction between an amino acid side chain within the sequence of amino acids and a reaction partner.
- the recognition tag may be a peptide sequence that is not naturally present in the polypeptide comprising the TGase recognition tag.
- the TGase recognition tag comprises at least one Gin.
- the TGase recognition tag comprises an amino acid sequence XXQX, wherein X is any amino acid (e.g., conventional amino acid Leu, Ala, Gly, Ser, Vai, Phe, Tyr, His, Arg, Asn, Glu, Asp, Cys, Met, Pro, Thr, Lys, or Trp or nonconventional amino acid).
- X is any amino acid (e.g., conventional amino acid Leu, Ala, Gly, Ser, Vai, Phe, Tyr, His, Arg, Asn, Glu, Asp, Cys, Met, Pro, Thr, Lys, or Trp or nonconventional amino acid).
- the acyl donor glutamine-containing tag comprises an amino acid sequence selected from the group consisting of LLQGG (SEQ ID NO: 6), LLQG (SEQ ID NO: 7), LSLSQG (SEQ ID NO: 8), GGGLLQGG (SEQ ID NO: 9), GLLQG (SEQ ID NO: 10), LLQ, GSPLAQSHGG (SEQ ID NO: 11), GLLQGGG (SEQ ID NO: 12), GLLQGG (SEQ ID NO: 13), GLLQ (SEQ ID NO: 14), LLQLLQGA (SEQ ID NO: 15), LLQGA (SEQ ID NO: 16), LLQYQGA (SEQ ID NO: 17), LLQGSG (SEQ ID NO: 18), LLQYQG (SEQ ID NO: 19), LLQLLQG (SEQ ID NO: 20), SLLQG (SEQ ID NO: 21), LLQLQ (SEQ ID NO: 22), LLQ
- the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the N-terminus of one or both of the antibody or fragment light chains. In certain embodiments, the antibody or fragment thereof has been modified to comprise a Q-tag at the N-terminus of both antibody light chains.
- the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the N-terminus of one or both antibody or antigen-binding fragment heavy chains. In certain embodiments, the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the N-terminus of both antibody heavy chains.
- the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the C-terminus of one or both antibody or antigen-binding fragment light chains. In certain embodiments, the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the C-terminus of both antibody light chains.
- the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the C-terminus of one or both antibody or antigen-binding fragment heavy chains. In certain embodiments, the antibody or antigen-binding fragment thereof has been modified to comprise a Q-tag at the C-terminus of both antibody heavy chains.
- antibody refers to immunoglobulin molecules comprising four polypeptide chains, two heavy chains (HC) and two light chains (LC) inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM).
- the antibody is an IgG format (e.g., lgG1 , lgG2, lgG3 or lgG4 or a variant thereof, for example, lgG4 having an S228P mutation) having the 2 heavy chains and 2 light chains interconnected by disulfide bonds to form a tetramer with a Y-like shape.
- the antibody or antigen-binding fragment is an IgA, IgD, IgE, IgM, lgA1 or lgA2 (or a variant thereof).
- An antibody may be conjugated to a payload, e.g., by a linker.
- the antibody or antigen-binding fragment can be in any form known to those of skill in the art.
- the antibody or fragment comprises a light chain.
- the light chain is a kappa light chain.
- the light chain is a lambda light chain.
- Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region (e.g., a human heavy chain constant region).
- Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region (e.g., a human light chain constant region).
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
- CDRs complementarity determining regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyterminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
- the FRs of the antibody can be identical to the human germline sequences, or can be naturally or artificially modified.
- An amino acid consensus sequence can be defined based on a side-by-side analysis of two or more CDRs.
- Antigen-binding fragments of antibodies that bind specifically to GLP1 R are also part of the present invention.
- the terms “antigen-binding portion” of an antibody, “antigen-binding fragment” of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex.
- Antigen-binding fragments of an antibody can be derived, e.g., from antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains.
- DNA is known and/or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized.
- the DNA can be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
- An antigen-binding fragment may be conjugated to a payload, e.g., by a linker.
- Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab') 2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) or scFv-Fc molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide.
- CDR complementarity determining region
- the antibody fragment is an In some aspects, the antibody fragment is a Fab' fragment.
- Other engineered molecules such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g., monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression “antigen-binding fragment,” as used herein.
- An antigen-binding fragment of an antibody may include at least one variable domain.
- variable domain can be of any size or amino acid composition and will generally comprise at least one CDR which is adjacent to or in frame with one or more framework sequences.
- V H and V domains can be situated relative to one another in any suitable arrangement.
- the variable region can be dimeric and contain VH-VH, VH-VL or VL-VL dimers.
- the antigen-binding fragment of an antibody can contain a monomeric V H or V L domain.
- An antigen-binding fragment of an antibody can contain at least one variable domain covalently linked to at least one constant domain.
- Non-limiting, exemplary configurations of variable and constant domains that can be found within an antigen-binding fragment of an antibody of the present description include: (i) V H -CH1 ; (ii) V H -CH2; (iii) V H -CH3; (iv) V H -CH1 -CH2; (V) V H -CH1 -CH2-CH3; (vi) V H -CH2-C H 3; (vii) V H -C L ; (viii) V L -C H 1; (ix) V L -C H 2; (x) V L -C H 3; (xi) V L -CH1-C H 2; (xii) V L -CH1-CH2-CH3; (xiii) V -CH2-CH3; and (xiv) V L -CL.
- variable and constant domains can be either directly linked to one another or can be linked by a full or partial hinge or linker region.
- a hinge region can consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60, or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule.
- an antigen-binding fragment of an antibody of the present description can comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed herein in non-covalent association with one another and/or with one or more monomeric VH or VL domain (e.g., by disulfide bond(s)).
- antigen-binding fragments can be monospecific or multispecific (e.g., bispecific).
- a multispecific antigen-binding fragment of an antibody may comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen.
