WO2023168520A1 - Preventing/treating pseudomonas aeruginosa infection - Google Patents

Preventing/treating pseudomonas aeruginosa infection Download PDF

Info

Publication number
WO2023168520A1
WO2023168520A1 PCT/CA2023/050297 CA2023050297W WO2023168520A1 WO 2023168520 A1 WO2023168520 A1 WO 2023168520A1 CA 2023050297 W CA2023050297 W CA 2023050297W WO 2023168520 A1 WO2023168520 A1 WO 2023168520A1
Authority
WO
WIPO (PCT)
Prior art keywords
methyl
rhamnopyranoside
seq
compound
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2023/050297
Other languages
English (en)
French (fr)
Inventor
Andrew David Cox
Evguenii Vinogradov
Janelle SAUVAGEAU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Research Council of Canada
Original Assignee
National Research Council of Canada
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National Research Council of Canada filed Critical National Research Council of Canada
Priority to EP23765629.3A priority Critical patent/EP4490181A1/en
Priority to AU2023232838A priority patent/AU2023232838A1/en
Priority to JP2024553416A priority patent/JP2025509292A/ja
Priority to CA3254311A priority patent/CA3254311A1/en
Priority to CN202380036901.3A priority patent/CN119095871A/zh
Priority to US18/841,818 priority patent/US20250161428A1/en
Priority to IL315298A priority patent/IL315298A/en
Priority to KR1020247033164A priority patent/KR20240161137A/ko
Publication of WO2023168520A1 publication Critical patent/WO2023168520A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/104Pseudomonadales, e.g. Pseudomonas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H15/00Compounds containing hydrocarbon or substituted hydrocarbon radicals directly attached to hetero atoms of saccharide radicals
    • C07H15/02Acyclic radicals, not substituted by cyclic structures
    • C07H15/04Acyclic radicals, not substituted by cyclic structures attached to an oxygen atom of the saccharide radical
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6415Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/643Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H1/00Processes for the preparation of sugar derivatives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H3/00Compounds containing only hydrogen atoms and saccharide radicals having only carbon, hydrogen, and oxygen atoms
    • C07H3/06Oligosaccharides, i.e. having three to five saccharide radicals attached to each other by glycosidic linkages
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/21Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/235Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bordetella (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/24Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • C07K14/245Escherichia (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/33Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/34Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Corynebacterium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76Albumins
    • C07K14/765Serum albumin, e.g. HSA
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/1214Pseudomonadaceae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/52Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/005Glycopeptides, glycoproteins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56911Bacteria
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6037Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/195Assays involving biological materials from specific organisms or of a specific nature from bacteria
    • G01N2333/21Assays involving biological materials from specific organisms or of a specific nature from bacteria from Pseudomonadaceae (F)

Definitions

  • the present disclosure relates to the identification and synthesis of novel methylated rhamnose containing glycans, protein-glycan conjugates and their use as antigens and vaccines. Also disclosed are antibodies that selectively bind said glycans and glycoconjugates. Uses of these glycans, glycoconjugates, corresponding compositions, and antibodies in the treatment and prevention of Pseudomonas aeruginosa infections are discussed.
  • BACKGROUND [0002] In recent years, large pharmaceutical companies have moved away from antibiotic research due in part to the high risks and costs related to development compared to the potential rewards [1].
  • the bi-specific antibody approach of Medimmune was not pursued beyond their phase 1 trail [12]; however the potential of a DNA encoded mAb therapy (DMab) showed promise and may alleviate the high cost of direct mAb therapeutics [13]. These studies suggest that antibodies against P. aeruginosa may have therapeutic applications.
  • DMab DNA encoded mAb therapy
  • SUMMARY OF THE INVENTION The present disclosure relates generally to compounds and compositions and vaccines comprising a novel isolated or synthesised Pseudomonas aeruginosa glycan antigen, optionally linked to a carrier protein in the form of a glycoconjugate.
  • the present invention provides an antigenic compound comprising the oligosaccharide moiety of Formula A: ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe) n - Formula A wherein n is 1-5, preferably 2-4, and wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or -OH.
  • the present invention provides an antigenic compound comprising the oligosaccharide moiety of Formula A1: ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe) n -X Formula A1 wherein n is 1-5 (preferably 2-4), and X is –H or -(4 ⁇ -Man3OMe)m-handle; and m is 0, 1, or 2, preferably 0 or 1; wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or –OH.
  • the present invention provides an antigenic compound, wherein the handle is –(CH2)zNH2 or 2-glyceraldehyde, where z is an integer selected from the group consisting of 1-5.
  • the handle is –(CH2) 2 NH 2, –(CH2) 3 NH 2 , or –(CH2) 3 NH 2 , when m is 0.
  • the handle is 2-glyceraldehyde.
  • the present invention provides an antigenic compound, selected from the group consisting of: ⁇ -D-Rha3OMe-4-( ⁇ –D-Rha3OMe-4)4-4- ⁇ –D-Man3OMe-2-glyceraldehyde-1d (OS2); 3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside- (1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D- rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D- rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ - ⁇ -rhamnopyranose (pentasaccharide); 3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside- (1 ⁇ 4)
  • the present invention provides and antigenic compound comprising a linker for linkage to a carrier protein, and having Formula A2: ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe)n-X-Linker Formula A2 wherein n is 1-5, and X is -(4 ⁇ -Man3OMe) m -(handle) p -; wherein m is 0, 1, or 2, preferably 0 or 1; and p is 0 or 1; and wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or –OH [0012] In one aspect, the present invention provides an antigenic compound comprising a conjugate of the antigenic compound conjugated to a carrier protein.
  • said conjugate has the following formula ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe)n-X-(Linker)q-Carrier Protein Formula A3 3 wherein n is 1-5 (preferably 2-4), and X is -(4 ⁇ -Man3OMe)m-(handle)p-; wherein m is 0, 1, or 2, preferably 0 or 1; and p is 0 or 1; and q is 0 or 1; and wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or –OH.
  • the carrier protein comprises CRM197, tetanus toxoid (TT), a Pseudomonas aeruginosa protein, human serum albumin (HSA), bovine serum albumin (BSA), diphtheria toxin fragment B (DTFB), DTFB C8, Diphtheria toxoid (DT), fragment C of TT, pertussis toxoid, cholera toxoid, E. coli LT, E. coli ST, or exotoxin A from Pseudomonas aeruginosa.
  • the carrier protein is CRM197, TT, or a Pseudomonas aeruginosa protein.
  • the present invention provides a pharmaceutical composition comprising the compound or the conjugate described herein; and a pharmaceutically acceptable diluent, carrier, or excipient.
  • said pharmaceutical composition is a vaccine.
  • the present invention provides a method of raising an immune response in a subject, comprising administering to the subject: the compound, the conjugate, or the pharmaceutical composition described herein.
  • the present invention provides a method of preventing a P. aeruginosa infection in a subject, the method comprising administering to the subject: the compound, the conjugate, or the pharmaceutical composition described herein.
  • the present invention provides the compound, the conjugate, the vaccine, or the pharmaceutical composition, for use in preventing a P. aeruginosa infection.
  • the present invention provides an antibody, or an antigen binding fragment thereof, that selectively binds to the compound or the conjugate described herein, LPS of P. aeruginosa, and/or a cell of P. aeruginosa, wherein optionally the antibody or antigen binding fragment thereof is a monoclonal antibody or antigen binding fragment thereof.
  • the present invention provides an antibody, or an antigen binding fragment thereof, that selectively binds to an isolated oxidized A-band terminal epitope antigen (OS2), wherein optionally the antibody or antigen binding fragment thereof is a monoclonal antibody or antigen binding fragment thereof.
  • OS2 oxidized A-band terminal epitope antigen
  • the present invention provides an antibody or antigen binding fragment thereof described herein, which is a chimeric or humanized antibody.
  • the present invention provides an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable domain comprising a variable heavy chain CDR1, a variable heavy chain CDR2, and a variable heavy chain CDR3, 4 ⁇ wherein the variable heavy chain CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 10, and SEQ ID NO: 19; ⁇ wherein the variable heavy chain CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 11, and SEQ ID NO: 20; and ⁇ wherein the variable heavy chain CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 12, and SEQ ID NO: 21.
