WO2023170302A1 - C-jun antagonist peptides - Google Patents
C-jun antagonist peptides Download PDFInfo
- Publication number
- WO2023170302A1 WO2023170302A1 PCT/EP2023/056243 EP2023056243W WO2023170302A1 WO 2023170302 A1 WO2023170302 A1 WO 2023170302A1 EP 2023056243 W EP2023056243 W EP 2023056243W WO 2023170302 A1 WO2023170302 A1 WO 2023170302A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- amino acid
- seq
- jun
- peptide
- antagonist
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/73—Fusion polypeptide containing domain for protein-protein interaction containing coiled-coiled motif (leucine zippers)
Definitions
- the present invention relates to peptides that antagonise c-Jun, nucleic acids encoding peptides that antagonise c-Jun, pharmaceutical preparations comprising peptides that antagonise c-Jun, and the use of the antagonist peptides in the treatment of c-Jun-mediated diseases.
- TFs Transcription factors
- a range of upstream signals converge upon TFs, converting vital cell signalling processes into transcriptional outputs via specific DNA site recognition. Consequently, of the -1600 TFs in the human genome, >300 are associated with a disease phenotype.
- TF dysfunction leads to a range of detrimental outcomes including cancer, diabetes, and cardiovascular disease (Lee et al., 2013; Lambert et al., 2018). Selective TF antagonism is therefore a compelling therapeutic route for the treatment of these diseases.
- c-Jun is a transcription factor that is implicated in a range of human diseases (Eferl et al., 2003; Yung et al., 2010; Shiozawa et al., 2009).
- c-Jun is a member of the activator protein-1 (AP-1) family of dimeric transcription factors.
- AP-1 proteins bind to DNA recognition elements via their basic-leucine zipper (bZIP) domain which consists of a leucine zipper (LZ) to facilitate dimerisation and a DNA-binding domain (DBD) to facilitate DNA sequence recognition (Glover et al., 1995; Risse et al., 1989).
- c-Jun binds to 12-0- tetradecanoylphorbol-13-acetate response elements (TREs), directly influencing cellular processes such as differentiation, proliferation, and survival (Shaulian et al., 2001 ; Eferl et al., 2003; Eckert et al., 2013; Alani et al., 1991). Dysregulation of these functions therefore promotes hallmark cancer cell behaviour, rendering eJun a focal point for cancer therapy.
- TREs tetradecanoylphorbol-13-acetate response elements
- TF function relies on protein-protein interactions (PPIs) and protein-DNA interactions which form many points of contact over their large surfaces.
- PPIs protein-protein interactions
- SMs Small molecules
- peptides While the flat protein-protein interactions are inaccessible to many pharmaceuticals, including small molecules, peptides have the potential to excel as high-affinity and selective inhibitors when designed to complement the broad target surface.
- Various methodologies have produced peptide c-Jun antagonists that target the broad LZ binding interface (Boysen et al., 2002; Mason et al., 2006; Kaplan et al., 2014; Baxter et al., 2017; Lathbridge et al., 2018).
- LZ binding will translate into functional antagonism as the eJun DBD remains unbound and capable of binding TRE DNA (Seldeen et al., 2008; Szaloki et al., 2015).
- a method of producing a c-Jun antagonist peptide may comprise synthesising the c-Jun antagonist peptide using solid or liquid phase peptide synthesis, or may comprise producing the c-Jun antagonist peptide by recombinant expression.
- the method may further comprise contacting the c-Jun antagonist peptide with a cross-linker to produce a helix constrained c-Jun antagonist peptide.
- TRE-mDHFR can be bound to an immobilised metal affinity chromatography column due to its 6xHis-tag and subsequently eluted by an imidazole gradient (B) to give pure protein as determined by (C) SDS-PAGE of the combined and concentrated fractions shown to contain the induced protein band.
- TRE-mDHFR did not migrate through the polyacrylamide gel as predicted by the protein marker lane (M), running at an apparently higher molecular weight but its identity was confirmed by (D) electrospray ionisation mass spectrometry.
- Figure 12 CD thermal denaturation profiles showing the interaction of FosW with the eJun bZIP.
- A CD spectra showing a shift in the TRE DNA peak at -281 nm upon addition of eJun which is reversed by the titration of HingeW into the sample, as HingeW sequesters the eJun in a non-functional heterodimer.
- B The relative peak shift from bound to free TRE is plotted for varying concentrations of HingeW and A- FosW showing greater cJun/TRE DNA inhibition for HingeW across all concentrations.
- T m values broadly correlate with ICso values.
- T m increases a direct correlation is observed with improved cJun/TRE DNA antagonism (antagonism of DNA binding in which formation of the ternary complex is blocked) as indicated by the lower IC50 value.
- Figure 22 Peptide optimisation quantified by CD to determine peptide helicity, c-Jun target binding and c-Jun/TRE DNA antagonism.
- the biophysical characterisation of selected peptides are shown to illustrate exemplar data and the effects observed throughout the optimisation process.
- A Spectra of selected peptides (10 pM) which shows the increase in helicity from truncating at the N- terminus, the decrease in helicity from truncating at the C-terminus and the increase in helicity due to lactamisation.
- B Thermal denaturation profiles for selected antagonist (5 pM)/cJun (5 pM) heterodimer samples.
- FIG 23 Optimisation of bisalkylated HingeW peptide variants.
- CD antagonism data produced by monitoring a shift from bound to free TRE, to provide a direct readout of cJun-induced DNA binding of the tested cyclised (mDBMBW cyclised and 0W cyclised) versus linear HingeW (mDBMBW Linear and 0W linear) variants.
- the c-Jun antagonist described herein typically comprises a hinge region of V[XI]EE[X2][X3]LE[X4]E, more preferably an extended hinge region having an amino acid sequence of LV[XI]EE[X2][X3]LE[X4]E (SEQ ID NO: 1); and a leucine zipper (LZ) region C-terminal to the extended hinge region, wherein Xi is V, D, K, C, or R, X2 is K, D, C or R, X3 is V, D, C, K, or R and X4 is selected from E, D, C, K or R.
- the c-Jun antagonists are also referred to herein as 'c-Jun antagonist peptides.
- Xi is K and Xsis D.
- the extended hinge region may comprise an amino acid sequence of LVKEEDDLEEE (SEQ ID NO: 33). Such amino acid sequences can be used, for example, to introduce an / to i+4 K to D lactam bridge in the in the f-to-c heptad positions of the hinge region of the antagonist.
- Xi is C and Xs is C.
- the extended hinge region may comprise an amino acid sequence of LVCEEDCLEEE (SEQ ID NO: 35). Such amino acid sequences can be used, for example, to introduce an / to i+4 alkyl cross-link in the in the f-to-c heptad positions of the hinge region of the antagonist.
- the N-terminal acidic extension is believed to produce electrostatic repulsion, advantageously reducing the tendency of the peptide to homodimerize thereby making more peptide antagonist available for heterodimerisation with c-Jun.
- the negative charge throughout the N-terminal domain of the acidic extension acts favourably with the positive charge of the c-Jun DBD.
- Xi in the extended hinge region
- X5 in the acidic extension
- K amino acid sequences
- Such amino acid sequences can be used, for example, to introduce an / to i+4 K to D lactam bridge that spans the acidic extension (heptad position b) and hinge region (heptad position f) of the antagonist.
- Xi in the extended hinge region
- X5 in the acidic extension
- Such amino acid sequences can be used, for example, to introduce an / to i+4 alkyl cross-link that spans the acidic extension (heptad position b) and hinge region (heptad position f) of the antagonist.
- the acidic extension may have an amino acid sequence of EAEE (SEQ ID NO:3).
- EAEE amino acid sequence
- This amino acid sequence is believed to induces helicity and stabilises the dipole of the molecule.
- a further advantage of the EAEE sequence is that its two central residues, AE, occur at positions corresponding to interaction with DNA on c-Jun, thereby forming a direct block between c-Jun and DNA.
- the LZ region of the antagonist of the invention is located C-terminal to the hinge region and is capable of interacting with the leucine zipper of c-Jun.
- the LZ region may comprise or consist of an amino acid sequence selected from the group consisting of:
- IEQLEERNYALRKEIEDLQ (SEQ ID NO: 9), or a variant thereof.
- the variant may comprise one or more amino acid modifications.
- the variant may comprise 1 , 2, 3, 4, or 5 amino acid modifications.
- the variant comprises 1 , 2 or 3 amino acid modifications.
- the LZ region comprises or consists of an amino acid sequence of IEQLEERNYALRKEIKDLQDQ (SEQ ID NO: 7), or a variant comprising 1 , 2, or 3 modifications.
- amino acid residues at positions corresponding to position 16 (position b in a heptad) and position 20 (position fin the same heptad) of SEQ ID NO: 7 in the variant are K and D amino acid residues, respectively (i.e. the amino acid modifications) are at positions other than the positions corresponding to 16 and 20 of SEQ ID NO: 7).
- the LZ region comprises or consists of an amino acid sequence of IEQLEERNYALRKEICDLQCQ (SEQ ID NO: 27), or a variant comprising 1 , 2, or 3 modifications.
- amino acid residues at positions corresponding to position 16 (position b in a heptad) and position 20 (position in the same heptad) of SEQ ID NO: 27 in the variant are both C amino acid residues (i.e. the amino acid modification(s) are at positions other than the positions corresponding to 16 and 20 of SEQ ID NO: 27).
- the LZ region comprises:
- [X 8 ] is I, V, or L;
- [X 9 ] and [X10] are any amino acid residue
- [Xu] is Q, E, or K.