- Any multispecific antibody format, including the exemplary bispecific antibody formats disclosed herein, can be adapted for use in the context of an antigen-binding fragment of an antibody of the present description using routine techniques available in the art.
- the antibodies of the description are human antibodies.
- the term “human antibody,” as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- the human antibodies of the description can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- the term “human antibody,” as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, that have been grafted onto human framework sequences.
- the antibody is a monoclonal antibody.
- the antibody is a polyclonal antibody.
- the antibody is a chimeric antibody.
- the antibody is a humanized antibody.
- the antibodies and antigen-binding fragments can, in some embodiments, be recombinant antibodies and antigen-binding fragments.
- the term “recombinant” antibody as used herein is intended to include antibodies that are prepared, expressed, created or isolated by recombinant means.
- recombinant antibodies include those expressed using a recombinant expression vector transfected into a host cell (e.g., a Chinese hamster ovary cell) which is optionally isolated from the host cell and/or culture media in which the host cell is grown.
- Recombinant antibodies include those isolated from a recombinant, combinatorial human antibody library, antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (See, e.g., Taylor et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences.
- Such human antibodies have variable and constant regions derived from human germline immunoglobulin sequences.
- such human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V H and V regions of the antibodies are sequences that, while derived from and related to human germline V H and V sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- the antibodies and antigen-binding fragments of the description can be isolated or purified antibodies.
- An “isolated” or “purified” antibody as used herein, means an antibody that has been identified and separated and/or recovered from at least one component of its natural environment. For example, an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced, is an “isolated antibody” for purposes of the present description. Moreover, an antibody that is removed partially or fully from a recombinant host cell in which is it produced is “isolated”. For example, an antibody that has been purified from at least one component of a reaction or reaction sequence, is an “isolated” or “purified” antibody.
- An isolated antibody also includes an antibody in situ within a recombinant cell. Isolated antibodies include those that have been subjected to at least one purification or isolation step. According to certain embodiments, an isolated antibody can be substantially free of other cellular material and/or chemicals.
- the antibodies and antigen-binding fragments disclosed herein can comprise one or more amino acid substitutions, insertions and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antibodies were derived. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases.
- the present description includes antibodies, and antigenbinding fragments thereof, which are derived from any of the amino acid sequences disclosed herein, wherein one or more amino acids within one or more framework and/or CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as “germline mutations”).
- germline mutations such sequence changes are referred to herein collectively as “germline mutations”.
- all of the framework and/or CDR residues within the VH and/or VL domains are mutated back to the residues found in the original germline sequence from which the antibody was derived.
- only certain residues are mutated back to the original germline sequence, e.g., only the mutated residues found within the first 8 amino acids of FR1 or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1 , CDR2 or CDR3.
- one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (/.e., a germline sequence that is different from the germline sequence from which the antibody was originally derived).
- the antibodies and antigen-binding fragments of the present description can contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g., wherein certain individual residues are mutated to the corresponding residue of a particular germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence.
- antibodies and antigen-binding fragments that contain one or more germline mutations can be tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, improved drug-to-antibody ratio (DAR) for antibody-drug conjugates, etc.
- the present invention includes anti-GLP1 R antibodies and antigen-binding fragments thereof (e.g., which are conjugated to a payload, e.g., by a linker) that are aglycosylated.
- the term “aglycosylated” antibody or antigen-binding fragment includes an antibody or fragment that does not comprise a glycosylation sequence that might interfere with a transglutamination reaction, for example, an antibody that does not have saccharide group at N297 on one or more heavy chains.
- an antibody heavy chain has an N297 mutation.
- an antibody heavy chain has an N297Q or an N297D mutation.
- Such an antibody can be prepared by site-directed mutagenesis to remove or disable a glycosylation sequence or by site-directed mutagenesis to insert a glutamine residue at site apart from any interfering glycosylation site or any other interfering structure.
- Such an antibody also can be isolated from natural or artificial sources.
- Aglycosylated antibodies and fragments also include antibodies and fragments comprising a T299 or S298P or other mutations, or combinations of mutations that result in a lack of glycosylation.
- An aglycosylated antibody or antigen-binding fragment may be completely lacking glycosylation, e.g., following expression in a bacterial host cell.
- the present invention includes anti-GLP1 R antibodies and antigen-binding fragments thereof (e.g., which are conjugated to a payload, e.g., by a linker) that are deglycosylated.
- deglycosylated antibody or antigen-binding fragment refers to an antibody or fragment in which a saccharide group at is removed to facilitate transglutaminase- mediated conjugation. Saccharides include, but are not limited to, N-linked oligosaccharides. In some embodiments, deglycosylation is performed at residue N297. In some embodiments, removal of saccharide groups is accomplished enzymatically, included but not limited to via PNGase.
- epitope refers to an antigenic determinant (e.g., of GLP1 R) that interacts with a specific antigen binding site in the variable region of an antibody or antigen-binding fragment known as a paratope.
- a single antigen can have more than one epitope.
- different antibodies can bind to different areas on an antigen and can have different biological effects.
- Epitopes can be either conformational or linear.
- a conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain.
- a linear epitope is one produced by adjacent amino acid residues in a polypeptide chain.
- an epitope can include moieties of saccharides, phosphoryl groups, or sulfonyl groups on the antigen.
- conjugated protein, antibody or antigen-binding fragment refers to a protein, antibody or fragment covalently linked to one or more chemical moieties.
- the chemical moiety can include an amine compound of the present disclosure.
- Linkers (L) and payloads (P) suitable for use with the present disclosure are described in detail herein.
- DAR Drug-to-Antibody Ratio
- a binding agent e.g., an antibody or antigen-binding fragment
- Linker Antibody Ratio also denoted as the lower case, in some embodiments, is the average number of reactive primary amine compounds conjugated to a binding agent of the present disclosure.
- binding agents e.g., antibodies or antigen-binding fragments
- primary amine compounds comprising, e.g., a suitable azide or alkyne.