  • the present invention provides an antibody or antigen binding fragment thereof, comprising a light chain variable domain comprising a variable light chain CDR1, a variable light chain CDR2, and a variable light chain CDR3, ⁇ wherein the variable light chain CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 15, and SEQ ID NO: 24; ⁇ wherein the variable light chain CDR2 comprises an amino acid sequence selected from the group consisting of GTS, and RVS; and ⁇ wherein the variable light chain CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 16, and SEQ ID NO: 25.
  • the present invention provides an antibody or antigen binding fragment thereof, comprising a combination of a heavy chain variable domain (VH) and light chain variable domain (VL), wherein the combination is selected from the group consisting of: ⁇ a VH comprising the amino acid sequence of SEQ ID NO:4 and a VL comprising the amino acid sequence SEQ ID NO: 8; ⁇ a VH comprising the amino acid sequence of SEQ ID NO: 13 and a VL comprising the amino acid sequence SEQ ID NO: 17; and ⁇ a VH comprising the amino acid sequence of SEQ ID NO: 22 and a VL comprising the amino acid sequence SEQ ID NO: 26.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • the present invention provides the antibody or antigen binding fragment thereof, for use in the treatment of a P. aeruginosa infection.
  • the present invention provides the antibody or antigen binding fragment thereof, for use in the diagnosis of a P. aeruginosa infection.
  • the present invention provides a method for treating a P. aeruginosa bacterial infection in an animal, comprising administering the antibody or antigen binding fragment thereof described herein to the animal. 5 [0028]
  • the present invention provides a method for the diagnosis of a P.
  • the present invention provides a synthetic process to produce the compound of Formula A1, wherein m is 0, said process comprising : ⁇ anomeric deprotection of a 3-O-methylated rhamnopyranoside to form a 3-O- methylated rhamnopyranose; ⁇ acetylating the 3-O-methylated rhamnopyranose to form an acetylated 3-O- methylated rhamnopyranoside; ⁇ partially deprotecting O-4 of the acetylated 3-O-methylated rhamnopyranoside to form a deprotected acetylated 3-O-methylated rhamnopyranoside; ⁇ coupling the O-4 deprotected acetylated 3-O-methylated rhamn
  • the present invention provides a synthetic process to produce the compound of Formula A1, wherein X is a handle, said process comprising the following steps: ⁇ glycosylating an activated O-3 methylated rhamnopyranoside intermediate at 1-O with a handle comprising a protected amine, wherein the activated monorhamnopyranoside intermediate comprises a protecting group at glycosylation site 4-O, and forming a protected 1-O glycosidic intermediate; ⁇ removing the protecting group from 4-O and forming a deprotected 1-O glycosidic intermediate; ⁇ coupling the deprotected 1-O glycosidic intermediate to an activated O-3 methylated rhamnopyranoside intermediate, wherein the activated rhamnopyranoside intermediate comprises a protecting group at 4-O, and forming a protected methylated disaccharide, trisaccharide, tetrasaccharide or pentasaccharide; and ⁇ removing all protecting
  • Fig.1 shows structures of some of the isolated compounds described herein.
  • Fig. 2 shows 1 H NMR spectra of the band-A polysaccharide obtained from the LPS by alkaline treatment (lower trace), and its NaIO 4 oxidation product OS 1 (upper trace). * marks impurities, R- rhamnose H-1 from the rhamnan repeating units, Rm - anomeric signals of 3- OMe-Rha.
  • Fig. 3 shows overlap of the gCOSY (70% grey), TOCSY (50% grey) and ROESY (black) spectra of the A-PS, isolated from P.
  • Fig.4 shows positive ion mode ESI-MS spectrum of the OS 1. Two peaks labelled at m/z 1117.8 and 1122.6 correspond to ammonium and sodium adducts of Rha5Man1Tetritol- 1d 1 Me 6. [0035] Figs. 5A and 5B show 1 H-NMR spectrum of L-monosaccharide (Fig. 5A) and D- monosaccharide (Fig.5B) recorded in CD3OD. [0036] Fig.6 shows GC-MS traces of derived octyl glycosides of OS1 and standards.
  • Fig. 7 shows the structure of the Pseudomonas aeruginosa A-band 3-O-methyl D rhamnose pentasaccharide tip linked to 3-O-methyl D-mannose and glyceraldehyde prior to conjugation to CRIM.
  • Figs. 8A, 8B, 8C, and 8D show MALDI-MS analyses of BSA (Fig. 8A), BSA-3-O- methyl rhamnan conjugate (Fig. 8B), CRM (Fig. 8C), and CRM-3-O-methyl rhamnan conjugate (Fig.8D).
  • Figs.9A and 9B show ELISA titrations of D56 serum from mice (M1-M6) immunised with CRM-3-O-methyl rhamnan conjugate, upper curves vs. BSA-3-O-methyl rhamnan conjugate and lower curves vs PAO1 wt LPS with IgM antibodies left and IgG antibodies right (Fig. 9A) or D72 serum from rabbits (R1-R2) immunised with CRM-3-O-methyl rhamnan conjugate vs. PAO1 wt LPS left and vs. BSA-3-O-methyl rhamnan conjugate right (Fig.9B). [0040] Fig.
  • FIG. 10 shows ELISA analysis of binding of 1B1, 3B8 and 3C4 mAb-containing hybridoma supernatant (used neat) to purified LPS antigens of P. aeruginosa strains PAO1wt, PAO1 (wzy ::Gm)( ⁇ pa5457) and PAO1 (wzy ::Gm)( ⁇ pa5458).
  • Figs. 11A, 11B, and 11C show ELISA analysis of binding of 1B1 (Fig. 11A), 3B8 (Fig. 11B), and 3C4 (Fig. 11C) purified monoclonal antibodies (mAbs) (all at 100 ⁇ g/ml) to killed whole cells of P.
  • Fig. 12 shows ELISA analysis of binding of 3C4 (panel a), 3B8 (panel b) and 1B1 (panel c) purified mAbs (all at 100 ⁇ g ml -1 ) to killed whole cells of clinical isolates of P. aeruginosa strains NRCC #’s 6678, 6944-53 (see Table 1 for full details of strains).
  • Figs.13A and 13B show opsonophagocytic assay titration curves of mAbs 1B1 (solid line), 3B8 (dashed line) and 3C4 (dotted line) against P. aeruginosa strain PAO1 BAA-47 (Fig. 13A) and P. aeruginosa strain 537 (Fig.13B).
  • Fig.14A shows competition ELISAs between mAbs 1B1 and 3C4 for purified PAO1 LPS.
  • mAb 1B1 was titered at the dilution shown on the x-axis onto an ELISA plate coated with PAO1 LPS.
  • Fig.14B shows competition ELISAs between mAbs 3B8 and 3C4 for purified PAO1 LPS. mAb 3B8 was titered at the concentrations shown on the x-axis onto an ELISA plate coated with PAO1 LPS.
  • Figs.15A, 15B, and 15C show inhibition ELISAs of mAbs 1B1 (Fig.15A), 3C4 (Fig. 15B) and 3B8 (Fig. 15C) with LPS (left hand panels; square markers – P. aeruginosa PAO1 BAA-47, inverted triangle markers – P.
  • aeruginosa (wzy ::Gm)( ⁇ pa5458), diamond markers – N. meningitidis galE/lpt3 and circular markers – PBS control) or synthetic oligosaccharides representing the terminal methylated rhamnan (right hand panels; solid circle markers – pentasaccharide, open square markers – tetrasaccharide, open circle markers- trisaccharide, inverted triangle markers – disaccharide, diamond markers – disaccharide with linker, triangle markers – L-monomer, solid square markers – D-monomer) against P. aeruginosa PAO1 BAA-47 LPS.
  • meningitidis galE/lpt3 and circle markers – PBS control or synthetic oligosaccharides representing the terminal methylated rhamnan (right hand panels; solid circle markers – pentasaccharide, open square markers – tetrasaccharide, open circle markers- trisaccharide, inverted triangle markers – disaccharide, diamond markers – disaccharide with linker, triangle markers – L-monomer, blue – D-monomer) against P. aeruginosa PAO1 BAA-47 whole cells. Serial dilution, as shown on the x-axis, of either LPS or synthetic oligosaccharide was combined at an equal volume with 10 ⁇ g/ml mAb.
  • Fig. 16 provides SPR sensorgrams showing binding of synthetic oligosaccharides to a high density 1B1 IgM surface. Various concentration ranges of synthetic oligosaccharides (see Experimental) were flowed over IgM 1B1 and an irrelevant IgM, Fn 4F1. Kinetics and affinities are reported in Table 5.