- the LZ region comprises:
- IEQLEERNYALRSEICSLQCQ SEQ ID NO: 66
- IEQLEERNYALRTEICSLMCK SEQ ID NO: 69
- IEQLEERNYALRAEICSLQCQ SEQ ID NO: 70.
- Such LZ regions are suitable for bisalkylation, as explained in more detail below.
- the LZ region comprises one or more lysine(s) and/or arginine(s) at heptad positions b, c, and/or f in the LZ region.
- the lysine(s) or arginine(s) are located at positions other than the positions being used to introduce the cross-link (e.g. lactam bridge or bisalkylation).
- the cross-link e.g. lactam bridge or bisalkylation
- the LZ region comprises or consists of an amino acid sequence of IRRLERRNRALRKEIKDLQDQ (SEQ ID NO: 74), or a variant comprising 1 , 2, or 3 modifications.
- amino acid residues at positions corresponding to position 16 (position b in a heptad) and position 20 (position fin the same heotad) of SEQ ID NO: 74 in the variant are K and D amino acid residues, respectively (i.e. the amino acid modification(s) are at positions other than the positions corresponding to 16 and 20 of SEQ ID NO: 74).
- amino acid residues at positions corresponding to position 2 (position b in a heptad) and position 3 (position c in a heptad) and position 9 (position b a heptad) of SEQ ID NO: 74 in the variant are K or R (optionally R) (i.e. the amino acid modification(s) are at positions other than the positions corresponding to 2, 3, and 9 of SEQ ID NO: 74). In some embodiments, the amino acid modification(s) are at positions other than the positions corresponding to positions 2, 3, 9, 16 and 20 of SEQ ID NO: 74.
- the LZ region comprises or consists of an amino acid sequence of IERLERRNYRLRREIKDLQDQ (SEQ ID NO: 75), or a variant comprising 1 , 2, or 3 modifications.
- amino acid residues at positions corresponding to position 16 (position b in a heptad) and position 20 (position fin the same heptad) of SEQ ID NO: 75 in the variant are K and D amino acid residues, respectively (i.e. the amino acid modification(s) are at positions other than the positions corresponding to 16 and 20 of SEQ ID NO: 75).
- amino acid residues at positions corresponding to position 3 (position c in a heptad), position 10 (position c in a heptad) and position 13 (position in a heptad) of SEQ ID NO: 75 in the variant are K or R (optionally R) (i.e. the amino acid modification(s) are at positions other than the positions corresponding to 3, 10 and 13 of SEQ ID NO: 75). In some embodiments, the amino acid modification(s) are at positions other than the positions corresponding to positions 3, 10, 13, 16 and 20 of SEQ ID NO: 75.
- the c-Jun antagonist as described herein is peptidic and may be in the D- or L-form.
- “Peptidic” as used herein includes compounds that are composed of or comprise a linear chain of amino acids linked by peptide bonds and may be any peptide, polypeptide or protein.
- the amino acid residues that form the peptidic antagonists may be comprised of D- or L-form amino acid residues, or a mixture of both.
- the peptidic compounds are typically referred to as peptides.
- a c-Jun antagonist as described herein may be isolated, in the sense of being free from contaminants, such as other polypeptides and/or cellular components.
- the c-Jun antagonist as described herein may be in the free form, or any pharmacologically acceptable salt form, for example, a form of acid salt, metal salt, alkaline earth metal salt, or amine salt.
- the c-Jun antagonist may be between 10 and 100 amino acid residues long.
- the c-Jun antagonist may be less than 70, preferably less than 60, more preferably less than 55, even more preferably less than 50, yet more preferably less than 45, still more preferably less than 40 amino acids long.
- the c-Jun antagonist may be between 30 and 70, 30 and 60, 30 and 50, or 30 and 40 amino acid residues long.
- the c-Jun antagonist may have a length of length of 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, 50, 51 , 52, 53, 54, 55, 56, 57 amino acids.
- the c-Jun antagonist has a length of 36 amino acids.
- the c-Jun antagonist may be the HingeW peptide, or a variant thereof.
- the HingeW peptide comprises an amino acid sequence of
- the HingeW peptide may further comprise one or more of the following: MAS at the N-terminus, GAP at the C-terminus, and a 6xHis tag (HHHHHH) (SEQ ID NO: 53) at the C-terminus.
- MAS at the N-terminus
- GAP at the C-terminus
- 6xHis tag HHHHHH
- the HingeW peptide was demonstrated to bind to the target c-Jun protein with a high affinity and antagonise the DNA-binding function of c-Jun, and hence is demonstrated to be a functional antagonist of c-Jun.
- the c-Jun antagonist may be a truncated form of the HingeW peptide, or a variant thereof.
- various truncated HingeW peptides were developed and demonstrated to be functional antagonists of HingeW. Although the functional antagonism of these truncated forms was reduced compared to the HingeW peptide, the truncated peptides are believed to exhibit more drug-like characteristics compared to the full-length HingeW peptide, suggesting that these truncated forms also represent effective therapeutic candidates for antagonising c-Jun function.
- a ‘functional antagonist’ of c-Jun is a peptidic compound that is capable of binding to c- Jun and inhibit its DNA-binding activity.
- Methods for identifying functional antagonist peptides include the Transcription-Block Survival (TBS) assay described in Example 1 . Briefly, in TBS the coding region for the essential gene dihydrofolate reductase (DHFR) is mutated to incorporate TRE sites so that introduction of c-Jun to this gene inside E. coli produces a transcriptional block that abrogates cell proliferation. The TRE site-bound c-Jun molecules sterically prevent RNA polymerase transcribing the essential gene and this can only be restored upon introduction of an effective c-Jun/TRE antagonist.
- TBS Transcription-Block Survival
- TBS thus facilitates the identification of therapeutically valuable sequences. Further details for the TBS assay are provided in W02020128015, which is incorporated herein by reference in its entirety.
- CD circular dichroism
- this assay involves preparing a sample containing the peptide and a TRE-DNA construct (GTCAGTCAGTGACTCAATCGGTCA) (SEQ ID NO: 51) and measuring the signal between 265-320 nm.
- the TRE-DNA construct produces a positive CD peak at -281 nm, which decreases in intensity upon c-Jun binding. If peptide is capable of antagonising c-Jun DNA binding activity, increasing concentrations of the peptide will shift the peak back to the free TRE-DNA peak. Hence, peak shift can be used to quantify the ability of the peptide to antagonise c-Jun DNA binding.
- This method allows for the calculation of an IC50 value by fitting the titration data to a Hill equation.
- the c-Jun antagonist is able to inhibit the DNA-binding activity of c-Jun within 10- fold of the ability of HingeW to inhibit the DNA-binding activity of c-Jun (e.g. the c-Jun antagonist has a reduced ability to inhibit the DNA-binding activity of c-Jun that is within 10-fold of that determined for HingeW).
- the c-Jun antagonist is able to inhibit the DNA-binding activity of c-Jun within 9-fold, preferably within 8-fold, more preferably within 7-fold, even more preferably within 6-fold, yet more preferably within 5-fold of the ability of HingeW to inhibit the DNA-binding activity of c-Jun.
- the ability of the c-Jun antagonist and HingeW to inhibit the DNA-binding activity may be measured using the TBS assay (e.g. by quantifying the number of colonies) or by determining the IC50 using a circular dichroism assay described herein.
- the c-Jun antagonist may have this activity when crosslinked. Methods for cross-linking peptides are described in more detail below.
- the c-Jun antagonist comprises or consists of any one of the following amino acid sequences:
- EAEELVVEEDVLEEEIEQLEEKNKALKDEIEDLY (SEQ ID NO: 25);
- EAEELVVEEDVLEEEIEQLEERNYALRKEICDLQCQ SEQ ID NO: 28;
- EAEELVVEEDVLEEEIEQLEERNYALRSEICSLQCQ SEQ ID NO: 37;
- EAEELVVEEDVLEEEIEQLEERNYALRTEICSLMCK SEQ ID NO: 40
- EAEELVVEEDVLEEEIEQLEERNYALRAEICSLQCQ SEQ ID NO: 41
- EAEELVVEEKVLEDEIERLERRNYRLRREIKDLQDQ (SEQ ID NO: 73), or a variant thereof comprising 1 , 2 or 3 amino acid modifications, optionally wherein the 1 , 2 or 3 amino acid modifications are present in the LZ region.
- amino acid residues at positions corresponding to position 3 (position b in a heptad) and position 7 (position f in the same heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- amino acid residues at positions corresponding to position 10 (position b in a heptad) and position 14 (position fin the same heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- amino acid residues at positions corresponding to position 17 (position b in a heptad) and position 21 (position fin the same heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- a c-Jun antagonist comprising a modified version of the amino acid sequence EAEELVVEEDVLEEEIEQLEERNYALRKEIEDLQKQ (SEQ ID NO: 18), wherein the modifications include one or more (e.g. one or two) of the following:
- amino acid residues at positions corresponding to position 7 (position fin a heptad) and position 11 (position c in the subsequent heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- amino acid residues at positions corresponding to position 14 (position fin a heptad) and position 18 (position c in the subsequent heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- amino acid residues at positions corresponding to position 21 (position fin a heptad) and position 25 (position c in the subsequent heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues;
- amino acid residues at positions corresponding to position 28 (position fin a heptad) and position 32 (position c in the subsequent heptad) of SEQ ID NO: 18 are K and D amino acid residues, respectively, or both are C amino acid residues, or a variant thereof comprising 1 , 2, 3 or 4 amino acid modifications outside of the stated positions (i.e. outside of the positions f in one heptad and c in the subsequent heptad).
- c-Jun antagonists where the amino acid sequence has been modified in order to introduce / to i+7 cross-linker(s) into the c-Jun antagonist.