- the resulting binding agent which is functionalized with an azide or an alkyne can subsequently react with a therapeutic moiety comprising the corresponding azide or alkyne via the 1 ,3-cycloaddition reaction.
- reaction pH refers to the pH of a reaction after all reaction components or reactants have been added.
- a "variant" of a polypeptide such as an immunoglobulin chain (e.g., REGN7990; REGN9268; REGN15869; REGN18121; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426; REGN5203;
- an immunoglobulin chain e.g., REGN7990; REGN9268; REGN15869; REGN18121; REGN18123; REGN8070; REGN8072; REGN9267; REGN7988; REGN5619; REGN7989; REGN8069; REGN8071 ; REGN9426; REGN5203;
- REGN5204; REGN5617; REGN5619; REGN7987; REGN9270; REGN9278; REGN9279; or REGN9280 V , V , HC or LC; or CDR thereof as set forth herein refers to a polypeptide comprising an amino acid sequence that is at least about 70-99.9% (e.g., 70, 72, 74, 75, 76, 79, 80, 81 , 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical or similar to a referenced amino acid sequence that is set forth herein (e.g., any of SEQ ID NOs: 26; 28; 30; 32; 34; 36; 38; 40; 42; 44; 46; 48; 50; 52; 54; 56; 58; 60; 62; 64; 66; 68; 70; 72;
- a "variant" of a polynucleotide refers to a polynucleotide comprising a nucleotide sequence that is at least about 70-99.9% (e.g., 70, 72, 74, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 , 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical to a referenced nucleotide sequence that is set forth herein (e.g., any of SEQ ID NOs: 25; 27; 29; 31 ; 33; 35; 37; 39; 41; 43; 45; 47; 49; 51 ; 53; 55; 57; 59; 61; 63; 65; 67; 69; 71 ; 73; 75; 77; 79; 81 ; 415; 417; 83; 85; 87;
- BLAST ALGORITHMS Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272;
- Anti-GLP1 R antigen-binding proteins include a heavy chain immunoglobulin or variable region thereof having at least 70% (e.g., 80%, 85%, 90%, 95%, 99%) amino acid sequence identity to the amino acids set forth in SEQ ID NO: 26, 46, 66, 86, 106, 126, 146, 166, 42, 62, 82, 414; 416; 102, 122, 142, 162 or 182; and/or a light chain immunoglobulin or variable region thereof having at least 70% (e.g., 80%, 85%, 90%, 95%, 99%) amino acid sequence identity to the amino acids set forth in SEQ ID NO: 34, 54, 74, 94, 114, 134, 154, 174, 44, 64, 84, 104, 124, 144, 164 or 184.
- 70% e.g., 80%, 85%, 90%, 95%, 99%
- a variant of a polypeptide may include an amino acid sequence that is set forth herein (e.g., SEQ ID NO: 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58,
- mutations such as, for example, missense mutations (e.g., conservative substitutions), non-sense mutations, deletions, or insertions.
- the present invention includes anti-GLP1 R antibodies and antigenbinding fragments thereof which include an immunoglobulin light chain (or VL) variant comprising the amino acid sequence set forth in SEQ ID NO: 34, 54, 74, 94, 114, 134, 154, 174, 44, 64, 84, 104, 124, 144, 164 or 184 but having one or more of such mutations and/or an immunoglobulin heavy chain (or V H ) variant comprising the amino acid sequence set forth in SEQ ID NO: 26, 46, 66, 86, 106, 126, 146, 166, 42, 62, 82, 414; 416; 102, 122, 142, 162 or 182 but having one or more of such mutations.
- VL immunoglobulin light chain
- V H immunoglobulin heavy chain
- an anti-GLP1 R antibody or antigen-binding fragment thereof includes an immunoglobulin light chain variant comprising CDR-L1 , CDR-L2 and CDR-L3 wherein one or more (e.g., 1 or 2 or 3) of such CDRs has one or more of such mutations (e.g., conservative substitutions) and/or an immunoglobulin heavy chain variant comprising CDR- H1 , CDR-H2 and CDR-H3 wherein one or more (e.g., 1 or 2 or 3) of such CDRs has one or more of such mutations (e.g., conservative substitutions).
- an immunoglobulin light chain variant comprising CDR-L1 , CDR-L2 and CDR-L3 wherein one or more (e.g., 1 or 2 or 3) of such CDRs has one or more of such mutations (e.g., conservative substitutions).
- Embodiments of the present invention also include antigen-binding proteins, e.g., anti-GLP1 R antibodies and antigen-binding fragments thereof, that comprise immunoglobulin VHs and VLs; or HCs and LCs, which comprise a variant amino acid sequence having 70% or more (e.g., 80%, 85%, 90%, 95%, 97% or 99%) overall amino acid sequence identity or similarity to the amino acid sequences of the corresponding VHs, VLs, HCs or LCs specifically set forth herein, but wherein the CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3 of such immunoglobulins are not variants and comprise the amino acid sequences specifically set forth herein.
- antigen-binding proteins e.g., anti-GLP1 R antibodies and antigen-binding fragments thereof, that comprise immunoglobulin VHs and VLs; or HCs and LCs, which comprise a
- variant antigen-binding proteins are not, themselves, variants.
- Examples of groups of amino acids that have side chains with similar chemical properties include 1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartate and glutamate, and 7) sulfur- containing side chains: cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine.
- a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443 45.
- Immunoglobulin chains of the anti-GLP1 R antibodies and antigen-binding fragments of the present invention are summarized below in Tables A and B.
- any HCVR and/or LCVR set forth herein includes an N-terminal Qtag such as LLQGSG (SEQ ID NO: 18).
- any light chain and/or heavy chain set forth herein does not include an N-terminal Qtag such as LLQGSG (SEQ ID NO: 18).