  • Mcat lgt2/4 control oligosaccharide.
  • Fig.17 shows an 1 H NMR spectrum for compound disaccharide (600 MHz, CD 3 OD).
  • Fig. 18 shows an 1 H NMR spectrum for compound trisaccharide (500 MHz, CD 3 OD).
  • Fig. 19 shows an 1 H NMR spectrum for compound tetrasaccharide (500 MHz, CD 3 OD).
  • Fig. 20 shows an 1 H NMR spectrum for compound pentasaccharide (600 MHz, CD 3 OD).
  • Fig.21 shows an 1 H NMR spectrum for compound disaccharide (600 MHz, D2O).
  • Fig.22 shows a reaction scheme for synthesis of D-monosaccharide (Scheme 1).
  • Fig.23 shows a reaction scheme for synthesis of L-monosaccharide (Scheme 2).
  • Fig. 24 shows a reaction scheme for synthesis of 3-O-methyl ⁇ -rhamnose oligosaccharides (Scheme 3).
  • Fig. 25 shows a reaction scheme for addition of an aminoethyl handle to the disaccharide (Scheme 4).
  • Fig.26A shows SDS-PAGE (left) and Fig.
  • FIG. 26B Western blot (with mAb 1B1; right) analyses of HSA (lane 2) and HSA--3-O-methyl rhamnan pentasaccharide conjugate (two 9 concentrations lanes 3 & 4). Molecular weight markers are shown in lane 1.
  • Fig. 27 shows MALDI-MS analyses of a) HSA, b) HSA-3-O-methyl rhamnan pentasaccharide conjugate.
  • Figs. 28A, 28B, 28C, 28D, 28E, 28F, 28G, and 28H show ELISAs using mice sera from synthetic conjugate immunisation for ability to recognise P.
  • Fig. 29 shows ELISAs of synthetic oligosaccharide conjugate-derived antisera vs. killed whole cells.
  • Fig.30 shows a reaction scheme for the synthesis of tri-, tetra-, and penta- saccharides including a handle and optionally a linker.
  • Fig. 29 shows ELISAs of synthetic oligosaccharide conjugate-derived antisera vs. killed whole cells.
  • Fig.30 shows a reaction scheme for the synthesis of tri-, tetra-, and penta- saccharides including a handle and optionally a linker.
  • 31A shows NMR of 3-O-Methyl- ⁇ - ⁇ -rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ - ⁇ -rhamnopyranoside-(1 ⁇ 4)-2-(2,2-dimethoxybutylcarbonyl)amino]ethyl 3-O-methyl- ⁇ - ⁇ - rhamnopyranoside (S22), 1 H NMR, 600MHz, CD3OD. [0064] Fig.
  • 31B shows NMR of 3-O-Methyl- ⁇ - ⁇ -rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ - ⁇ -rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ - ⁇ -rhamnopyranoside-(1 ⁇ 4)-2-(2,2- dimethoxybutylcarbonyl)amino]ethyl 3-O-methyl- ⁇ - ⁇ -rhamnopyranoside (S23), 1 H NMR, 600MHz, CD 3 OD. [0065] Fig.
  • aeruginosa PAO1 BAA-47 (wt); N. meningitidis galE/lpt3; PBS control) or synthetic oligosaccharides with linker representing the terminal methylated rhamnan (right-hand graph; pentasaccharide; tetrasaccharide; trisaccharide; against P. aeruginosa PAO1 BAA-47 (wt) LPS. Serial dilution, as shown on the x axis. [0067] Fig. 34A.
  • mice MRha3V 1-5 will receive the trisaccharide CRM conjugate
  • mice MRha4V 6-10 will receive the tetrasaccharide 10 CRM conjugate
  • mice MRha5V 11-15 will receive the pentasaccharide CRM conjugate.
  • Fig. 35A ELISA determined recognition with final bleed mice sera IgM titration following CRM-oligosaccharide conjugate immunisation vs BSA-trisaccharide conjugates.
  • Mice MRha3V 1-5 received the trisaccharide CRM conjugate
  • mice MRha4V 6-10 received the tetrasaccharide CRM conjugate
  • mice MRha5V 11-15 received the pentasaccharide CRM conjugate.
  • Fig. 35B ELISA determined recognition with final bleed mice sera IgM titration following CRM-oligosaccharide conjugate immunisation vs BSA-tetrasaccharide conjugates. Mice MRha3V 1-5 received the trisaccharide CRM conjugate, mice MRha4V 6-10 received the tetrasaccharide CRM conjugate and mice MRha5V 11-15 received the pentasaccharide CRM conjugate. [0071] Fig. 35C. ELISA determined recognition with final bleed mice sera IgM titration following CRM-oligosaccharide conjugate immunisation vs BSA-pentasaccharide conjugates.
  • mice MRha3V 1-5 received the trisaccharide CRM conjugate
  • mice MRha4V 6-10 received the tetrasaccharide CRM conjugate
  • mice MRha5V 11-15 received the pentasaccharide CRM conjugate.
  • Fig. 35D ELISA determined recognition with final bleed mice sera IgM titration following CRM-oligosaccharide conjugate immunisation vs LPS.
  • Fig. 36A ELISA determined recognition with final bleed mice sera IgM titration following CRM-oligosaccharide conjugate immunisation vs LPS.
  • mice MRha3V 1-5 received the trisaccharide CRM conjugate
  • mice MRha4V 6-10 received the t
  • mice MRha3V 1-5 will receive the trisaccharide CRM conjugate
  • mice MRha4V 6-10 will receive the tetrasaccharide CRM conjugate
  • mice MRha5V 11-15 will receive the pentasaccharide CRM conjugate.
  • Fig. 37A ELISA determined recognition with final bleed mice sera IgG (1:20 dilution) following CRM-oligosaccharide conjugate immunisation vs BSA-oligosaccharides and Pa wt LPS as indicated.
  • mice MRha3V 1-5 received the trisaccharide CRM conjugate
  • mice MRha4V 6-10 received the tetrasaccharide CRM conjugate
  • mice MRha5V 11-15 received the pentasaccharide CRM conjugate.
  • Pre-immune sera was included as a 11 negative control and mAb 3C4 (isotype IgG2b) was included as a positive control for Pa wt LPS.
  • ELISA determined recognition with pooled pre- and final bleed mice sera IgG (1:40 dilution) following CRM-oligosaccharide conjugate immunisation vs Pa wt, Pa wzy5457, Pa wzy5458 and Nm wt (negative control) LPS as indicated.
  • Mice MRha3V 1-5 received the trisaccharide CRM conjugate
  • mice MRha4V 6-10 received the tetrasaccharide CRM conjugate
  • mice MRha5V 11-15 received the pentasaccharide CRM conjugate.
  • Pre- immune sera (Pre) was included as a negative control. [0077] Fig.38A.
  • ELISA determined recognition with pre- and post-immune (D70) rabbit sera titration prior to and following CRM-oligosaccharide conjugate immunisation vs Pa wt, Pa wzy5457 and Pa wzy5458 LPS.
  • Rabbits RRha3V 1-2 received the trisaccharide CRM conjugate
  • rabbits RRha4V 3-4 received the tetrasaccharide CRM conjugate
  • rabbits RRha5V 5-6 received the pentasaccharide CRM conjugate.
  • Fig.39A ELISA analysis of binding of pooled mice sera pre- and post-immune (IgM and IgG all at 1:40 dilution) to killed whole cells of P.
  • aeruginosa strains NRCC #’s 6678, 6667-70, 6954-60 and negative control strain M. catarrhalis 6541 see Table 7 for full details of strains.
  • Fig. 39B ELISA analysis of binding of individual rabbit sera pre- and post-immune (all at 1:1500 dilution) to killed whole cells of P. aeruginosa strains NRCC #’s 6678, 6667-70, 6954-60 and negative control strain M. catarrhalis 6541 (see Table 7 for full details of strains).
  • Fig.39C ELISA analysis of binding of individual rabbit sera pre- and post-immune (all at 1:1500 dilution) to killed whole cells of P. aeruginosa strains NRCC #’s 6678, 6667-70, 6954-60 and negative control strain M. catarrhalis 6541 (see Table 7 for full details of strains).