- the covalent / to i+7 amino acid cross-linker(s) may be alkyl cross-link formed between two C residues (cysteine alkylation).
- / to /+7amino acid residue cross-links are introduced at solvent exposed b-to-b, c-to-c or f-to-f (spanning two heptads) heptad positions.
- a c-Jun antagonist comprising a modified version of the amino acid sequence EAEELVVEEDVLEEEIEQLEERNYALRKEIEDLQKQ (SEQ ID NO: 18), wherein the modifications include one or more (e.g. one or two) of the following:
- amino acid residues at positions corresponding to position 3 (position b in a heptad) and position 10 (position b in the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 10 (position b in a heptad) and position 17 (position b in the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 17 (position b in a heptad) and position 24 (position b in the subsequent heptad) of SEQ ID NO: 7 are both C amino acid residues;
- amino acid residues at positions corresponding to position 24 (position b in a heptad) and position 31 (position b in the subsequent heptad) of SEQ ID NO: 7 are both C amino acid residues;
- amino acid residues at positions corresponding to position 4 (position c in a heptad) and position 11 (position c in the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 25 (position c in a heptad) and position 32 (position c in the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 7 (position fin a heptad) and position 14 (position fin the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 14 (position fin a heptad) and position 21 (position fin the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 21 (position fin a heptad) and position 28 (position fin the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues;
- amino acid residues at positions corresponding to position 28 (position fin a heptad) and position 35 (position fin the subsequent heptad) of SEQ ID NO: 18 are both C amino acid residues, or a variant thereof comprising 1 , 2, 3 or 4 amino acid modifications outside of the stated positions (i.e. outside of the positions b, c or accordingly).
- the c-Jun antagonist comprises or consists of the amino acid sequence of:
- the amino acid substitution may be a conservative amino acid substitution.
- Conservative amino acid substitutions may involve exchange of a member of one of these classes with another member of the same class.
- a conservative amino acid substitution may be a substitution of the acidic amino acid glutamic acid (E) for the acidic amino acid aspartic acid (D).
- Non-natural amino acids may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems.
- Suitable non-natural amino acids include 3-Cyclohexylalanine (Cha), Norleucine (NLe) and Ornithine (Orn).
- Other examples of non-natural amino acids include citrulline (Cit), hydroxyproline (Hyp), 3-nitrotyrosine, nitroarginine naphtylalanine (Nal), Abu, DAB, methionine sulfoxide and methionine sulfone.
- the amino acid modifications result in the introduction of hydrophobic and charged surface patches in the peptide.
- Hydrophobic and charged surface patches can be introduced by inserting clusters of amino acid residues (e.g. at least 3 contiguous residues) that are hydrophobic and/or positively charged, as described for example in Perry et al., 2018.
- the amino acid modifications described herein may produce a c-Jun antagonist that contains at least 3 contiguous amino acid residues that are either lysine or leucine (e.g. in the extended hinge region and/or leucine region).
- any amino acid modifications are typically located outside of the relevant positions that are being used for cross-linking. That is, for antagonists comprising b-to-f (in one heptad) amino acid residue cross-links, the amino acid modification(s) may be at positions a, c, d, e, or g in that heptad.
- the amino acid modification(s) may be at any of positions a, b, c, d ore in the first heptad and a, b, d, e, for g, in the second heptad.
- the introduction of positively charged amino acids at a solvent exposed face of an a-helical peptide improves cell penetrance (see for example, Smith et al., 2008 and Perry et al., 2018). This may be achieved by the introduction of arginine residues at specific positions in order to generate an arginine substitution pattern known to promote cell permeability as described in Smith et al., 2008. Accordingly, in some embodiments, the peptides described herein comprise one or more arginine or lysine substitutions. In some embodiments, the extended hinge region and/or LZ region comprises one or more arginine or lysine modifications, i.e.
- an arginine or lysine substitutions pattern may be introduced in the peptides described herein.
- these arginine modifications are located at heptad positions b, c, and/or f, i.e. on the solvent exposed face of an a-helical peptide.
- the c-Jun antagonist peptide described herein comprises a modified version of the amino acid sequence according to SEQ ID NO:11 , wherein modifications include one or more (e.g one or two) of the following:
- amino acid residues at positions corresponding to positions 14 (position fin a heptad), 17 (position b in a heptad), 18 (position c in a heptad) 24 (position b in a heptad) are K or R residues (optionally R).
- the c-Jun antagonist peptide may have the amino acid sequence EAEELVVEEKVLEREIRRLERRNRALRKEIKDLQDQ (SEQ ID NO:72); or (ii) amino acid residues at positions corresponding to position 18 (position c in a heptad), position 25 (position c in a heptad), position 28 (position f in a heptad) are K or R residues (optionally R).
- the c-Jun antagonist may have the amino acid sequence
- EAEELVVEEKVLEDEIERLERRNYRLRREIKDLQDQ (SEQ ID NO: 73) or a variant thereof comprising 1 , 2, 3 or 4 amino acid modifications outside of the stated positions.
- the amino acid residues at positions corresponding to position 31 (position b in a heptad) and position 35 (position fin a heptad) of SEQ ID NO: 72 or 73 in the variant are K and D amino acid residues, respectively (i.e. the amino acid modification(s) are at positions other than positions corresponding to positions 14, 17, 18, 31 and 35 of SEQ ID NO: 72, or at positions other than positions corresponding to positions 18, 25, 28, 31 and 35 of SEQ ID NO: 73.
- a c-Jun antagonist may have an amino acid sequence having a specified degree of sequence identity to one of SEQ ID Nos 12 to 26.
- the specified degree of sequence identity may be from at least 60% to 100% sequence identity. More preferably, the specified degree of sequence identity may be one of at least 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity.
- a c-Jun antagonist peptide as described herein may be provided using synthetic or recombinant techniques which are standard in the art.
- a c-Jun peptide as described herein may be produced by solid phase synthesis.
- Peptides are typically synthesized by solid phase synthesis in a stepwise fashion from the C terminus to the N terminus.
- an N protected amino acid is covalently attached to an insoluble solid support via its carbonyl group.
- Suitable groups for N protecting the amino acid include 9-fluorenylmethyloxycarbonyl group (Fmoc) and t-butyloxycarbonyl (Boc).
- protecting groups may be employed to prevent functional groups in the side chains of amino acids from reacting with an incoming N protected amino acids. These side chain protecting groups may be present throughout the synthesis of the peptide and may be removed in a final deprotection step.
- a method of producing a c-Jun antagonist peptide may comprise synthesising a peptide comprising SEQ ID NO:1 by solid or liquid phase peptide synthesis.
- alpha-helices are thought to comprise approximately 60% of all secondary structures in protein complexes (Jochim and Arora, 2010). Additionally, alpha-helices have been shown to mediate a large number of key therapeutically relevant PPI interfaces, of which 60% bind to one face of the helix (Raj et al., 2013).
- n is an integer selected from 1 to 3;
- m is an integer selected from 0 to 2;
- the cross-linking agent is 1 ,3-dibromomethylbenzene (DBMB) having the following chemical formula:
- DBMB can be used to react with derivatisable amino acid residues at the / and i+3 or / and i+4 in the amino acid sequence of the peptide.
- the cross-linking agent is 4,4'-bisbromomethyl-biphenyl (Bpy) having the following chemical formula:
- Bpy can be used to react with derivatisable amino acid residues at the / and i+7 in the amino acid sequence of the peptide.
- the cross-linker may be present at a concentration of between 1 pM and 1 mM (e.g. between 10 pM and 100 pM), and for a period of at least 20 minutes (e.g. between 20 minutes and 10 hours). Further details of a suitable in cellulo cross-linking method are provided for example in WO 2021/260074.
- R 1a represents a bond or CH2-CH2- linker derived from the appropriate R1 group in formula 1 .
- the cross-link may be formed between amino acids at positions / and i+3, i and i+4, or / and i+7 in the amino acid sequence of the peptide.
- the cross-link is between cysteine (C) residues located at these positions.
- the cross-link is between lysine (K) and aspartic acid (D) residues at these positions.
- the cross-link is formed between amino acids at positions / and i+4.
- a nucleic acid encoding a c-Jun antagonist peptide may be any nucleic acid (DNA or RNA).
- the c-Jun antagonist may be conjugated, optionally through a linker, to another moiety, such as a fatty acid or other lipid, a polymer, or another peptide sequence (e.g. a cell penetrating peptides (CPPs).
- a linker such as a cell penetrating peptides (CPPs).
- CPPs cell penetrating peptides
- Such conjugates retain the functional antagonist property of the c-Jun antagonist, and may have one or more improved properties, such as stability, in vivo half-life, or potency, or cell penetrance relative to unconjugated c-Jun antagonist.
- the moiety may be conjugated to the c-Jun antagonist through the N- or C-terminus, or any other site of the peptide.
- the peptide may be conjugated to a cell penetrating peptides (CPP).
- CPPs are a class of peptides capable of penetrating the plasma membrane of mammalian cells and of transporting compounds of many types and molecular weights across the membrane. When CPPs are chemically linked or fused to other proteins, the resulting polypeptides are able to enter cells.
- the linkage to the CPP may be direct (e.g. as part of a fusion protein), or may be via a linker (e.g. a short peptide linker).
- CPPs are generally peptides of less than 30 amino acids, derived from natural or unnatural protein or chimeric sequences.