- HC lmmunoglobulin heavy chain
- LC Immunoglobulin light chain
- HCVR Heavy chain variable region
- LCVR Light chain variable region
- GCG AAA GGC CTT ATA GCA CCT CGT CCG ATG GGC TTT GAC TAC (SEQ ID NO: 51)
- LCVR Light chain variable region
- a A s (SEQ ID NO: 58)
- CAC CAG GCT GAC AGT TTC CCG TAC ACT (SEQ ID NO: 59)
- GCG AAA GGC CTT ATA GCA CCT CGT CCG ATG GGC TTT GAC TAC (SEQ ID NO: 71)
- LCVR Light chain variable region
- a A s (SEQ ID NO: 78)
- CAC CAG GCT GAC AGT TTC CCG TAG ACT (SEQ ID NO: 79)
- GCG AAA GGC CTT ATA GCA CCT CGT CCG ATG GGC TTT GAC TAC (SEQ ID NO: 71)
- LCVR Light chain variable region
- a A s (SEQ ID NO: 78)
- CAC CAG GCT GAC AGT TTC CCG TAC ACT (SEQ ID NO: 79)
- Heavy chain variable region (HCVR; VH)-nucleotide sequence
- GCG AAA GGC CTT ATA GCA CCT CGT CCG ATG GGC TTT GAC TAC (SEQ ID NO: 71)
- LCVR Light chain variable region
- a A s (SEQ ID NO: 78)
- CAAGCTGGAGATCAAA (SEQ ID NO: 93)
- AAG ATT TCT (SEQ ID NO: 97)
- VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO:
- GCT GCA TCC (SEQ ID NO: 117) CDR-L2-amino acid sequence A A s (SEQ ID NO: 118) CDR-L3-nucleotide sequence
- Heavy chain variable region (HCVR, VH)-nucleotide sequence
- GGT GCA TCC (SEQ ID NO: 137)
- PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SEQ ID NO: 142
- Heavy chain variable region (HCVR, Vn)-nucleotide sequence HCVR, Vn-nucleotide sequence
- PVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SEQ ID NO: 162
Landscapes
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Diabetes (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Emergency Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Obesity (AREA)
- General Chemical & Material Sciences (AREA)
- Cell Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Neurology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2023231305A AU2023231305A1 (en) | 2022-03-11 | 2023-03-11 | Anti-GLP1r antibody-tethered drug conjugates comprising GLP1 peptidomimetics and uses thereof |
| EP23714050.4A EP4489855A1 (en) | 2022-03-11 | 2023-03-11 | Anti-glp1r antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof |
| CN202380027101.5A CN119072335A (zh) | 2022-03-11 | 2023-03-11 | 包含glp1肽模拟物的抗glp1r抗体-药物缀合物及其用途 |
| JP2024554120A JP2025512735A (ja) | 2022-03-11 | 2023-03-11 | Glp1ペプチド模倣体を含む抗glp1r抗体係留型薬物コンジュゲートおよびその使用 |
| MX2024011099A MX2024011099A (es) | 2022-03-11 | 2023-03-11 | Conjugados de farmaco unido a anticuerpo anti-glp1r que comprenden peptidomimeticos de glp1 y usos de los mismos. |
| KR1020247033773A KR20240159847A (ko) | 2022-03-11 | 2023-03-11 | Glp1 펩티드 모방체를 포함하는 항-glp1r 항체-연결된 약물 접합체 및 이의 용도 |
| CA3243669A CA3243669A1 (en) | 2022-03-11 | 2023-03-11 | ANTI-GLP1R ANTIBODY-DRUG CONJUGATES INCLUDING GLP1 PEPTIDOMIMETS AND THEIR USES |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263319175P | 2022-03-11 | 2022-03-11 | |
| US63/319,175 | 2022-03-11 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023173132A1 true WO2023173132A1 (en) | 2023-09-14 |
Family
ID=85779020
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/064203 Ceased WO2023173132A1 (en) | 2022-03-11 | 2023-03-11 | Anti-glp1r antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20230330254A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4489855A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2025512735A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240159847A (cg-RX-API-DMAC7.html) |
| CN (1) | CN119072335A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2023231305A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3243669A1 (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024011099A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023173132A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024182268A1 (en) * | 2023-02-27 | 2024-09-06 | Regeneron Pharmaceuticals, Inc. | Liquid phase peptide support synthesis of peptides and peptidomimetics |
| WO2024211135A3 (en) * | 2023-04-07 | 2024-10-31 | Regeneron Pharmaceuticals, Inc. | Characterization of crosslinking sites in antibody-drug conjugates |
| WO2025096921A1 (en) * | 2023-11-03 | 2025-05-08 | Regeneron Pharmaceuticals, Inc. | Peptide acids as a glp1r agonist and antibody-drug conjugates thereof |
Citations (41)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| WO2005089808A2 (en) | 2004-03-15 | 2005-09-29 | Wyeth | Antibody calicheamicin conjugates |
| US20060275288A1 (en) | 2005-01-20 | 2006-12-07 | Grihalde Nelson D | GLP-1 receptor agonist and allosteric modulator monoclonal antibodies and uses thereof |
| US20070258987A1 (en) | 2000-11-28 | 2007-11-08 | Seattle Genetics, Inc. | Recombinant Anti-Cd30 Antibodies and Uses Thereof |
| WO2008122039A2 (en) | 2007-04-02 | 2008-10-09 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Selenocysteine mediated hybrid antibody molecules |
| US20080305497A1 (en) | 2007-05-23 | 2008-12-11 | Ventana Medical Systems, Inc. | Polymeric carriers for immunohistochemistry and in situ hybridization |
| WO2010010324A1 (en) | 2008-07-21 | 2010-01-28 | Polytherics Limited | Novel reagents and method for conjugating biological molecules |