  • Fig.39C ELISA analysis of binding of individual
  • the present invention is based, in part, on the identification of novel P. aeruginosa polysaccharide structures by NMR and chemical analysis. It is believed that the structures 12 provided herein are the first identification or the first correct identification of P. aeruginosa A- band terminal epitope antigen (A-PS).
  • Pseudomonas aeruginosa (also referred to as P. aeruginosa) is an opportunistic bacterial pathogen and the etiologic agent of several potentially life-threatening infections, including healthcare-associated and ventilator-associated pneumonia, chronic pulmonary infection in cystic fibrosis (CF) patients, and burn and soft tissue infections.
  • CF cystic fibrosis
  • P. aeruginosa refers to a pathogenic strain of Pseudomonas aeruginosa, including, but not limited to, antibiotic-resistant strains, such as P.
  • aeruginosa aeruginosa strains resistant to ⁇ -lactam antibiotics (e.g., penicillin), piperacillin, imipenem, tobramycin or ciprofloxacin.
  • the term “P. aeruginosa” refers to a pathogenic strain that infects cystic fibrosis patients.
  • the term "infection” refers to any microbial infection of a subject’s body. Infection includes the invasion of a patient's body by a microbe and subsequent replication of the microbe in the subject's body. In a specific example, the microbe is P. aeruginosa.
  • subject refers to an animal, and can include, for example, domesticated animals, such as cats, dogs, etc., livestock (e.g., cattle, horses, pigs, sheep, goats, etc.), laboratory animals (e.g., mouse, rabbit, rat, guinea pig, etc.), mammals, non-human mammals, primates, non-human primates, rodents, birds, reptiles, amphibians, fish, and any other animal.
  • livestock e.g., cattle, horses, pigs, sheep, goats, etc.
  • laboratory animals e.g., mouse, rabbit, rat, guinea pig, etc.
  • mammals non-human mammals, primates, non-human primates, rodents, birds, reptiles, amphibians, fish, and any other animal.
  • the subject is a human.
  • Glycans As used herein, the terms “”carbohydrate”, glycan”, “saccharide”, “oligosaccharide”, and “polysaccharide”, are used interchangeably and refer to oligomers or polymers made up of sugar monomers, typically joined by glycosidic bonds also referred to herein as linkages. Within a glycan, monosaccharide monomers may all be the same or they may differ.
  • Common monomers include, but are not limited to trioses, tetroses, pentoses, glucose, fructose, galactose, rhamnose and 3-O-methyl rhamnose, xylose, arabinose, lyxose, allose, altrose, mannose and 3-O-methyl mannose, gulose, iodose, ribose, mannoheptulose, sedoheptulose and talose.
  • Amino sugars may also be monomers within a glycan. Glycans comprising such sugars are herein referred to as aminoglycans.
  • Amino sugars are sugar molecules that comprise an amine group in place of a hydroxyl group, or in some embodiments, a sugar derived from such a sugar.
  • amino sugars include, but are not limited to glucosamine, galactosamine, N-acetylglucosamine, N-acetylgalactosamine, sialic acids 13 (including, but not limited to, N-acetylneuraminic acid and N-glycolylneuraminic acid) and L- daunosamine.
  • glycans may be modified with one or more non-glycan components including, but not limited to labels, handles, linkers, spacers, carriers, and the like.
  • glycans may comprise glycoconjugates.
  • Glycoconjugates may include, but are not limited to glycoproteins, glycolipids or proteoglycans.
  • Glycoproteins include any proteins that contain covalently attached oligosaccharide chains (glycans).
  • JCBM Joint Commission on Biochemical Nomenclature
  • antigens are substances that may be bound by antibody molecules or by ⁇ cell receptors. Many types of biological and other molecules can act as antigens.
  • antigens may originate from molecules that include, but are not limited to, proteins, peptides, carbohydrates, polysaccharides, oligosaccharides, sugars, lipids, phospholipids, glycophospholipids, and other molecules, and fragments and/or combinations thereof.
  • Antigens may originate from innate sources or from sources extrinsic to a particular mammal or other animal (e.g., from infectious agents). Antigens may possess multiple antigenic determinants such that exposure of a mammal to an antigen may produce a plurality of corresponding antibodies or cellular immune responses with differing specificities.
  • an isolated or chemically synthesised glycan antigen from P. aeruginosa may serve to sensitize the host by the presentation of the antigen in association with MHC molecules at a cell surface.
  • antigen-specific T-cells or 14 antibodies can be generated to allow for the future protection of an immunized host. Immunogenic compositions thus can protect the host from infection by the bacteria, reduced severity, or may protect the host from death due to the bacterial infection.
  • Antigens may also be used to generate polyclonal or monoclonal antibodies, which may be used to confer passive immunity to a subject.
  • Antigens may also be used to generate antibodies that are functional as measured by the killing of bacteria in either an animal efficacy model or via an opsonophagocytic killing assay.
  • the term “isolated” in connection with a polysaccharide refers to isolation of A-band terminal epitope antigen (A-PS) from purified polysaccharide using purification techniques known in the art, including the use of centrifugation, depth filtration, precipitation, ultrafiltration, treatment with activate carbon, diafiltration and/or column chromatography.
  • A-PS A-band terminal epitope antigen
  • an isolated polysaccharide refers to partial removal of proteins, nucleic acids and non-specific endogenous polysaccharide.
  • the isolated polysaccharide contains less than 10%, 8%, 6%, 4%, or 2% protein impurities and/or nucleic acids.
  • the term “purified” in connection with a bacterial polysaccharide refers to the purification of the polysaccharide from cell lysate through means such as centrifugation, precipitation, and ultra-filtration. Generally, a purified polysaccharide refers to removal of cell debris and DNA.
  • Bacterial glycans may be derived from naturally-occurring bacteria, genetically engineered bacteria, or can be produced synthetically.
  • the polysaccharides are typically subjected to one or more processing steps prior to use, for example, purification, functionalization, depolymerization using mild acidic or oxidative conditions, deacetylation, and the like. Post processing steps can also be employed, if desired. Any suitable method known in the art for synthesizing, preparing, and/or purifying suitable polysaccharides and oligosaccharides can be employed. [0097] Pseudomonas aeruginosa produces a variety of cell surface glycans.
  • PS polysaccharide
  • aeruginosa polysaccharide structures and shown that the carbohydrate antigen consists of an immunogenic methylated rhamnan oligosaccharide at the non-reducing end of the A-band PS: ⁇ -D-Rha3OMe-4-( ⁇ -D-Rha3OMe-4-) 4 - 15 [0098]
  • the inventors isolated and characterized A-PS1 and A-PS2 (see Fig. 1). It is believed that the structures provided herein are the first identification or the first correct identification of P. aeruginosa A-band terminal epitope antigen.
  • the A-PS tip (see A-PS1 and A-PS2 in Fig. 1) was further isolated to its antigenic component to produce OS1 and OS2.
  • the present invention thus provides an antigenic compound comprising the oligosaccharide moiety of Formula A: ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe) n - Formula A wherein n is 1-5, preferably 2-4, and wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or -OH.
  • the present invention provides an antigenic compound comprising the oligosaccharide moiety of Formula A1: ⁇ -Rha3OMe(-4 ⁇ -Rha3OMe)n-X Formula A1 wherein n is 1-5 (preferably 2-4), and X is –H or -(4 ⁇ -Man3OMe) m -handle; and m is 0, 1, or 2, preferably 0 or 1; and wherein the 2-position in each Rha3OMe saccharide moiety is independently substituted with -OAc or –OH.
  • the saccharide monomeric moieties may be independently in the D or the L configuration.
  • the saccharidic moieties may be independently acetylated at 2-O.
  • an alternating pattern of 3-O-methyl rhamnose acetylated and non- acetylated may be used.
  • 2-O may be substituted with groups other than acetates to improve immunogenicity, such as glycolyl and lactyl.
  • methylated rhamnose oligosaccharides include: ⁇ -D-Rha3OMe-4-( ⁇ –D-Rha3OMe-4)4-4- ⁇ -D-Man3OMe-2-glyceraldehyde-1d (OS2); 3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O- methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O- methyl- ⁇ - ⁇ -rhamnopyranose (pentasaccharide); 3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇ 4)-3-O-methyl- ⁇ -D-rhamnopyranoside-(1 ⁇
  • the methylated rhamnose oligosaccharides of the invention can be isolated or synthesized chemically. Alternatively the isolate oligosaccharides can be further modified chemically.