- CPPs examples include tat (PGRKKRRQRRPPQ) (SEQ ID NO: 54), penetratin (RQIKIWFQNRRMKWKK) (SEQ ID NO: 55), transportan (GWTLNSAGYLLGKINLKALAALAKKIL) (SEQ ID NO: 56), VP-22 (DAATATRGRSAASRPTERPRAPARSASRPRRPVD) (SEQ ID NO: 57), Pep-1 (KETWWETWWTEWSQPKKKRKV) (SEQ ID NO: 58), MAP (KALAKALAKALA) (SEQ ID NO: 59), SAP (VRLPPPVRLPPPVRLPPP) (SEQ ID NO: 60), oligoarginine (RRRRRRRR (SEQ ID NO: 61) or RRRRRRRRR (SEQ ID NO: 62)), calcitonin (LGTYTQDFNKTFPQTAIGVGAP) (SEQ ID NO: 63), SynB (RGGRLSYSRRRFSTSTGR (SEQ
- c-Jun antagonist peptides of the invention may be formulated in a pharmaceutical composition.
- a pharmaceutical composition is a formulation comprising one or more active agents (e.g. the c-Jun antagonist peptides or conjugates described herein) and one or more pharmaceutically acceptable excipients.
- the pharmaceutical composition may be capable of eliciting a therapeutic effect.
- a method of making a pharmaceutical composition may comprise; admixing a c-Jun antagonist peptide or conjugate as described above with a pharmaceutically acceptable excipient.
- pharmaceutically acceptable relates to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound veterinary or medical judgement, suitable for use in contact with the tissues of a subject (e.g. human or other mammal) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- a subject e.g. human or other mammal
- Each carrier, excipient, etc. must also be “acceptable” in the sense of being compatible with the other ingredients of the formulation.
- Suitable excipients and carriers include, without limitation, water, saline, buffered saline, phosphate buffer, alcoholic/aqueous solutions, emulsions or suspensions. Other conventionally employed diluents, adjuvants, and excipients may be added in accordance with conventional techniques.
- Such carriers can include ethanol, polyols, and suitable mixtures thereof, vegetable oils, and injectable organic esters. Buffers and pH-adjusting agents may also be employed, and include, without limitation, salts prepared from an organic acid or base.
- Representative buffers include, without limitation, organic acid salts, such as salts of citric acid (e.g., citrates), ascorbic acid, gluconic acid, carbonic acid, tartaric acid, succinic acid, acetic acid, phthalic acid, Tris, trimethylamine hydrochloride, or phosphate buffers.
- Parenteral carriers can include sodium chloride solution, Ringer's dextrose, dextrose, trehalose, sucrose, lactated Ringer's, or fixed oils.
- Intravenous carriers can include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
- Preservatives and other additives such as, for example, antimicrobials, antioxidants, chelating agents (e.g., EGTA; EDTA), inert gases, and the like may also be provided in the pharmaceutical carriers.
- chelating agents e.g., EGTA; EDTA
- inert gases e.g., inert gases, and the like
- the pharmaceutical compositions described herein are not limited by the selection of the carrier.
- the preparation of these pharmaceutically-acceptable compositions, from the above-described components, having appropriate pH, isotonicity, stability and other conventional characteristics, is within the skill of the art.
- a pharmaceutical composition may conveniently be presented in unit dosage form and may be prepared by any methods well-known in the art of pharmacy. Such methods include the step of bringing the peptide into association with a carrier or excipient as described above which may constitute one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active compound with liquid carriers or finely divided solid carriers or both.
- compositions described herein may be produced in various forms, depending upon the route of administration.
- the pharmaceutical compositions may be prepared for administration to subjects in the form of, for example, liquids, powders, aerosols, tablets, capsules, enteric-coated tablets or capsules, or suppositories.
- Pharmaceutical compositions may also be in the form of suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations.
- Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials, such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
- compositions may be made in the form of sterile aqueous solutions or dispersions, suitable for injectable use, or made in lyophilized forms using freeze-drying techniques. Lyophilized pharmaceutical compositions are typically maintained at about 4°C, and can be reconstituted in a stabilizing solution, e.g., saline or HEPES, with or without adjuvant. Pharmaceutical compositions can also be made in the form of suspensions or emulsions.
- compositions may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections immediately prior to use.
- the pharmaceutical composition may be administered to a subject by any convenient route of administration. In some embodiments, administration is by systemic routes, including oral, or more preferably parenteral routes.
- the pharmaceutical composition may be administered by intravenous, intraperitoneal or subcutaneous injection.
- An individual with a c-Jun-mediated disease may display at least one identifiable sign, symptom, or laboratory finding that is sufficient to make a diagnosis of a c-Jun-mediated disorder in accordance with clinical standards known in the art. Examples of such clinical standards can be found in textbooks of medicine such as Harrison's Principles of Internal Medicine, 1 5th Ed., Fauci AS et al., eds., McGraw-Hill, New York, 2001 .
- the individual may have been previously identified or diagnosed with a c-Jun-mediated disorder or a method of the invention may comprise identifying or diagnosing the presence of a c-Jun-mediated disorder in the individual, prognosing a c-Jun-mediated disorder or assessing the risk of onset of a c-Jun-mediated disorder in the individual.
- Treatment may be any treatment and therapy, whether of a human or an animal (e.g. in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the c-Jun-mediated disease, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the c-Jun-mediated disease, cure or remission (whether partial or total) of the c-Jun-mediated disease, preventing, delaying, abating or arresting one or more symptoms and/or signs of the c-Jun-mediated disease or prolonging survival of a subject or patient beyond that expected in the absence of treatment.
- some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the c-Jun-mediated disease, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the c-Jun-mediated disease, cure or remission (whether partial or total) of the c-Jun-mediated disease, preventing, delaying, abating
- the c-Jun antagonist peptide may be used in a method of treatment of any one of the following diseases: cancer, diabetes, cardiovascular disease, autoimmune disease, joint disorders (such as arthritis), and neurodegenerative disease.
- a c-Jun antagonist peptide may be useful in inhibiting or reducing the metastasis of a cancer.
- a method of reducing or inhibiting metastasis in an individual with cancer may comprise administering therapeutically effective amounts of a c-Jun peptide to the individual
- Test compounds used in the method may be obtained from a synthetic combinatorial peptide library, or may be synthetic peptides or peptide mimetic molecules.
- A-Fos which combined the wild-type (WT) cFos LZ (known to heterodimerise with c-Jun) and a rationally designed Glu-rich acidic extension (Figure 1) (Olive et al., 1997).
- WT wild-type
- Figure 1 a rationally designed Glu-rich acidic extension
- the A-Fos design principle postulated that the LZ interaction is extended N-terminally generating a DBD-acidic extension interaction facilitated by the incorporation of Leu residues into putative d positions in the acidic extension.
- An intracellular Transcription Block Survival (TBS) library screening assay was developed and validated to search for functional TF antagonists, where cell survival only occurs when TF activity is abolished.
- bacterial growth rates are correlated with antagonist efficiency allowing for comparison and competition between TF antagonists.
- a large peptide library (131 ,027 members), demonstrating that they can be screened within the TBS platform for functional c-Jun antagonism.
- the selected peptide is validated using a range of biophysical approaches indicating a clear improvement from the parent peptide in target binding and c-Jun/TRE DNA antagonism that is particularly facilitated by a reduction in homodimeric stability. The following methods were used:
- Proteins were purified by subcloning their DNA sequences into either a pET21 -His-SUMO plasmid (eJun bZIP, cFos bZIP) or a pET24a plasmid (HingeW, A-FosW, FosW) using Nhel and Asci sites.
- An overnight culture of E. coli containing the relevant plasmid was used to inoculate LB media at a dilution factor of 1 :1000. This culture was incubated with shaking (37°C, 200 rpm) until the ODeoonm reached 0.7.
- Protein over-expression was induced by the addition of IPTG (1 mM) before incubation with shaking (25°C, 200 rpm) overnight. Cells were then harvested from the culture by centrifugation. Cell pellets were resuspended in Histrap Binding Buffer (20 mM potassium phosphate, 500 mM NaCI, 40 mM imidazole, 5 mM DTT, pH 7.4), sonicated and loaded on a HisTrap HP 5 mL pre-loaded column.
- Histrap Binding Buffer (20 mM potassium phosphate, 500 mM NaCI, 40 mM imidazole, 5 mM DTT, pH 7.4
- Binding Buffer:Elution Buffer (20 mM potassium phosphate buffer, 500 mM NaCI, 400 mM imidazole, 5 mM DTT, pH 7.4) gradient. This methodology was also used to produce a -80% pure sample of His-tagged ULP1 protease for use in the SUMO cleavage step.
- SUMO-tagged proteins were buffer exchanged into Standard Buffer (20 mM Tris.HCI, 2 mM DTT, pH 8.0). A 10:1 mixture of SUMO-tagged protein:ULP1 was incubated at 30°C for 16h.
- the cleavage reaction was diluted 1 in 5 in Binding Buffer and then passed through the HisTrap column to remove the cleaved SUMO tag and the His-tagged ULP1 .
- the HisTrap flowthrough was finally purified to >98% purity by using RP-HPLC with a Jupiter Proteo column (4-pm particle size, 90 A pore size, 250 * 10 mm; Phenomenex) using a water:acetonitrile gradient (0.1% TFA). Peptides without a SUMO tag, were concentrated after Histrap elution and HPLC purified.
- DHFR Activity Assay A colorimetric assay kit (Sigma CD0340) was used to measure the activity of purified DHFR enzymes. WT- or TRE-mDHFR (100 nM in reaction) and NADPH (60 pM in reaction) were mixed in assay buffer only, or with DHFR inhibitors TMP or Mtx (1 pM in reaction). Reactions were initiated by the addition of DHF (50 pM in reaction plus a blank reaction with no DHF) and the absorbance at 340 nm of samples was measured using a Varian Cary 50 UV-Vis spectrophotometer. The specific activity was calculated using the following equation. Specific activity - - 12 3x -m -g protein
- Library inserts were produced using PCR fill-in reactions from synthesised primers (Sigma) with degenerate codons at the desired positions to produce the correct residue options.