| WO2010052253A1 (en) | 2008-11-04 | 2010-05-14 | Galderma Research & Development | Oxoazetidine derivatives, process for the preparation thereof and use thereof in human medicine and in cosmetics |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| US7750116B1 (en) | 2006-02-18 | 2010-07-06 | Seattle Genetics, Inc. | Antibody drug conjugate metabolites |
| WO2011018611A1 (en) | 2009-08-10 | 2011-02-17 | Ucl Business Plc | Reversible covalent linkage of functional molecules |
| WO2011130598A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2012005982A2 (en) | 2010-07-06 | 2012-01-12 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Reporter for rna polymerase ii termination |
| US20120058592A1 (en) | 2008-12-30 | 2012-03-08 | Jong Hwan Kim | Laser firing apparatus for high efficiency solar cell and fabrication method thereof |
| WO2012059882A2 (en) | 2010-11-05 | 2012-05-10 | Rinat Neuroscience Corporation | Engineered polypeptide conjugates and methods for making thereof using transglutaminase |
| US20120148586A1 (en) * | 2009-08-27 | 2012-06-14 | Joyce Ching Tsu Chou | Glucagon-like protein-1 receptor (glp-1r) agonists for treating autoimmune disorders |
| WO2012166559A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
| WO2013055990A1 (en) | 2011-10-14 | 2013-04-18 | Seattle Genetics, Inc. | Pyrrolobenzodiazepines and targeted conjugates |
| WO2013053872A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Synthesis method and intermediates useful in the preparation of pyrrolobenzodiazepines |
| WO2013055993A1 (en) | 2011-10-14 | 2013-04-18 | Seattle Genetics, Inc. | Pyrrolobenzodiazepines and targeted conjugates |
| WO2013053873A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Pyrrolobenzodiazepines |
| US20130101546A1 (en) | 2011-06-10 | 2013-04-25 | Mersana Therapeutics, Inc. | Protein-Polymer-Drug Conjugates |
| WO2013068874A1 (en) | 2011-11-11 | 2013-05-16 | Pfizer Inc. | Antibody-drug conjugates |
| WO2013085925A1 (en) | 2011-12-05 | 2013-06-13 | Igenica, Inc. | Antibody-drug conjugates and related compounds, compositions, and methods |
| WO2014065661A1 (en) | 2012-10-23 | 2014-05-01 | Synaffix B.V. | Modified antibody, antibody-conjugate and process for the preparation thereof |
| US20150380666A1 (en) | 2014-06-26 | 2015-12-31 | Universal Display Corporation | Organic electroluminescent materials and devices |
| EP3034514A1 (en) * | 2013-08-13 | 2016-06-22 | Gmax Biopharm LLC | Antibody specifically binding to glp-1r and fusion protein thereof with glp-1 |
| WO2017147542A2 (en) | 2016-02-26 | 2017-08-31 | Regeneron Pharmaceuticals, Inc. | Optimized transglutaminase site-specific antibody conjugation |
| US9951141B2 (en) | 2014-06-02 | 2018-04-24 | Regeneron Pharmaceuticals, Inc. | Antibody-drug conjugates, their preparation and their therapeutic use |
| US9950076B2 (en) | 2016-01-25 | 2018-04-24 | Regeneron Pharmaceuticals, Inc. | Maytansinoid derivatives, conjugates thereof, and methods of use |
| US20180311372A1 (en) * | 2017-01-17 | 2018-11-01 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using glp-1 receptor agonists conjugated to antagonists for gastric inhibitory peptide receptor (gipr) |
| US20180333504A1 (en) * | 2017-05-18 | 2018-11-22 | Regeneron Pharmaceuticals, Inc. | Cyclodextrin protein drug conjugates |
| US10842881B2 (en) | 2013-07-31 | 2020-11-24 | Rinat Neuroscience Corp. | Engineered polypeptide conjugates using transglutaminase |
| WO2021231366A1 (en) * | 2020-05-12 | 2021-11-18 | Regeneron Pharmaceuticals, Inc. | Anti-glp1r antagonist antibodies and methods of use thereof |
| WO2022056494A1 (en) | 2020-09-14 | 2022-03-17 | Regeneron Pharmaceuticals, Inc. | Antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof |
-
2023
- 2023-03-11 JP JP2024554120A patent/JP2025512735A/ja active Pending
- 2023-03-11 CN CN202380027101.5A patent/CN119072335A/zh active Pending
- 2023-03-11 KR KR1020247033773A patent/KR20240159847A/ko active Pending
- 2023-03-11 AU AU2023231305A patent/AU2023231305A1/en active Pending
- 2023-03-11 CA CA3243669A patent/CA3243669A1/en active Pending
- 2023-03-11 EP EP23714050.4A patent/EP4489855A1/en active Pending
- 2023-03-11 US US18/182,323 patent/US20230330254A1/en active Pending
- 2023-03-11 WO PCT/US2023/064203 patent/WO2023173132A1/en not_active Ceased
- 2023-03-11 MX MX2024011099A patent/MX2024011099A/es unknown
Patent Citations (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4740461A (en) | 1983-12-27 | 1988-04-26 | Genetics Institute, Inc. | Vectors and methods for transformation of eucaryotic cells |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US5385839A (en) | 1985-01-30 | 1995-01-31 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter regulatory DNA sequence |
| US4959455A (en) | 1986-07-14 | 1990-09-25 | Genetics Institute, Inc. | Primate hematopoietic growth factors IL-3 and pharmaceutical compositions |
| US4912040A (en) | 1986-11-14 | 1990-03-27 | Genetics Institute, Inc. | Eucaryotic expression system |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US20070258987A1 (en) | 2000-11-28 | 2007-11-08 | Seattle Genetics, Inc. | Recombinant Anti-Cd30 Antibodies and Uses Thereof |