  • Isolation of A-band terminal epitope antigen The present inventors have developed a method for isolating an A-band terminal epitope antigen (A-PS).
  • A-PS A-band terminal epitope antigen
  • OS1 A-band terminal epitope antigen
  • there is provided a method for producing an A-band terminal epitope antigen (OS1) comprising subjecting isolated LPS (lipopolysaccharide) from P. aeruginosa to acid or alkaline hydrolysis, to produce a polymeric fraction.
  • the polymeric fraction is subject to acid hydrolysis, such as with acetic acid.
  • the polymeric fraction is subject to alkaline hydrolysis, such as by reaction with KOH, followed by treatment with HCl.
  • the polymeric fraction is then subject to an oxidation step followed by acid hydrolysis to produce OS1.
  • said first oxidation step comprises: reacting said polymeric fraction with NaIO 4 , reacting with ethylene glycol and NaBD 4 , reacting with AcOH, and 17 desalting to produce a product, and subjecting the product to acid hydrolysis, to produce the isolated A-band terminal epitope antigen (OS1).
  • OS1 isolated A-band terminal epitope antigen from P.
  • OS1 ⁇ -D-Rha3OMe-4-( ⁇ -D -Rha3OMe-4)4-4- ⁇ –D-Man3OMe-2-tetritol-1d (OS1)
  • OS1 is subject to a further oxidation step, a further isolated A-band terminal epitope is obtained, identified herein as OS2.
  • said second oxidation step comprises: reacting OS1 with NaIO 4 , reacting with ethylene glycol and NaBD 4 , reacting with AcOH, and desalting to produce a product, and subjecting the product to acid hydrolysis, to produce the isolated A-band terminal epitope antigen (OS2).
  • an isolated oxidized A-band terminal epitope antigen (OS2) P. aeruginosa which is a glycan that is a compound of Formula: ⁇ -D-Rha3OMe-4-( ⁇ –D-Rha3OMe-4)4-4- ⁇ –D-Man3OMe-2-glyceraldehyde-1d (OS2)
  • OS2 isolated oxidized A-band terminal epitope antigen
  • the compound is an antigen.
  • Chemical Synthesis The chemical synthesis of the compounds of the invention is described in detail in the Examples and is illustrated in Figs.22-24 and 30.
  • a synthetic process to produce a compound of the invention comprising: ⁇ anomeric deprotection of a 3-O-methylated rhamnopyranoside to form a 3-O- methylated rhamnopyranose; ⁇ acetylating the 3-O-methylated rhamnopyranose to form an acetylated 3-O-methylated rhamnopyranoside; ⁇ partially deprotecting O-4 of the acetylated 3-O-methylated rhamnopyranoside to form a deprotected acetylated 3-O-methylated rhamnopyranoside; ⁇ coupling the O-4 deprotected acetylated 3-O-methylated rhamnopyranoside to form an acetylated 3-O-methylated oligosaccharide; ⁇ deprotecting O-4 of the acetylated 3-O-methylated oligosaccharide; ⁇ deprotecting O-4 of
  • the compounds of the present invention also include compounds that include a “handle”.
  • a “handle” in the context of the present invention is a chemical modification at a site distal to the terminal ⁇ -Rha3OMe repeat to form a reactive group. Examples include 2-glyceraldehyde, -CH 2 -NH 2 , -(CH 2 ) 2 NH 2 , -(CH 2 ) 3 NH 2 , -(CH 2 ) 4 NH2, (CH2)5NH2, -C(O)OH, -C(O)H, -C(O)NH2, and –CH2N3.
  • -4 ⁇ - Man3OMe i.e.
  • the handle is preferably 2-glyceraldehyde.
  • the handle is preferably -CH2-NH2, -(CH2)2NH2, -(CH 2 ) 3 NH 2 , -(CH 2 ) 4 NH2, (CH2) 5 NH2, -C(O)OH, -C(O)H, -C(O)NH 2 , and –CH 2 N 3 , more preferably -CH2-NH2, -(CH2)2NH2, -(CH2)3NH2, -(CH2)4NH2, or -(CH2)5NH2.
  • the synthetic process further comprises adding a handle by performing the following steps: ⁇ glycosylating an activated O-3 methylated rhamnopyranoside intermediate at 1-O with a handle comprising a protected amine, wherein the activated monorhamnopyranoside intermediate comprises a protecting group at glycosylation site 4-O, and forming a protected 1-O glycosidic intermediate; ⁇ removing the protecting group from 4-O and forming a deprotected 1-O glycosidic intermediate; ⁇ coupling the deprotected 1-O glycosidic intermediate to an activated O-3 methylated rhamnopyranoside intermediate, wherein the activated rhamnopyranoside intermediate comprises a protecting group at 4-O, and forming a protected methylated disaccharide, trisaccharide, tetrasaccharide or pentasaccharide; and 19 ⁇ removing all protecting groups from the protected disaccharide, trisaccharide, t
  • the synthetic process further comprises adding a handle to a compound of the invention, by performing the following steps: linker, which may be conjugated to the oligosaccharides of the invention directly or through a handle on the oligosaccharide.
  • linker may be any suitable linker for the desired purpose, for example, for conjugation of the 4 ⁇ -linked glycan to the carrier protein.
  • Suitable linkers containing functional groups on both ends, such as an acid, or an NHS ester, or a PFP ester , will be known to one skilled in the art and include, but are not limited to, for example, polyethylene glycol (PEG), linear poly-amidoamine (PAA), poly(2-oxazoline)s (POx), poly (glycerol adipate) (PGA), polyhydroxyalkanoates (PHA), and other linkers suitable for the preparation of glycoconjugates, such as those described in Munneke et al [42]. Examples of suitable linkers are obtainable, for example from BroadPharm® as BCN PEG and BCN Reagents.
  • the oligosaccharide can be coupled to a linker to form a polysaccharide-linker in which the free terminus of the linker is an ester group.
  • the linker is therefore one in which at least one terminus is an ester group. The other terminus is selected so that it can react with the oligosaccharide to form the oligosaccharide-linker intermediate.
  • the linker is a bifunctional linker that provides a first ester group for reacting with the primary amine group on the handle of the oligosaccharide and a second ester group for reacting with the primary amine group in the carrier molecule.
  • a typical linker is adipic acid N-hydroxysuccinimide diester (SIDEA).
  • the linker may be a bivalent linker containing an activated N-hydroxysuccinimide and a hemiacetal protected 20 aldehyde, wherein one end is reactive with the primary amine on the handle of the oligosaccharided.
  • Other suitable techniques use carbodiimides, hydrazides, active esters, norborane, p- nitrobenzoic acid, N-hydroxysuccinimide, S-NHS, EDC, TSTU. Many are described in International Patent Application Publication No. WO 98/42721.
  • Conjugation may involve a carbonyl linker which may be formed by reaction of a free hydroxyl group of the saccharide with CDI (See Bethell et al., [43]) followed by reaction with a protein to form a carbamate linkage. This may involve reduction of the anomeric terminus to a primary hydroxyl group, optional protection/deprotection of the primary hydroxyl group, reaction of the primary hydroxyl group with CDI to form a CDI carbamate intermediate and coupling the CDI carbamate intermediate with an amino group on a protein.
  • a linker may be used for linking at the anomeric position. In some examples, the linker may be placed early during the synthetic process.
  • a linker such as amino-peg and a functional group such as azide and aldehyde protecting group may be used.
  • a linker may be added according to the following process: classes of proteins include pili, outer membrane proteins and excreted toxins of pathogenic bacteria; nontoxic or “toxoid” forms of such toxins, nontoxic proteins antigenically similar to 21 bacterial toxins (i.e. cross-reacting materials or CRMs) and other proteins.
  • CRM such as CRM197 can be used as a carrier protein.
  • CRM197 is a non-toxic variant of diphtheria toxin (DT).
  • Suitable carrier proteins include additional inactivated bacterial toxins such as DT, Diphtheria toxoid fragment B (DTFB), DTB C8, TT (tetanus toxid) or fragment C of TT, pertussis toxoid, cholera toxoid, E. coli LT (heat-labile enterotoxin), E. coli ST (heat-stable enterotoxin), and a Pseudomonas aeruginosa protein such as exotoxin A from Pseudomonas aeruginosa.