- the library was subcloned using Sacl and Asci sites into the pET24a plasmid containing A-FosW.
- the primers used were cJun-Hinge-Lib-F: 5’- GAAGAGCTCSWGSWGSWGSWGSWTSWGCTGSWGGMASWGATTGAACAGCTGGAAGAACGCAAC
- TATGCC-3’ SEQ ID NO: 49
- cJun-Hinge-Lib_R 5’- TGAGGCGCGCCCAGTTTCTCCAGCTGTTTCTGGAGGTCTTCGATCTCTTTGCGCAAGGCATAGTTGC GTTC-3’
- the library DNA was transformed into NEB 10-beta electrocompetent E. coli cells. The following equation was utilised to determine library coverage by the number of single colonies: E - 100 x (1 - ⁇ ) m where E is the percentage of the library missing, m is the number of colonies collected and n is the library size. This showed that from 2155000 library colonies collected, 99.9% of the Hinge library was covered.
- Library DNA quality was assessed by sequencing both the DNA pool and a number of single colonies to show degenerate codons in the correct positions in the pool and to show a diversity of library members from single colonies.
- the pool of library DNA was transformed into BL21 Gold cells already containing pES300d-TRE-mDHFR and pES230d-cJun bZIP.
- Selective pressure is applied by growing the bacteria in M9 minimal media with TMP (2-4 pM) alongside ampicillin, kanamycin and chloramphenicol to maintain the required plasmids, and IPTG (1 mM) to induce protein expression.
- the library transformants were first plated out onto selective agar plates (2 pM TMP) and grown at 37°C for 72-96h.
- Optimisation experiments ( Figure 5) indicate that 4 pM TMP is optimum for selection however a lower stringency is used initially before selection is increased in later steps. Colonies from this first round of selection were pooled and serially grown in liquid culture at starting ODeoo of 0.05 and grown at 37°C with shaking at 200 rpm until the ODeoo reached 0.6.
- TMP concentration was 2 pM in the first liquid culture passage before it was increased to the optimum 4 pM in subsequent passages.
- Bacteria containing the most effective functional antagonists were expected to produce higher levels of TRE-mDHFR which provides a growth advantage, and these will dominate the culture.
- a sample of the culture was plated on LB agar (supplemented with antibiotics to maintain plasmids) to select and sequence individual colonies, and a DNA pool was also sequenced. This allows the occurrence of library members to be monitored as winner sequences are selected for.
- Thermal denaturation experiments were performed by measuring the ellipticity at 222 nm over a 1 to 90°C gradient at 1 °C increments. Post-melt scans at 20°C confirmed the transitions were reversible as they overlaid within 10% of the pre-melt scan. The resulting thermal denaturation curves were converted to MRE and fitted to a two-state model, derived via modification of the Gibbs-Helmholtz equation to determine the melting temperature (T m ) (Mason et al., 2007).
- ITC Isothermal Titration Calorimetry
- the resulting binding data were fit to a one site binding model to extract the enthalpy change of binding (AH and the equilibrium binding constant (KD), from which the free energy change of binding (ZIG) and the entropy change of binding (21 S) was calculated (Wiseman et al., 1989).
- Thermodynamic parameters are presented as an average of two independent experiments with errors given as one standard deviation.
- Protein/DNA samples for electrophoresis were incubated at 4°C for 30 minutes in binding buffer (150 mM KOI, 1 mM dithiothreitol, 1 mM EDTA, 10 mM Tris, 10 mM MgCh, pH 8) before running on a 1.3% agarose gel in 0.5xTBE buffer (supplemented with 10 mM MgCh).
- binding buffer 150 mM KOI, 1 mM dithiothreitol, 1 mM EDTA, 10 mM Tris, 10 mM MgCh, pH 8
- SYBR® Green stain was included in the gel and running buffer to stain for DNA which was imaged on a transilluminator before SYPRO® Ruby was added and incubated for 3 h to stain for protein.
- the gel was destained in a 10% methanol, 7% acetic acid solution for 1 h before imaging on a transilluminator.
- Transcription block survival is an intracellular assay that utilises cell survival as a readout. This allows protein-DNA interaction antagonists to be screened, and the most active identified by their ability to remove a transcriptional block on exogenous murine dihydrofolate reductase (DHFR). This enzyme is absolutely essential for survival since it is required for the production of purines needed for DNA and amino acid synthesis. Endogenous E.coli DHFR (ecDHFR) can be selectively inhibited by trimethoprim (TMP), meaning that cells grown in M9 minimal media are rendered dependent on exogenous murine DHFR (mDHFR) activity for their survival (Matthews et al., 1985).
- TMP trimethoprim
- the transcription block is strongly TRE site specific as indicated by a 1 .3-fold reduction without TRE sites.
- peptides known to bind to eJun were introduced into the system, to establish whether they can impact upon eJun function - i.e. sequester the eJun bZIP as a non-functional heterodimer therefore preventing DNA-binding and rescuing TRE-mDHFR transcription.
- cFos LZ and FosW an optimised sequence identified from a protein-fragment complementation assay (PCA) that readily binds to eJun in the absence of DNA at nM affinity (Mason et al., 2006; Worral et al., 2011).
- This protein was designed to act as a template for peptide library design and optimisation using TBS screening. Reassuringly the template peptide was able to successfully antagonise the cJun/TRE DNA interaction, restoring 60% of the colony numbers relative to TRE-mDHFR only ( Figure 8B-8 vs. 8B-5). Importantly, all experimental variations above were plasmid-matched with appropriate dummy constructs to control for potential differences in antibiotic stress (Table 3). TBS design is summarised in Figure 8A.
- the acidic extension design principle is the most successful methodology in the literature to target the full bZIP domain of various proteins (Olive et al., 1997; Ahn et al., 1998; Chen et al., 2011).
- incomplete restoration of colonies using A-FosW indicated that transcription remained partially hampered by eJun binding across the 15 TRE sites.
- the library design utilised semi-randomised positions within the hinge region that straddles the acidic extension and LZ domains ( Figure 9).
- the low thermal stability of the HingeW homodimer results in no observable lower baseline prior to the transition such that the Tm for this component, and thus the average, cannot be determined.
- this ATm can be estimated to be ⁇ 40°C, compared to 27.5°C for A-FosW/cJun.
- the TBS screen has therefore led to an optimised reduction in homodimersation more so than increased heterodimerisation with the target. This ensures that more antagonist is available as free monomer in solution and therefore in a target-dimerisation competent state.
- Another difference between the two denaturation profiles is the presence of a double transition for the A-FosW/cJun heterodimer, with a smaller initial transition occurring at ⁇ 30°C.
- HingeW effectively antagonises the c-Jun/TRE DNA interaction
- eJun The binding of eJun to TRE DNA can be observed by monitoring a DNA absorbance peak in the CD spectrum centred at -281 nm (John M et al., 1996). Peptides (eJun, HingeW or A-FosW) in isolation do not absorb at this wavelength meaning that all changes in the spectrum in this region correspond to shifts in DNA conformation. Addition of eJun (20 pM) to TRE DNA (5 pM) decreases this DNA peak by 55% as the eJun engages its target TRE site and alters the DNA structure ( Figure 15A). Subsequent titration of HingeW into this bound cJun/TRE DNA mixture reverses the peak shift, with the peak increasing as DNA is released.
- an electrophoretic mobility shift assay (EMSA) was employed. Firstly, eJun bZIP (20 pM) was mixed with the TRE DNA construct (2 pM), resulting in a significant reduction in the free DNA band intensity relative to DNA alone ( Figure 15C). No bound cJun/TRE DNA band was observed as the overall charge of this complex prohibited entry into the gel. Antagonism was therefore best observed by monitoring the intensity of the free DNA band. A concentration dependent increase in the free DNA band intensity was observed upon addition of HingeW to cJun/TRE DNA ( Figure 15D). The same trend was observed for increasing concentrations of A-FosW with cJun/TRE DNA ( Figure 15E).
- the data could be fit to the Hill equation (OriginPro) to determine an IC50 value of 9.6 ⁇ 0.8 pM for HingeW and 12.1 ⁇ 1 .9 pM for A-FosW.
- the data could be fit to the Hill equation (OriginPro) to determine an IC50 value of 9.6 ⁇ 0.8 pM for HingeW and 12.1 ⁇ 1 .9 pM for A- FosW ( Figure 15F).
- thermodynamic parameters for the interactions between c-Jun and either the rationally designed A-FosW template or the TBS library -derived HingeW is provided in Table 4 as follows:
- Table 4 Thermodynamic parameters for the interactions between c-Jun and either the rationally designed A-FosW template or the TBS library derived HingeW. Errors shown as one standard deviation.
- TBS system required the production of a mutant DHFR gene (TRE-mDHFR) which retained its enzymatic activity upon introduction of 15 TRE sites into its DNA sequence, leading to 13 amino acid substitutions. This allowed for a cJun-induced transcriptional block when the TF binds to the TRE sites on the TRE-mDHFR plasmid DNA. For loss of TRE-mDHFR activity to take place there is an absolute requirement for both the TF DBD and the TRE sites within the mDHFR gene, confirming specificity in the TBS system.
- the phenotype of bacterial growth rate is directly linked to the genotype of the antagonist sequence expressed by virtue of the systems containment in a single cell.