| WO2005089808A2 (en) | 2004-03-15 | 2005-09-29 | Wyeth | Antibody calicheamicin conjugates |
| US20060275288A1 (en) | 2005-01-20 | 2006-12-07 | Grihalde Nelson D | GLP-1 receptor agonist and allosteric modulator monoclonal antibodies and uses thereof |
| US7750116B1 (en) | 2006-02-18 | 2010-07-06 | Seattle Genetics, Inc. | Antibody drug conjugate metabolites |
| WO2008122039A2 (en) | 2007-04-02 | 2008-10-09 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Selenocysteine mediated hybrid antibody molecules |
| US20080305497A1 (en) | 2007-05-23 | 2008-12-11 | Ventana Medical Systems, Inc. | Polymeric carriers for immunohistochemistry and in situ hybridization |
| US20100129314A1 (en) | 2008-04-30 | 2010-05-27 | Immunogen Inc. | Potent conjugates and hydrophilic linkers |
| WO2010010324A1 (en) | 2008-07-21 | 2010-01-28 | Polytherics Limited | Novel reagents and method for conjugating biological molecules |
| WO2010052253A1 (en) | 2008-11-04 | 2010-05-14 | Galderma Research & Development | Oxoazetidine derivatives, process for the preparation thereof and use thereof in human medicine and in cosmetics |
| US20120058592A1 (en) | 2008-12-30 | 2012-03-08 | Jong Hwan Kim | Laser firing apparatus for high efficiency solar cell and fabrication method thereof |
| WO2011018611A1 (en) | 2009-08-10 | 2011-02-17 | Ucl Business Plc | Reversible covalent linkage of functional molecules |
| US20120148586A1 (en) * | 2009-08-27 | 2012-06-14 | Joyce Ching Tsu Chou | Glucagon-like protein-1 receptor (glp-1r) agonists for treating autoimmune disorders |
| WO2011130598A1 (en) | 2010-04-15 | 2011-10-20 | Spirogen Limited | Pyrrolobenzodiazepines and conjugates thereof |
| WO2012005982A2 (en) | 2010-07-06 | 2012-01-12 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Reporter for rna polymerase ii termination |
| WO2012059882A2 (en) | 2010-11-05 | 2012-05-10 | Rinat Neuroscience Corporation | Engineered polypeptide conjugates and methods for making thereof using transglutaminase |
| WO2012166559A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
| US20130101546A1 (en) | 2011-06-10 | 2013-04-25 | Mersana Therapeutics, Inc. | Protein-Polymer-Drug Conjugates |
| WO2013055990A1 (en) | 2011-10-14 | 2013-04-18 | Seattle Genetics, Inc. | Pyrrolobenzodiazepines and targeted conjugates |
| WO2013053872A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Synthesis method and intermediates useful in the preparation of pyrrolobenzodiazepines |
| WO2013055993A1 (en) | 2011-10-14 | 2013-04-18 | Seattle Genetics, Inc. | Pyrrolobenzodiazepines and targeted conjugates |
| WO2013053873A1 (en) | 2011-10-14 | 2013-04-18 | Spirogen Sàrl | Pyrrolobenzodiazepines |
| WO2013068874A1 (en) | 2011-11-11 | 2013-05-16 | Pfizer Inc. | Antibody-drug conjugates |
| WO2013085925A1 (en) | 2011-12-05 | 2013-06-13 | Igenica, Inc. | Antibody-drug conjugates and related compounds, compositions, and methods |
| WO2014065661A1 (en) | 2012-10-23 | 2014-05-01 | Synaffix B.V. | Modified antibody, antibody-conjugate and process for the preparation thereof |
| US10842881B2 (en) | 2013-07-31 | 2020-11-24 | Rinat Neuroscience Corp. | Engineered polypeptide conjugates using transglutaminase |
| EP3034514A1 (en) * | 2013-08-13 | 2016-06-22 | Gmax Biopharm LLC | Antibody specifically binding to glp-1r and fusion protein thereof with glp-1 |
| US9951141B2 (en) | 2014-06-02 | 2018-04-24 | Regeneron Pharmaceuticals, Inc. | Antibody-drug conjugates, their preparation and their therapeutic use |
| US20150380666A1 (en) | 2014-06-26 | 2015-12-31 | Universal Display Corporation | Organic electroluminescent materials and devices |
| US9950076B2 (en) | 2016-01-25 | 2018-04-24 | Regeneron Pharmaceuticals, Inc. | Maytansinoid derivatives, conjugates thereof, and methods of use |
| WO2017147542A2 (en) | 2016-02-26 | 2017-08-31 | Regeneron Pharmaceuticals, Inc. | Optimized transglutaminase site-specific antibody conjugation |
| US20190070306A1 (en) * | 2016-02-26 | 2019-03-07 | Regeneron Pharmaceuticals, Inc. | Optimized transglutaminase site-specific antibody conjugation |
| US20180311372A1 (en) * | 2017-01-17 | 2018-11-01 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using glp-1 receptor agonists conjugated to antagonists for gastric inhibitory peptide receptor (gipr) |
| US20180333504A1 (en) * | 2017-05-18 | 2018-11-22 | Regeneron Pharmaceuticals, Inc. | Cyclodextrin protein drug conjugates |
| WO2021231366A1 (en) * | 2020-05-12 | 2021-11-18 | Regeneron Pharmaceuticals, Inc. | Anti-glp1r antagonist antibodies and methods of use thereof |
| WO2022056494A1 (en) | 2020-09-14 | 2022-03-17 | Regeneron Pharmaceuticals, Inc. | Antibody-drug conjugates comprising glp1 peptidomimetics and uses thereof |
Non-Patent Citations (70)
| Title |
|---|
| "Pharmaceutical Dosage Forms: Parenteral Medications", 1993, MARCEL DEKKER |
| "Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary", 1984, MACK PUBLISHING COMPANY |
| "Useful proteins from recombinant bacteria", SCIENTIFIC AMERICAN, vol. 242, 1980, pages 74 - 94 |