  • HSA human serum albumin
  • BSA bovine serum albumin
  • DT mutants can also be used as the carrier protein, such as CRM176, CRM228, CRM45; CRM9, CRM45, CRM102, CRM103, CRM3201, and CRM107. Also included are Clostridium perfringens exotoxins/toxoid.
  • suitable bacterial proteins include, but are not limited to, pneumococcal surface protein A (PspA), pneumococcal adhesin protein (PsaA), and pneumococcal surface proteins BVH-3 and BVH-11.
  • immunogenic carrier proteins from non-mammalian sources including keyhole limpet hemocyanin (KLH), horseshoe crab hemocyanin and plant edestin is also contemplated, as is the use of viral proteins such as hepatitis B surface/core antigens; rotavirus VP7 protein and respiratory syncytial virus F and G proteins.
  • viral proteins such as hepatitis B surface/core antigens; rotavirus VP7 protein and respiratory syncytial virus F and G proteins.
  • Other carrier proteins will be known to those of skill in the art.
  • the glycan conjugates may be prepared by known coupling techniques.
  • the oligosaccharides of the invention may be conjugated directly or through a handle and/or linker to a carrier protein to form a glycoconjugate, using chemistry discussed above with respect to the linkers.
  • Conjugation between the glycan and the carrier may be achieved using a variety of reagents.
  • the conjugation may be directly between the glycan and the carrier protein, such as a direct covalent linkage by reductive amination. Alternatively, conjugation may be carried out using a cross-linking agent.
  • the protein may be conjugated to a glycan-handle-linker compound per the following: [00127]
  • the antigen is the natural saccharide extracted and modified from Pseudomonas aeruginosa (OS2), which may be conjugated to a carrier protein such as CRM, 22 HSA, BSA, or the like.
  • OS2 Pseudomonas aeruginosa
  • glyceraldehyde acts as a handle, and the protein is attached via a reductive amination reaction.
  • the antigen comprises or consists of: example, may be used. In some examples this is achieved via the reducing end of the synthetic antigen.
  • a linker may first be added to the saccharide via the handle and conjugate to the attached linker with known linking technology.
  • the carrier protein or the linker can be conjugated by direct reductive amination with the amines from the carrier protein or linker, respectively (R is the protein or linker). The following is an example.
  • the oligosaccharides may be acetylated at 2-O.
  • a combination of non-acetylated and acetylated monosaccharides may be used.
  • an alternating patter of 3-O-methyl rhamnose acetylated and nonacetylated may be used.
  • the other oligosaccharides of the invention including the corresponding pentasaccharide, tetrasaccharide, trisaccharide, and disaccharides.
  • compositions including pharmaceutical, immunogenic and vaccine compositions, comprising, consisting essentially of, or alternatively, consisting of any of the glycans described herein including both those conjugated or non-conjugated to a carrier protein, together with a pharmaceutically acceptable carrier, excipient, and/or an adjuvant.
  • Formulation can be accomplished using art-recognized methods. For instance, the glycans can be formulated with a physiologically acceptable vehicle to prepare the composition.
  • Such vehicles include, but are not limited to, water, buffered saline, polyols (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and dextrose solutions.
  • polyols e.g., glycerol, propylene glycol, liquid polyethylene glycol
  • dextrose solutions e.g., dextrose solutions.
  • a composition comprising a conjugate and a pharmaceutically acceptable excipient.
  • a composition comprising a conjugate, a pharmaceutically acceptable excipient, and an adjuvant.
  • a vaccine the glycan being an antigenic component of the vaccine.
  • a vaccine refers to a substance used to stimulate the production of antibodies and/or provide immunity against one or several diseases, prepared from the causative agent of a disease, its products, or a synthetic substitute, treated to act as an antigen without inducing the disease.
  • a vaccine typically contains an antigen that resembles a disease-causing agent or is made from weakened or killed forms of the disease-causing agent.
  • a vaccine can have one or more antigens from a bacterium, one or more of its surface proteins, or one or more of its membrane components.
  • Vaccines can be prophylactic (to reduce the risk of developing or to ameliorate the effects of a future infection by a natural or "wild" pathogen), or therapeutic (e.g., vaccines against a disease or disorder, which are being investigated).
  • the vaccine described herein is a prophylactic vaccine.
  • the vaccine described herein is a therapeutic vaccine.
  • the vaccine may be both prophylactic and therapeutic.
  • Adjuvants may be used to elicit a higher immune response in a subject. As such, adjuvants used according to the present invention may be selected based on their ability to affect antibody titers.
  • adjuvant refers to any substance that acts to accelerate, prolong, or enhance antigen-specific immune responses when used in combination with specific vaccine antigens.
  • An adjuvant can be a naturally occurring component contained in weakened or killed immunogens.
  • an adjuvant can be a whole cell, a protein, or a protein fragment, or a component of the lipid membrane of a bacterial cell.
  • An adjuvant may also be a synthesized compound.
  • an adjuvant can be an aluminum salt, a phospholipid, or a derivative thereof.
  • adjuvanted vaccines can help to elicit stronger local immune reactions as well as systemic immune reactions compared to non-adjuvanted vaccines.
  • the method of raising an immune response further comprises administering an adjuvant.
  • water-in-oil emulsions may be useful as adjuvants. Water-in-oil emulsions may act by forming mobile antigen depots, facilitating slow antigen release and enhancing antigen presentation to immune components.
  • Freund's adjuvant may be used as complete Freund's adjuvant (CFA) which comprises mycobacterial particles that have been dried and inactivated, or as incomplete Freund's adjuvant (IFA), which lacks such particles.
  • CFA complete Freund's adjuvant
  • IFA incomplete Freund's adjuvant
  • Other water-in-oil-based adjuvants may include EMULSIGEN®.
  • EMULSIGEN® comprises micron sized oil droplets that are free from animal-based components and it may be used alone or in combination with other adjuvants, including, but not limited to aluminum hydroxide and CARBIGENTM.
  • immunostimulatory oligonucleotides may also be used as adjuvants.
  • Such adjuvants may include CpG oligodeoxynucleotide (ODN).
  • CpG ODNs are recognized by Toll-like receptor 9 (TLR9), leading to strong immunostimulatory effects.
  • Type C CpG ODNs induce strong IFN- ⁇ production from plasmacytoid dendritic cell (pDC) and B cell stimulation as well as IFN- ⁇ production from T-helper (Tx) cells.
  • CpG ODN adjuvant has been shown to significantly enhance pneumococcal polysaccharide (19F and type 6B)-specific IgG2a and IgG3 in mice.
  • CpG ODN also enhances antibody responses to the protein carrier CRM197, particularly CRM197-specific IgG2a and IgG3.
  • immunization of aged mice with pneumococcal capsular polysaccharide serotype 14 (PPS14) combined with a CpG- ODN has been shown to restore IgG anti-PPS14 responses to young adult levels.
  • CpG ODNs used according to the present invention may include class A, B or C ODNs.
  • ODNs may include any of those available commercially, such as ODN-1585, ODN-1668, ODN-1826, ODN-2006, ODN-2007, ODN-2216, ODN-2336, ODN-2395 and/or ODN-M362.
  • ODN-2395 may be used.
  • ODN-2395 is a class C CpG ODN that specifically stimulates human as well as mouse TLR9. These ODNs comprise phosphorothioate backbones and CpG palindromic motifs.
  • the glycan is covalently linked, or otherwise conjugated, to an immunogenic carrier molecule.
  • the immunogenic carrier molecule is a protein or polypeptide.
  • excipient or “pharmaceutically acceptable excipient” as used herein refers to any substance combined with a compound and/or composition of the invention before use. In some embodiments, excipients are inactive and used primarily as a carrier, diluent or vehicle for a compound and/or composition of the present invention. An excipient is pharmaceutically if it is physiologically compatible, i.e. it does not produce an adverse or untoward reaction when administered to an animal, including a human or non-human animal as appropriate. 26 [00149] Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
  • Such preparatory methods include the step of associating the active ingredient with an excipient and/or one or more other accessory ingredients.
  • a pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • Pharmaceutically acceptable excipients used in the manufacture of pharmaceutical compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical compositions.
  • diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
  • a vaccine as described herein may preferably prevent, ameliorate and/or treat an infection in a subject caused by P. aeruginosa.