- Bacterial cells are ideal for this process owing to their fast growth rate, durability, ease of use and low cost. Crucially, they also allow for the direct measurement of eJun interacting with TRE sites in the absence of any related eukaryotic TFs that might interfere with the assay.
- TBS facilitates high-throughput genotype to phenotype screening and competition of peptide libraries to isolate those that result in functional loss of eJun DNA binding activity from those that bind but have little or no effect upon target activity (or those that do not bind at all).
- the distinction is important since it means that an antagonist must not only bind to the target free in solution but must also be capable of meeting the much more demanding task of liberating the TF from DNA, which is known to be more stable (Seldeen et al., 2011).
- all the above is undertaken within the complex environment of the cytoplasm, removing molecules that are toxic, non-specific, insoluble, or protease susceptible from consideration at the initial screening stage, rather than determining this at later hit validation or clinical trial stages.
- TBS improves upon the related protein-fragment complementation assay, as well as in vitro screening platforms such as phage display or ribosome display, by the complete removal of any requirement for bulky protein fusions or hydrophobic/aromatic tags, which can interfere with the relevant assay interactions and lead to false readouts.
- TBS central advantage of TBS is the requirement for assay hits to prevent TFs from binding to their consensus DNA sequence as exemplified by the combined design of A-FosW, a hybrid containing domains from both A-Fos (Olive et al., 1997) and the FosW PCA hit (Mason et al., 2006).
- A-FosW the LZ targets the antagonist to the eJun bZIP with high affinity and selectivity, with the acidic extension added to assist in functionally antagonising the cJun/TRE DNA interaction by blocking the eJun DBD.
- HingeW included one more acidic residue than A- FosW, supporting the Olive et al. methodology of including dominant negative charge throughout the N- terminal domain to interact favourably with positive charge within the eJun DBD.
- the precise selection pattern was more nuanced than simply producing a block of negative charged residues.
- the nature of HingeW suggests another benefit of the TBS library screening approach, in which directed evolution of the antagonist led to an improvement by reducing homodimerisation. TBS has provided considerable utility in the exploration of novel sequence space by producing a protein sequence which could not have been predicted without the use of this library screening approach.
- TBS opens a new capability in semi-rational PPI design where both affinity and activity are co-selected for. This offers significant potential to expand the TBS approach to both new libraries and targets where previous work may have produced potential antagonists which were later found to lack functional activity.
- the approach can be fully expanded to any DNA-binding protein that recognises a discrete consensus sequence, or even any dimeric system to which a DBD is appended.
- the method can be assumed to be generalizable, since any DNA consensus sequence can be incorporated into the DHFR DNA sequence and can be transcriptionally blocked by co-expression of the relevant TFs. This will require the DHFR design process to be iterated and subsequent testing and optimization for each system, however, the central principle has been shown here to be valid.
- This example shows the optimisation of the peptide library screen-derived hit of example 1 , designed to target the full eJun bZIP domain in an attempt to simultaneously block both eJun dimerisation and DNA- binding.
- TBS screening of a 130,000-member peptide library resulted in the HingeW sequence (HW1).
- HingeW was developed to be capable of binding across the full eJun bZIP domain for more effective functional antagonism of TRE binding, relative to DBD-only or LZ-only eJun inhibitors.
- the nature of the broad, shallow helical binding surface supports the use of longer peptides such as Hinge. However it was unclear whether the full length of the sequence was required to achieve functional antagonism.
- Peptides were resuspended in 3:1 water:acetonitrile before purification using RP-HPLC with a Jupiter Proteo column (4-pm particle size, 90 A pore size, 250 * 10 mm; Phenomenex) using a watenacetonitrile gradient (0.1% TFA). Peptide masses and purity (>95%) were verified by electrospray ionisation mass spectrometry.
- Circular Dichroism An Applied Photophysics Chirascan was used for CD measurements, with a 200 pL sample in a 1 mm path length CD cell. Protein/DNA samples were suspended in 150 mM potassium phosphate, 150 mM potassium fluoride and 5 mM TCEP at pH 7.4 and were equilibrated for 30 minutes before measurement. For full spectra, three scans between 190 and 260 nm (265-320 nm for DNA binding experiments) were collected with a bandwidth of 1 nm and data sampled at a rate of 0.5 s-1 . These scans were averaged and converted to molar residue ellipticities (MRE).
- MRE molar residue ellipticities
- T m thermal denaturation
- IC50 CD functional activity
- fH helicity
- Table 6 Summary of thermal denaturation, functional activity, and helicity results All N-terminal truncations in the series (2-6) reduced peptide/target binding and antagonism efficacy, indicating that the full length of the acidic extension contributes to antagonism of the c-Jun/TRE interaction ( Figure 18). However, each truncation in the series resulted in an increasingly large effect on the antagonism per residue removed. Inspection of the truncations from 1 to 2, from 2 to 3 and from 3 to 5, representing the three full heptad N-terminal deletions, reveals antagonism decreases of 1 .2-fold, 2- fold and 2.3-fold respectively.
- Peptide 5 was next optimised by incorporating i- i+4 (K-to-D) lactam bridges.
- Lactam bridges can be incorporated through the use of orthogonal-protecting groups (Lys(Mtt) and Asp(O-2-PhiPr)), which can be selectively deprotected (2% trifluoroacetic acid in DCM) and reacted using typical solid phase chemistry while the peptide is still attached to the resin.
- the success of the reaction can be confirmed using mass spectrometry (MS) to observe the decreased mass from the loss of a water molecule, compared with the linear unreacted peptide.
- MS mass spectrometry
- Peptide 11 was therefore the next step in optimisation which utilises the NA20 truncation whilst also truncating at the C-terminus.
- the removal of the four C-terminal residues from 4 to 11 reduced antagonism 1 .8x but further truncation at the C-terminus to produce 25 vastly reduced antagonism 14.8x compared to
- Peptide 11 was considered as a scaffold for further optimisation which has almost half the number of residues compared with 1 whilst retaining a high level of functional activity.
- K-to-D lactam bridges at / to i+4 positions were systematically incorporated at different sites to investigate which regions were most amenable to the helix constraint, and which produced improvements in affinity and inhibition. Again, due to point mutations to accommodate the bridging K and D residues, both linear and cyclised peptides were produced.
- the heterodimer AT m from lactamisation ranges from ⁇ 2°C for 14/15 to ⁇ 9°C for 22/23.
- Table 7 ITC derived thermodynamic parameters c-Jun-peptide interactions. Thermodymanic parameters are presented as an average of two independent experiments with errors given as one one SD.
- Thillet et al. Site-directed mutagenesis of mouse dihydrofolate reductase. Mutants with increased resistance to methotrexate and trimethoprim. J Biol Chem 263, 12500-12508 (1988).
- JNK c-Jun N-terminal Kinase
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Diabetes (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Epidemiology (AREA)
- Psychiatry (AREA)
- Heart & Thoracic Surgery (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Cardiology (AREA)
- Hospice & Palliative Care (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Rheumatology (AREA)
- Physical Education & Sports Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP23710892.3A EP4490176A1 (en) | 2022-03-11 | 2023-03-10 | C-jun antagonist peptides |
| CA3245706A CA3245706A1 (en) | 2022-03-11 | 2023-03-10 | ANTAGONIST PEPTIDES OF C-JUN |
| US18/845,709 US20250188151A1 (en) | 2022-03-11 | 2023-03-10 | C-jun antagonist peptides |
| JP2024553833A JP2025510591A (ja) | 2022-03-11 | 2023-03-10 | c-Junアンタゴニストペプチド |