| AGARWAL ET AL., PROC. NATL. ACAD. SCI., USA, vol. 110, 2013, pages 46 - 51 |
| AL-LAZIKANI ET AL., J. MOL. BIOL., vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., FEBS J., vol. 272, no. 20, 2005, pages 5101 - 5109 |
| ALTSCHUL, S. F. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL, S. F. ET AL., J. MOL. EVOL., vol. 36, 1993, pages 290 - 300 |
| ALTSCHUL, S. F. ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ALTSCHUL, S. F., J. MOL. BIOL., vol. 219, 1991, pages 555 - 565 |
| ALTSCHUL, S. F: "Theoretical and Computational Methods in Genome Research", 1997, PLENUM, article "Evaluating the statistical significance of multiple distinct local alignments", pages: 1 - 14 |
| BENOIST ET AL., NATURE, vol. 290, 1981, pages 304 - 310 |
| BERGE ET AL.: "Pharmaceutical Salts", J. PHARM. SCI., vol. 66, 1977, pages 1, XP002675560, DOI: 10.1002/jps.2600660104 |
| BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42 |
| CAINA LI ET AL: "Glutazumab, a novel long-lasting GLP-1/anti-GLP-1R antibody fusion protein, exerts anti-diabetic effects through targeting dual receptor binding sites", BIOCHEMICAL PHARMACOLOGY, VOL. 150, 3 February 2018 (2018-02-03), pages 46 - 53, XP055642385, Retrieved from the Internet <URL:https://api.elsevier.com/content/article/PII:S0006295218300297?httpAccept=text/plain> [retrieved on 20191114], DOI: 10.1016/j.bcp.2018.01.029 * |
| CARRICO ET AL., NAT. CHEM. BIOL., vol. 3, 2007, pages 321 - 322 |
| CHEPURNY ET AL., JBC, 2019 |
| DE GRAAF ET AL., PHARMACOLOGICAL REVIEWS, 2016 |
| DEBOER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 21 - 25 |
| DEMBO, A., ANN. PROB., vol. 22, 1994, pages 2022 - 2039 |
| DENNLER ET AL., PROTEIN CONJUGATE CHEM, vol. 25, 2014, pages 569 - 578 |
| DONNELLY, BR J PHARMACOL, vol. 166, no. 1, 2011, pages 27 - 41 |
| DU, J. J.GAO, X. F.XIN, L.M.LEI, Z.LIU, Z.GUO, J.: "Convergent Synthesis of N-Linked Glycopeptides via Aminolysis of ω-Asp p-Nitrophenyl Thioesters in Solution", ORG. LETT., vol. 18, 2016, pages 4828 - 4831 |
| DURING ET AL., NATURE MEDICINE, vol. 9, 2003, pages 1173 - 1179 |
| GISH, W. ET AL., NATURE GENET, vol. 3, 1993, pages 266 - 272 |
| GONNET, SCIENCE, vol. 256, 1992, pages 1443 45 |
| HANCOCK, J. M. ET AL., COMPUT. APPL. BIOSCI., vol. 10, 1994, pages 67 - 70 |
| HANDBOOK OF CHEMISTRY AND PHYSICS |
| HANIKOFF S, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919 |
| HARDMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL |
| HOFER ET AL., PROC. NATL. ACAD. SCI., USA, vol. 105, 2008, pages 12451 - 12456 |
| HOLLANDER ET AL., BIOCONJUGATE CHEM., vol. 19, 2008, pages 358 - 361 |
| HONEGGEPLUCKTHUN, J. MOL. BIOL., vol. 309, 2001, pages 657 - 70 |
| I. BEREZOWSKAN.N. CHUNGC. LEMIEUXB.C. WILKESP.W. SCHILLER: "Agonist vs Antagonist Behavior of δ Opioid Peptides Containing Novel Phenylalanine Analogues in Place of Tyr", J. MED. CHEM., vol. 52, no. 21, 2009, pages 6941 - 6945 |
| J PHARM SCI TECHNOL, vol. 52, pages 238 - 311 |
| JAZAYERI A ET AL., NATURE, vol. 546, 2017, pages 254 - 258 |
| JEGER ET AL.: "Site-specific and stoichiometric modification of antibodies by bacterial transglutaminase", ANGEW CHEM INT ED ENGL, vol. 49, 2010, pages 9995 - 7, XP002695029, DOI: 10.1002/ANIE.201004243 |
| KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268 |
| KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
| LAI ET AL.: "Tissue transglutaminase (TG2) and mitochondrial function and dysfunction", FRONTIERS IN BIOSCIENCE-LANDMARK, vol. 22, no. 7, 2017, pages 1114 - 1137 |
| LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| LI ET AL.: "Glutazumab, a novel long-lasting GLP-1/anti-GLP-1R antibody fusion protein, exerts anti-diabetic effects through targeting dual receptor binding sites", BIOCHEM PHARMACOL, vol. 150, 3 February 2018 (2018-02-03), pages 46 - 53, XP055642385, DOI: 10.1016/j.bcp.2018.01.029 |
| LIEBERMAN ET AL.: "Pharmaceutical Dosage Forms: Disperse Systems", vol. 249, 1990, MARCEL DEKKER, pages: 1527 - 1533 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MADDEN, T. L. ET AL., METH. ENZYMOL., vol. 266, 1996, pages 131 - 141 |
| MANANDHARAHN, JOURNAL OF MEDICAL CHEMISTRY, 2014 |
| MINDT ET AL.: "Modification of different IgG1 antibodies via glutamine and lysine using bacterial and human tissue transglutaminase", BIOCONJUG CHEM, vol. 19, 2008, pages 271 - 8, XP002676805, DOI: 10.1021/bc700306n |
| PERRY ET AL., JOURNAL OF NEUROSCIENCE RESEARCH, vol. 72, 2003, pages 603 - 612 |
| PERRYGRIEG, CURRENT DRUG TARGETS, vol. 6, 2004, pages 565 - 571 |
| POWELL ET AL.: "Compendium of excipients for parenteral formulations", PDA, 1998 |
| RABUKA ET AL., NAT. PROTOCOLS, vol. 10, 2012, pages 1052 - 1067 |
| RYAN ET AL., FOOD & AGRICULTURE IMMUNOL., vol. 13, 2001, pages 127 - 130 |
| SARAFEDDINOV: "A Novel Transglutaminase Substrate from Streptomyces mobaraensis Inhibiting Papain-Like Cysteine Proteases", J. MICROBIOL. BIOTECHNOL., vol. 21, 2011, pages 617 - 26 |
| SCHIBLI, ANGEW CHEMIE INTER ED, vol. 49, 2010, pages 9995 |
| SCHUMACHER ET AL., J CLIN IMMUNOL, vol. 36, 2016, pages 100 |