  • prevention includes the prevention of the recurrence, spread or onset of a P. aeruginosa infection. It is not intended that the present disclosure be limited to complete prevention. In some embodiments, prevention includes delayed onset or reduced severity of infection.
  • treatment refers to obtaining beneficial or desired results, including clinical results. Beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of extent of disease, stabilized (i.e.
  • Treating can also mean prolonging survival as compared to expected survival if not receiving treatment.
  • the terms “treat” and “treating” are not limited to the case where the subject (e.g. patient) is cured and the disease is eradicated. Rather, examples of the present disclosure also contemplate treatment that reduces symptoms, and/or delays disease progression.
  • aeruginosa is any morbid phenomenon or departure from the normal in structure, function, or sensation, experienced by a subject and indicative of disease.
  • the term “amelioration” or “ameliorates” as used herein refers to a decrease, reduction or elimination of a condition, disease, disorder, or phenotype, including an abnormality or symptom.
  • P. aeruginosa is a significant opportunistic pathogen that causes a variety of life- threatening infections in immunosuppressed or immunocompromised patients. Individuals who are at risk of developing P.
  • aeruginosa infections include cystic fibrosis patients, burn patients, severe neutropenic patients (e.g., cancer patients receiving chemotherapy) and intensive care unit patients receiving respiratory support.
  • a vaccine as described herein may be administered simultaneously with other existing vaccines.
  • the vaccines herein may be administered to a subject by any route, including intramuscular, subcutaneous, intradermic, oral, inhalable, intranasal, rectal and intravenous routes. Oral administration may be suitably via a tablet, a capsule or a liquid suspension or emulsion. Alternatively the vaccines may be administered in the form of a fine powder or aerosol via a Dischaler® or Turbohaler®.
  • Intranasal administration may suitably be in the form of a fine powder or aerosol nasal spray or modified Dischaler® or Turbohaler®. Rectal administration may suitably be via a suppository.
  • the immunoprotective amount of the vaccine may be administered in a single dose or in a series of doses. Where more than one dose is administered, the doses may be administered days, weeks or months apart. In some examples, the vaccine may be administered as a single dose or in a series including one or more boosters.
  • the dosage of vaccine to be administered a subject and the regime of administration may be determined in accordance with standard techniques well known to those of ordinary skill in the pharmaceutical and veterinary arts, taking into consideration such factors as the intended use, particular antigen, the adjuvant (if present), the age, sex, weight, species, general condition, prior illness and/or treatments, and the route of administration.
  • a therapeutically effective amount of a vaccine or immunogenic composition is used.
  • a therapeutically effective amount refers to a quantity of a specified agent sufficient to achieve a desired effect in a subject being treated with that agent. For example, this may be the amount of a vaccine useful for eliciting an immune response in a subject and/or for 28 preventing infection.
  • a vaccine or immunogenic composition
  • the effective amount of a vaccine (or immunogenic composition) useful for increasing resistance to, preventing, ameliorating, and/or treating infection in a subject will be dependent on, for example, the subject being treated, the manner of administration of the therapeutic composition and other factors.
  • Antibodies [00165] In some examples, there is provided a method of producing antibodies specific for a glycan antigen as described herein. [00166] In some examples, antibodies may be developed through immunizing a host with a particular antigen. As discussed above, such an immune response typically leads to the production by the organism of one or more antibodies against the foreign entity, e.g., antigen or a portion of the antigen. In some cases, methods of immunization may be altered based on one or more desired immunization outcomes.
  • the term “immunization outcome” refers to one or more desired effects of immunization. Examples include high antibody titers and/or increased antibody specificity for a target of interest. Methods of collecting antibodies are known in the art.
  • the term “antibody” is used in the broadest sense and specifically covers various embodiments including, but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies formed, for example, from at least two intact antibodies), and antibody fragments such as diabodies so long as they exhibit a desired biological activity. Antibodies are primarily amino-acid based molecules but may also comprise one or more modifications such as with sugar moieties, linkers, detectable labels and the like.
  • the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous cells (or clones), i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
  • each monoclonal antibody is directed against a single determinant on the antigen.
  • the antibodies described herein may be humanized.
  • “Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from 29 the hypervariable region from an antibody of the recipient are replaced by residues from the hypervariable region from an antibody of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • Methods of the invention are conveniently practiced by providing the compounds and/or compositions used in such methods in the form of a kit.
  • a kit preferably contains a composition as described herein.
  • kits preferably contains instructions for the use thereof.
  • an isolated or synthetized glycan preferably an isolated or synthesized glycan antigen from P. aeruginosa, more preferably an isolated or synthesized glycan antigen from P. aeruginosa linked to a carrier protein in the form of a glycoconjugate to a subject.
  • a method of treating a subject having a Pseudomonas aeruginosa infection, suspected of having a Pseudomonas aeruginosa infection, or at risk of developing a Pseudomonas aeruginosa infection comprising administering an isolated or synthetized glycan, preferably an isolated or synthesized glycan antigen from P. aeruginosa, more preferably an isolated or synthesized glycan antigen from P. aeruginosa linked to a carrier protein in the form of a glycoconjugate to the subject.
  • a method of treating a subject having a Pseudomonas aeruginosa infection, suspected of having a Pseudomonas aeruginosa infection, or at risk of developing a Pseudomonas aeruginosa infection comprising administering an antibody or derivative thereof that is specific for a glycan antigen from P. aeruginosa as identified in this document.
  • an antibody such as a monoclonal antibody described herein for diagnosing or treating a P. aeruginosa infection.
  • said antibody is the 1B1 MAb described herein.
  • the antibody or antigen binding fragment thereof may be used for the treatment of a P. aeruginosa infection. 30 [00178] In one aspect, the antibody or antigen binding fragment thereof may be used in the diagnosis of a P. aeruginosa infection. [00179] In one aspect, a method for treating a P. aeruginosa infection is provided, said method comprising administering the antibody or antigen binding fragment to a subject. [00180] In one aspect, a method for the diagnosis of a P. aeruginosa bacterial infection in an animal is provided, comprising contacting a test sample with the antibody or antigen binding fragment thereof, and detecting specific binding thereto.
  • Pseudomonas aeruginosa produces a variety of cell surface glycans.
  • PS polysaccharide
  • A-band PS that is composed of a neutral D-rhamnan trisaccharide repeating unit as a relatively conserved cell surface carbohydrate.
  • NMR Nuclear magnetic resonance
  • Synthetic oligosaccharides (mono- to penta-) representing the terminal 3-O-methyl D-rhamnan were prepared and the trisaccharide was identified as the minimum epitope required to effectively mimic the natural antigen recognised by the broadly cross-reactive monoclonal antibody.
  • a conjugate of the synthetic pentasaccharide with a carrier protein raised polyclonal antibodies in mice. These antibodies were also able to recognise whole cells of P. aeruginosa strains tested, emphasising further the ability of the synthetic antigen to effectively mimic the natural antigen.
  • A-band PS was isolated from the PAO1 Wzy::Gm (mutant lacking band B OPS) LPS by acetic acid hydrolysis with subsequent size-exclusion chromatography. PS fraction was then purified by anion-exchange or reverse-phase HPLC. The yield was usually low, about 5 mg of A-PS from 100 mg of the LPS, and did not scale up proportionally with a higher amount of starting LPS. 32 [00186] Alternatively A-PS was extracted from the same mutant cells with EDTA. This method has been previously reported as an LPS extraction method, but no significant amount of the LPS was extracted in this way.
  • the yield of the A-PS was much higher from the EDTA extraction, compared to its isolation from the LPS, but purification was more challenging.
  • the A-PS was purified on reverse-phase HPLC column or Sep-Pak C18 cartridge, where it was fully retained in water and could be eluted with 30% methanol. All components of the A-PS, including those producing minor anomeric signals and methyl signals in NMR spectra elute together. In column C18 chromatography, with water-methanol gradient elution, A-PS was eluted in wide area of methanol gradient starting at about 20% MeOH, without visible peaks.
  • A-PS contained acidic components and was partially retained on the anion-exchange column, eluting in NaCl gradient in several fractions. This behaviour may be indicative of the linkage of the A-PS to the LPS core, which is acidic due to phosphorylation.
  • P. aeruginosa strain PAO1 wzy::Gm
  • NRCC 6667 known to lack B-band LPS was grown in order to isolate the A-band polysaccharide (PS).