| CN202380033105.4A CN118984835A (zh) | 2022-03-11 | 2023-03-10 | c-Jun拮抗剂肽 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB2203399.7 | 2022-03-11 | ||
| GBGB2203399.7A GB202203399D0 (en) | 2022-03-11 | 2022-03-11 | c-jun antagonist peptides |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023170302A1 true WO2023170302A1 (en) | 2023-09-14 |
Family
ID=81254979
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2023/056243 Ceased WO2023170302A1 (en) | 2022-03-11 | 2023-03-10 | C-jun antagonist peptides |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20250188151A1 (https=) |
| EP (1) | EP4490176A1 (https=) |
| JP (1) | JP2025510591A (https=) |
| CN (1) | CN118984835A (https=) |
| CA (1) | CA3245706A1 (https=) |
| GB (1) | GB202203399D0 (https=) |
| WO (1) | WO2023170302A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118252913A (zh) * | 2024-02-07 | 2024-06-28 | 中国医学科学院阜外医院 | 多肽偶联物及其在射血分数保留的心衰中的应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5516891A (en) | 1992-06-16 | 1996-05-14 | Kinerton, Ltd. | Liquid phase synthesis of peptides and peptide derivatives |
| WO2006017913A1 (en) * | 2004-08-20 | 2006-02-23 | Phylogica Limited | Peptide inhibitors of c-jun dimerization and uses thereof |
| WO2020128015A2 (en) | 2018-12-20 | 2020-06-25 | The University Of Bath | Screening assay |
| WO2021260074A1 (en) | 2020-06-25 | 2021-12-30 | The University Of Bath | Cross-linking methods |
-
2022
- 2022-03-11 GB GBGB2203399.7A patent/GB202203399D0/en not_active Ceased
-
2023
- 2023-03-10 EP EP23710892.3A patent/EP4490176A1/en active Pending
- 2023-03-10 CA CA3245706A patent/CA3245706A1/en active Pending
- 2023-03-10 US US18/845,709 patent/US20250188151A1/en active Pending
- 2023-03-10 JP JP2024553833A patent/JP2025510591A/ja active Pending
- 2023-03-10 CN CN202380033105.4A patent/CN118984835A/zh active Pending
- 2023-03-10 WO PCT/EP2023/056243 patent/WO2023170302A1/en not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5516891A (en) | 1992-06-16 | 1996-05-14 | Kinerton, Ltd. | Liquid phase synthesis of peptides and peptide derivatives |
| WO2006017913A1 (en) * | 2004-08-20 | 2006-02-23 | Phylogica Limited | Peptide inhibitors of c-jun dimerization and uses thereof |
| WO2020128015A2 (en) | 2018-12-20 | 2020-06-25 | The University Of Bath | Screening assay |
| WO2021260074A1 (en) | 2020-06-25 | 2021-12-30 | The University Of Bath | Cross-linking methods |
Non-Patent Citations (72)
| Title |
|---|
| "Methods in Enzymology", vol. 289, 1997, ACADEMIC PRESS, article "Solid-Phase Peptide Synthesis" |
| "UniProt", Database accession no. P05412 |
| AHN ET AL.: "A dominant-negative inhibitor of CREB reveals that it is a general mediator of stimulus-dependent transcription of c-fos", MOL CELL BIOL, vol. 18, 1998, pages 967 - 977, XP002512819 |
| ALANI ET AL.: "The transactivating domain of the c-Jun proto-oncoprotein is required for cotransformation of rat embryo cells", MOL CELL BIOL, vol. 11, 1991, pages 6286 - 6295 |
| AZZARITO, V: "Inhibition of a-helix-mediated protein-protein interactions using designed molecules", NATURE CHEMISTRY, vol. 5, no. 3, 2013, pages 161 - 173, XP055138191, DOI: 10.1038/nchem.1568 |
| BAXTER D ET AL: "Supporting Information- Exploiting Overlapping Advantages of In Vitro and In Cellulo Selection Systems to Isolate a Novel High-Affinity cJun Antagonist", 20 October 2017 (2017-10-20), XP093052325, Retrieved from the Internet <URL:https://pubs.acs.org/doi/abs/10.1021/acschembio.7b00693> [retrieved on 20230606] * |
| BAXTER DANIEL ET AL: "Exploiting Overlapping Advantages of In Vitro and In Cellulo Selection Systems to Isolate a Novel High-Affinity cJun Antagonist", ACS CHEMICAL BIOLOGY, vol. 12, no. 10, 20 October 2017 (2017-10-20), pages 2579 - 2588, XP093052321, ISSN: 1554-8929, DOI: 10.1021/acschembio.7b00693 * |
| BAXTER ET AL.: "Exploiting Overlapping Advantages of In Vitro and In Cellulo Selection Systems to Isolate a Novel High-Affinity cJun Antagonist", ACS CHEM BIOL, vol. 12, 2017, pages 2579 - 2588 |
| BAXTER ET AL.: "Library construction, selection and modification strategies to generate therapeutic peptide-based modulators of protein-protein interactions", FUTURE MED CHEM, vol. 6, 2014, pages 2073 - 2092 |
| BOYSEN ET AL.: "Role of interfacial hydrophobic residues in the stabilization of the leucine zipper structures of the transcription factors c-Fos and c-Jun", J BIOL CHEM, vol. 277, 2002, pages 23 - 31, XP055724292, DOI: 10.1074/jbc.M104556200 |
| BRENNAN ANDREW ET AL: "Selective antagonism of cJun for cancer therapy", JOURNAL OF EXPERIMENTAL AND CLINICAL CANCER RESEARCH, vol. 39, no. 1, 1 December 2020 (2020-12-01), IT, XP055802224, ISSN: 0392-9078, DOI: 10.1186/s13046-020-01686-9 * |
| BRENNAN ET AL.: "Selective antagonism of cJun for cancer therapy", J EXP CLIN CANCER RES, vol. 39, 2020, pages 184 |
| CABEZAS, E.SATTERTHWAIT, A. C., J. AM. CHEM. SOC., vol. 121, 1999, pages 3862 |
| CHANWHITE: "Fmoc Solid Phase Peptide Synthesis - A Practical Approach.", 2000, OXFORD UNIVERSITY PRESS |
| CHEN ET AL.: "Design of peptide inhibitors that bind the bZIP domain of Epstein-Barr virus protein BZLF1", J MOL BIOL, vol. 408, 2011, pages 304 - 320, XP028196473, DOI: 10.1016/j.jmb.2011.02.046 |
| CODY ET AL.: "Understanding the role of Leu22 variants in methotrexate resistance: comparison of wild-type and Leu22Arg variant mouse and human dihydrofolate reductase ternary crystal complexes with methotrexate and NADPH", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 61, 2005, pages 147 - 155 |
| COIN ET AL., NATURE PROTOCOLS, vol. 2, 2007, pages 3247 - 3256 |
| DE ARAUJO ET AL.: "Comparative a-helicity of cyclic pentapeptides in water", ANGEW CHEM INT ED ENGL, vol. 53, 2014, pages 6965 - 9, XP055778405, DOI: 10.1002/anie.201310245 |
| ECKERT ET AL.: "AP1 transcription factors in epidermal differentiation and skin cancer", J SKIN CANCER, 2013, pages 537028 |
| EFERL ET AL.: "AP-1: a double-edged sword in tumorigenesis", NAT REV CANCER, vol. 3, 2003, pages 859 - 868 |
| FAIRLIE, D. P.DANTAS DE ARAUJO, A.: "Review stapling peptides using cysteine crosslinking", BIOPOLYMERS, vol. 106, no. 6, 2016, pages 843 - 852 |
| FANJUL ET AL.: "A new class of retinoids with selective inhibition of AP-1 inhibits proliferation", NATURE, vol. 372, 1994, pages 107 - 111 |
| FUJIMOTO, K. ET AL.: "Development of a series of cross-linking agents that effectively stabilize alpha-helical structures in various short peptides", CHEMISTRY, vol. 14, no. 3, 2008, pages 857 - 63 |
| G. A. GRANT: "Applied Biosystems 430A User's Manual", 1992, ABI INC. |
| GLOVER, J.N.S.C. HARRISON: "Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA", NATURE, vol. 373, no. 6511, 1995, pages 257 - 61, XP002924574, DOI: 10.1038/373257a0 |
| HANEY, C.M. ET AL.: "Promoting peptide a-helix formation with dynamic covalent oxime side-chain cross-links", CHEM COMMUN CAMB, vol. 47, no. 39, 2011, pages 10915 - 7 |
| HEITZ ET AL.: "Twenty years of cell-penetrating peptides: from molecular mechanisms to therapeutics", BR J PHARMACOL, vol. 157, no. 2, 2009, pages 195 - 206 |
| HOLLAND-NELL, K.; MELDAL, M: " Maintaining biological activity by using triazoles as disulfide bond mimetics", ANGEW CHEM INT ED ENGL., vol. 50, no. 22, 2011, pages 5204 - 6, XP055454226, DOI: 10.1002/anie.201005846 |
| JAIN ET AL.: "A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation", SCI REP, vol. 7, 2017, pages 14343 |
| JO, H: "Development of a-helical calpain probes by mimicking a natural protein-protein interaction", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 134, no. 42, 2012, pages 17704 - 17713, XP055138213, DOI: 10.1021/ja307599z |
| JOCHIM, A. L.ARORA, P. S.: "Systematic analysis of helical protein interfaces reveals targets for synthetic inhibitors", ACS CHEMICAL BIOLOGY, vol. 5, no. 10, 2010, pages 919 - 923 |
| JOHN, R. ET AL.: "DNA binding of Jun and Fos bZip domains: homodimers and heterodimers induce a DNA conformational change in solution", NUCLEIC ACIDS RES, vol. 24, 1996, pages 4487 - 4494 |
| KAPLAN ET AL.: "Increasing the affinity of selective bZIP-binding peptides through surface residue redesign", PROTEIN SCI, vol. 23, 2014, pages 940 - 953 |
| KOWALCZYK ET AL.: "Peptide Lipidation - A Synthetic Strategy to Afford Peptide Based Therapeutics", PEPTIDES AND PEPTIDE-BASED BIOMATERIALS AND THEIR BIOMEDICAL APPLICATIONS, vol. 1030, 2017, pages 185 - 227, XP055886047, DOI: 10.1007/978-3-319-66095-0_9 |
| LAMBERT S. A. ET AL.: "The Human Transcription Factors", CELL, vol. 175, 2018, pages 598 - 599 |
| LATHBRIDGE ET AL.: "Computational Competitive and Negative Design To Derive a Specific cJun Antagonist", BIOCHEMISTRY, vol. 57, 2018, pages 6108 - 6118, XP055802561, DOI: 10.1021/acs.biochem.8b00782 |