| SCHWARTZ, R. M. ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, NATL. BIOMED. RES. FOUND., article "Matrices for detecting distant relationships", pages: 353 - 358 |
| SHAUNAK ET AL., NAT. CHEM. BIOL., vol. 2, 2006, pages 312 - 313 |
| SHIELD, JBC, vol. 277, 2002, pages 26733 |
| SILVA ET AL.: "The S228P Mutation Prevents in Vivo and in Vitro IgG4 Fab-arm Exchange as Demonstrated using a Combination of Novel Quantitative Immunoassays and Physiological Matrix Preparation", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 290, no. 9, 2015, pages 5462 - 5469, XP055299482, DOI: 10.1074/jbc.M114.600973 |
| STATES, D. J. ET AL., METHODS, vol. 3, 1991, pages 66 - 70 |
| TAYLOR ET AL., NUCL. ACIDS RES., vol. 20, 1992, pages 6287 - 6295 |
| THOMAS SORRELL: "Organic Chemistry", 1999, UNIVERSITY SCIENCE BOOKS |
| VLLLA-KOMAROFF ET AL., PROC. NATL. ACAD. SCI. USA, vol. 75, 1978, pages 3727 - 3731 |
| WAGNER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 78, 1981, pages 1441 - 1445 |
| WEINERKOTKOSKIE: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, AND WILKINS |
| WOOTTON, J. C. ET AL., COMPUT. CHEM., vol. 17, 1993, pages 149 - 163 |
| WU ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 4429 - 4432 |
| WU, X.Y.STOCKDILL, J.L.PARK, P. K.SAMUEL J. DANISHEFSKY, S.J.: "Expanding the Limits of Isonitrile-Mediated Amidations: On the Remarkable Stereosubtleties of Macrolactam Formation from Synthetic Seco-Cyclosporins", J. AM. CHEM. SOC., vol. 134, 2012, pages 2378 - 2384 |
| YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797 |
| ZHANG, J. ET AL., GENOME RES., vol. 7, 1997, pages 649 - 656 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024182268A1 (en) * | 2023-02-27 | 2024-09-06 | Regeneron Pharmaceuticals, Inc. | Liquid phase peptide support synthesis of peptides and peptidomimetics |
| WO2024211135A3 (en) * | 2023-04-07 | 2024-10-31 | Regeneron Pharmaceuticals, Inc. | Characterization of crosslinking sites in antibody-drug conjugates |
| WO2025096921A1 (en) * | 2023-11-03 | 2025-05-08 | Regeneron Pharmaceuticals, Inc. | Peptide acids as a glp1r agonist and antibody-drug conjugates thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2024011099A (es) | 2024-09-18 |
| EP4489855A1 (en) | 2025-01-15 |
| JP2025512735A (ja) | 2025-04-22 |
| CA3243669A1 (en) | 2023-09-14 |
| US20230330254A1 (en) | 2023-10-19 |
| CN119072335A (zh) | 2024-12-03 |
| AU2023231305A1 (en) | 2024-09-12 |
| KR20240159847A (ko) | 2024-11-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12280124B2 (en) | Antibody-drug conjugates comprising GLP1 peptidomimetics and uses thereof | |
| US20230330254A1 (en) | Anti-glp1r antibody-tethered drug conjugates comprising glp1 peptidomimetics and uses thereof | |
| US11401315B2 (en) | Immunoglobulins and uses thereof | |
| AU2011208719B2 (en) | Anticoagulant antidotes | |
| WO2011089183A2 (en) | Anticoagulant antidotes | |
| JP2013503626A (ja) | グルカゴン受容体に対する抗体と、それらの使用 | |
| JP2024531480A (ja) | ステロイド化合物及びそのコンジュゲート | |
| US20250171516A1 (en) | Peptide acids as a glp1r agonist and antibody-drug conjugates thereof | |
| EA051876B1 (ru) | Конъюгаты антитело-лекарственное средство, содержащие пептидомиметики glp1, и их применения | |
| AU2024372425A1 (en) | Peptide acids as a glp1r agonist and antibody-drug conjugates thereof | |
| WO2025085489A1 (en) | Gspt1-degrading compounds, anti-cd33 antibodies and antibody-drug conjugates and uses thereof | |
| IL325400A (en) | Anti-human CACNG1 antibody-drug conjugates and their uses | |
| EA050796B1 (ru) | Иммуноглобулины и их применение |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23714050 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: AU23231305 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024554120 Country of ref document: JP Ref document number: MX/A/2024/011099 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380027101.5 Country of ref document: CN Ref document number: 2401005917 Country of ref document: TH |
|
| ENP | Entry into the national phase |
Ref document number: 2023231305 Country of ref document: AU Date of ref document: 20230311 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024018636 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417076698 Country of ref document: IN Ref document number: 202492341 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20247033773 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247033773 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12024552452 Country of ref document: PH Ref document number: 2023714050 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023714050 Country of ref document: EP Effective date: 20241011 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202406175V Country of ref document: SG |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024018636 Country of ref document: BR Free format text: APRESENTE NOVAS FOLHAS DAS REIVINDICACOES, UMA VEZ QUE AS APRESENTADAS NAO TEM A REIVINDICACAO 68. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| ENP | Entry into the national phase |
Ref document number: 112024018636 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240910 |