| LEDUC, A.M. ET AL.: "Helix-stabilized cyclic peptides as selective inhibitors of steroid receptor- coactivator interactions", PROC NATL ACAD SCI USA., vol. 100, no. 20, 2003, pages 11273 - 8, XP055003552, DOI: 10.1073/pnas.1934759100 |
| LEE T. I.YOUNG R. A.: "Transcriptional regulation and its misregulation in disease", CELL, vol. 152, 2013, pages 1237 - 1251, XP029001372, DOI: 10.1016/j.cell.2013.02.014 |
| MASON ET AL.: "Improved stability of the Jun-Fos Activator Protein-1 coiled coil motif: A stopped-flow circular dichroism kinetic analysis", J BIOL CHEM, vol. 282, no. 32, 2007, pages 23015 - 24 |
| MASON ET AL.: "Semirational design of Jun-Fos coiled coils with increased affinity: Universal implications for leucine zipper prediction and design", PROC NATL ACAD SCI USA, vol. 103, 2006, pages 8989 - 8994, XP055503842, DOI: 10.1073/pnas.0509880103 |
| MATTHEWS ET AL.: "Dihydrofolate reductase. The stereochemistry of inhibitor selectivity", J BIOL CHEM, vol. 260, 1985, pages 392 - 399, XP000952830 |
| MERRIFIELD, J. AMER. CHEM. SOC., vol. 85, 1963, pages 2149 - 54 |
| MUNOZ ET AL.: "Elucidating the folding problem of helical peptides using empirical parameters", NAT STRUCT BIOL, vol. 1, 1994, pages 399 - 409, XP008042892, DOI: 10.1038/nsb0694-399 |
| MUPPIDI, A. ET AL.: "Achieving cell penetration with distance-matching cysteine cross-linkers: a facile route to cell-permeable peptide dual inhibitors of Mdm2/Mdmx", CHEM COMMUN (CAMB, vol. 47, no. 33, 2011, pages 9396 - 8, XP055137829, DOI: 10.1039/c1cc13320a |
| NIKOLAEV YAROSLAV ET AL: "The Leucine Zipper Domains of the Transcription Factors GCN4 and c-Jun Have Ribonuclease Activity", PLOS ONE, vol. 5, no. 5, 21 May 2010 (2010-05-21), pages e10765, XP093051961, DOI: 10.1371/journal.pone.0010765 * |
| OLIVE ET AL.: "A dominant negative to activation protein-1 (AP1) that abolishes DNA binding and inhibits oncogenesis", J BIOL CHEM, vol. 272, 1997, pages 18586 - 18594, XP055802889, DOI: 10.1074/jbc.272.30.18586 |
| PACE ET AL.: "A helix propensity scale based on experimental studies of peptides and proteins", BIOPHYS J, vol. 75, no. 1, 1998, pages 422 - 7 |
| PERRY, SAMUEL R ET AL.: "Contiguous hydrophobic and charged surface patches in short helix-constrained peptides drive cell permeability.", ORGANIC & BIOMOLECULAR CHEMISTRY, vol. 16, no. 3, 2018, pages 367 - 371, XP055644201, DOI: 10.1039/C7OB02952G |
| R. L. DAI: "Novel DNA bis-intercalation by MLN944, a potent clinical bisphenazine anticancer drug", J BIOL CHEM, vol. 279, 2004, pages 46096 - 46103, XP055802565, DOI: 10.1074/jbc.M404053200 |
| RAJ, M.BULLOCK, B. N.ARORA, P. S.: "Plucking the high hanging fruit: a systematic approach for targeting protein-protein interactions", BIOORGANIC & MEDICINAL CHEMISTRY, vol. 21, no. 14, 2013, pages 4051 - 4057, XP028595034, DOI: 10.1016/j.bmc.2012.11.023 |
| RISSE ET AL.: "Asymmetrical recognition of the palindromic AP1 binding site (TRE) by Fos protein complexes", EMBO J, vol. 8, 1989, pages 3825 - 3832 |
| ROBERTSON, N. S.SPRING, D. R.: "Using Peptidomimetics and Constrained Peptides as Valuable Tools for Inhibiting Protein-Protein Interactions", MOLECULES (BASEL, SWITZERLAND), vol. 23, no. 4, 2018, pages 959, XP055719879, DOI: 10.3390/molecules23040959 |
| RODRIGUEZ-MARTINEZ ET AL.: "Combinatorial bZIP dimers display complex DNA-binding specificity landscapes", ELIFE, vol. 6, 2017, pages e19272 |
| RUAN, F. ET AL.: "Metal ion-enhanced helicity in synthetic peptides containing unnatural, metal- ligating residues", J. AM. CHEM. SOC., vol. 112, no. 25, 1990, pages 9403 - 9404, XP002212076, DOI: 10.1021/ja00181a058 |
| SALI, D.M. BYCROFTA.R. FERSHT: "Stabilization of protein structure by interaction of alpha-helix dipole with a charged side chain", NATURE, vol. 335, no. 6192, 1988, pages 740 - 3 |
| SELDEEN ET AL.: "Energetic coupling along an allosteric communication channel drives the binding of Jun-Fos heterodimeric transcription factor to DNA", FEBS J, vol. 278, 2011, pages 2090 - 2104 |
| SELDEEN ET AL.: "Evidence that the bZIP domains of the Jun transcription factor bind to DNA as monomers prior to folding and homodimerization", ARCH BIOCHEM BIOPHYS, vol. 480, 2008, pages 75 - 84, XP025670228, DOI: 10.1016/j.abb.2008.10.010 |
| SHAULIAN ET AL., ONCOGENE, vol. 20, 2001, pages 2390 - 2400 |
| SHIOZAWA, S.K. TSUMIYAMA: "Pathogenesis of rheumatoid arthritis and c-Fos/AP-1", CELL CYCLE, vol. 8, no. 10, 2009, pages 1539 - 43 |
| SMITH, BETSY A ET AL.: "Minimally cationic cell-permeable miniature proteins via alpha-helical arginine display.", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 130, no. 10, 2008, pages 2948 - 9, XP002498264, DOI: 10.1021/ja800074v |
| STAWIKOWSKI, CURR PROTOC PROTEIN SCI. 2002, 2002 |
| STEWART, J. M.YOUNG, J. D.: "The Practice of Peptide Synthesis", 1984, PIERCE CHEMICAL CO. |
| SZALΔKI ET AL.: "Evidence for Homodimerization of the c-Fos Transcription Factor in Live Cells Revealed by Fluorescence Microscopy and Computer Modeling", CELL BIOL, vol. 35, 2015, pages 3785 - 3798 |
| THILLET ET AL.: "Site-directed mutagenesis of mouse dihydrofolate reductase. Mutants with increased resistance to methotrexate and trimethoprim", J BIOL CHEM, vol. 263, 1988, pages 12500 - 12508 |
| TIMMERMAN ET AL.: "Rapid and quantitative cyclization of multiple peptide loops onto synthetic scaffolds for structural mimicry of protein surfaces", CHEMBIOCHEM : A EUROPEAN JOURNAL OF CHEMICAL BIOLOGY, vol. 6, no. 5, 2005, pages 821 - 824, XP072140375, DOI: 10.1002/cbic.200400374 |
| TSUCHIDA ET AL.: "Design, synthesis, and biological evaluation of new cyclic disulfide decapeptides that inhibit the binding of AP-1 to DNA", J MED CHEM, vol. 47, 2004, pages 4239 - 4246, XP002390592, DOI: 10.1021/jm049890+ |
| TYNDALL ET AL.: "Proteases universally recognize beta strands in their active sites", CHEM REV, vol. 105, no. 3, 2005, pages 973 - 99 |
| WALENSKY, L.D. ET AL.: "Activation of apoptosis in vivo by a hydrocarbon-stapled BH3 helix", SCIENCE, vol. 205, no. 5689, 2004, pages 1466 - 70, XP002555229, DOI: 10.1126/science.1099191 |
| WANG, D. ET AL.: "Enhanced metabolic stability and protein-binding properties of artificial alpha helices derived from a hydrogen-bond surrogate: application to Bcl-xL", ANGEW CHEM INT ED ENGL., vol. 44, no. 40, 2005, pages 6525 - 9, XP055221460, DOI: 10.1002/anie.200501603 |
| WISEMAN, T. ET AL.: "Rapid measurement of binding constants and heats of binding using a new titration calorimeter", ANAL BIOCHEM, vol. 179, no. 1, 1989, pages 131 - 7, XP024816985, DOI: 10.1016/0003-2697(89)90213-3 |
| WORRALL, J. M. MASON: "Thermodynamic analysis of Jun-Fos coiled coil peptide antagonists", FEBS J, vol. 278, 2011, pages 663 - 672 |
| YUNG ET AL.: "Role of c-Jun N-terminal Kinase (JNK) in Obesity and Type 2 Diabetes", CELLS, vol. 9, no. 3, 2020 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118252913A (zh) * | 2024-02-07 | 2024-06-28 | 中国医学科学院阜外医院 | 多肽偶联物及其在射血分数保留的心衰中的应用 |
| WO2025167587A1 (zh) * | 2024-02-07 | 2025-08-14 | 中国医学科学院阜外医院 | 多肽偶联物及其在射血分数保留的心衰中的应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3245706A1 (en) | 2023-09-14 |
| US20250188151A1 (en) | 2025-06-12 |
| GB202203399D0 (en) | 2022-04-27 |
| CN118984835A (zh) | 2024-11-19 |
| JP2025510591A (ja) | 2025-04-15 |
| EP4490176A1 (en) | 2025-01-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11912794B2 (en) | Modulation of structured polypeptide specificity | |
| US11753444B2 (en) | Modulation of structured polypeptide specificity | |
| US12570698B2 (en) | Stabilized peptides for covalent binding to target protein | |
| US20250188151A1 (en) | C-jun antagonist peptides | |
| EP2697249B1 (en) | Compounds binding to the bacterial beta ring | |
| Rathman | Design and Synthesis of Biologically Relevant N-Aminated Macrocyclic Peptidomimetics | |
| WO2026085280A1 (en) | Cell-penetrating peptides with enhanced solubility | |
| Werner | Structural and Functional Impacts of Chemical Modifications in Peptides and Small Proteins | |
| HK1252864B (en) | Modulation of structured polypeptide specificity | |
| Liu | Development of cyclic peptidyl ligands through a combinatorial library approach | |
| NZ623518B2 (en) | Modulation of structured polypeptide specificity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23710892 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024553833 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380033105.4 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023710892 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023710892 Country of ref document: EP Effective date: 20241011 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18845709 Country of ref document: US |