  • BHI Brain Heart Infusion
  • the 4 L of concentrated cells were killed with addition of 90 ml of a 95% (w/v) phenol solution and placed in Forma shaker incubator at 10 °C and shaken at 175 RPM for 4 h. A viability check of material following washing 3 X with PBS was performed.
  • the 4 L concentrate was spun in a Sorval RC6+ centrifuge at 11K RPM for 30 minutes to pellet cells. 2767 g wet wt of a gelatinous sloppy pellet was obtained and dispersed into three 1 L containers. One container was spun for an additional 30 minutes at 11K RPM resulting in a final wet weight of 1110 g. Cells were freeze dried and stored for future use.
  • LPS was isolated as described previously [14] from P. aeruginosa cells from strain PAO1 (wzy::Gm) (NRCC 6667). LPS (100 mg) was hydrolyzed with 2% acetic acid (100 °C, 2 h). The resulting solution was centrifuged to remove precipitate and separated on a Biogel P6 column. A polymeric fraction was collected and separated by anion-exchange chromatography.
  • EXAMPLE 1B Structural characterization of an immunodominant epitope a the tip of the A-band rhamnan of Pseudomonas aeruginosa (Pa)
  • Determination of neutral and amino sugars as alditol acetates Samples (0.2-1 mg) were hydrolyzed with 3 M TFA (120 °C, 3 h), dried, reduced with NaBD4, and excess reagent destroyed with 0.5 mL of AcOH. The solution was dried under a stream of air, dried twice following addition of MeOH (1 mL), and acetylated with 0.2 mL Ac2O with 0.2 mL pyridine for 30 min at 100 °C.
  • NMR spectroscopy NMR experiments were carried out on a Bruker AVANCE III 600 MHz ( 1 H) spectrometer with 5 mm Z-gradient probe with acetone internal reference (2.225 ppm for 1 H and 31.45 ppm for 13 C) using standard pulse sequences cosygpprqf (gCOSY), mlevphpr (TOCSY, mixing time 120 ms), roesyphpr (ROESY, mixing time 500 ms), hsqcedetgp (HSQC), hsqcetgpml (HSQC-TOCSY, 80 ms TOCSY delay) and hmbcgplpndqf (HMBC, 100 ms long range transfer delay).
  • gCOSY mlevphpr
  • TOCSY mixing time 120 ms
  • ROESY mixing time 500 ms
  • hsqcedetgp hsqcetgpml
  • HMBC hmbcgplp
  • A-PS contains a main component which is composed of D-rhamnose trisaccharide repeating units: -2- ⁇ -Rha-3- ⁇ -Rha-3- ⁇ -Rha- A-PS repeating unit A B C
  • NMR spectra of the A-PS preparations contained signals of the repeating units and additional signals (Fig. 2). Some of the minor anomeric signals were previously identified as belonging to 3-O-methyl-rhamnose [18], which has signals of O-methyl groups around 3.3 ppm, but the complete structure was never determined.
  • OS1 contains five residues of 3-O-methyl-D-Rha connected by 1-4-linkages.
  • a similar oligosaccharide was suggested previously [18], but xylose was detected in that study instead of 3-O-methyl- ⁇ -Man and linkage positions were not identified.
  • Interpretation of the NMR spectra of the intact A-PS confirmed the signals of the repeating rhamnan trisaccharide -A-B-C- (data not shown), and also showed the presence of less intense spin systems corresponding to the full OS1, and two residues G and H, identified 37 as 2-O-methyl-Man (G) and 2-O-Me-Rha (H) (Table 3).
  • 3-O-methyl-Man L in the A-PS was linked to O-4 of ⁇ -Man M, thus erythritol X in OS 1 originated from the oxidized Man M.
  • erythritol X in OS 1 originated from the oxidized Man M.
  • spin-systems of ⁇ -Man were present and they form a trisaccharide -4- ⁇ -Man-4- ⁇ -Man-4- ⁇ -Man- (M-K-D), linked either to 2-O-methyl- Rha H or 2-O-methyl-Man G. Further tracing of the chain was not possible, because no other components could be identified.
  • EXAMPLE 2 Production and immunological evaluation of glycoconjugates (BSA-OS2 and CRM-OS2) made with isolated A-band epitope (OS2) [00217]
  • BSA-OS2 and CRM-OS2 glycoconjugates
  • OS2 isolated A-band epitope
  • Three mAbs have been identified that are specific for the A-PS terminus, and preliminary epitope mapping studies suggest that they recognise different regions within this terminal unit. These mAbs, and to a lesser extent the polyclonal sera raised to the A-PS terminus, were able to facilitate killing of P. aeruginosa strains in SBA and OPA experiments.
  • the lyophilised material was dissolved in 10 mL of 100 mM NaPO4, then NaCNBH 3 (5 mg mL -1 ) was added and the resulting solutions were left at room temperature (RT) for 16 h.
  • the conjugate was purified on a 30 KDa molecular weight cut off spin column in PBS with 10 mM sodium citrate and the supernatant was assayed for protein and filter sterilized and frozen at -20 o C. An aliquot was examined by MALDI-MS as described previously [23].
  • Generation of anti-P. aeruginosa A-band terminal epitope antibodies To produce antibodies that target P.
  • mAb production Mice immunised for polyclonal sera were screened for recognition of the A-band PS and the mouse giving the highest titer was selected for the fusion following 40 a final i.v. injection.
  • Antibody sequences SEQ I D NO: Sequence Description 41 EIQLQQSGPELVKPGASVKVSCKASGYSFTDYNMYWVK QSHGKSLEWVGYIDPYNGGTTYNQKFKGKATLTVDKSSS *Bold highlighting indicates the location of CDR sequences [00224]
  • ELISA The binding of anti-P. aeruginosa A-band terminal epitope mAbs and polyclonal sera to BSA conjugates, purified LPS and to whole cells was evaluated by ELISA as described previously [24].
  • mAb competition ELISA Wells of Nunc Maxisorp EIA plates were coated with 1 ⁇ g of P.
  • aeruginosa LPS in PBS overnight at 4 °C and then brought to RT before use. Plates were blocked with 1% BSA-PBS for 1 h at RT, and then wells were washed with PBS-T. One mAb (1B1 or 3B8) was titrated and added to the plate for 1 h at RT. Following washing with PBS- T, the second mAb (3C4) was added at a pre-determined concentration and allowed to incubate for 1 h at RT. Following washing with PBS-T, AP-labeled goat anti-mouse IgG2b (Southern Biotech) specific for mAb 3C4, diluted 1:250 in 1% BSA-PBS was added for 1 h at RT.
  • mAb inhibition ELISA Wells of Nunc Maxisorp EIA plates were coated with either 1 ⁇ g of P. aeruginosa LPS in PBS overnight at 4 °C or P. aeruginosa killed whole cells in dH2O in a drying oven overnight, and then brought to RT before use. Plates were blocked with 1% BSA-PBS for 1 h at RT, and then wells were washed with PBS-T.
  • the inhibition was set-up. Either LPS or a synthetic oligosaccharide was added to a tube at either 1 mg/ml or 3 mg/ml and then a serial dilution with 1% BSA-PBS was performed, before an equal volume of mAb (1B1, 3B8 or 3C4) was added at a constant concentration of 10 ⁇ g/ml in 1% BSA-PBS, this mixture was incubated for 1 h at RT. Following washing of the EIA plate with PBS-T, 100 ⁇ l from the mixed tubes was added to the plate and allowed to incubate for 1 h at RT for LPS coated plates, or 3 h at RT for killed whole cell coated plates.
  • Serum bactericidal assay The ability of the polyclonal sera and mAbs to facilitate bactericidal killing of selected P. aeruginosa strains was determined as described previously [22].
  • Opsonophagocytic assay The ability of the polyclonal sera and mAbs to facilitate opsonophagocytic killing of selected P. aeruginosa strains was determined as described previously [23].
  • SPR Surface plasmon resonance
  • SPR binding assays were performed at 25°C on a Biacore T200 instrument in HBS-EP running buffer (Cytiva Life Sciences, Mississauga, Canada), essentially as described previously [24]. Briefly, approximately 13000 RUs of IgM (PA 1B1 and control Fn 4F1) were amine coupled to a CM7S sensor chip in 10 mM acetate buffer, pH 4.0 (Cytiva).
  • Synthetic oligosaccharides were reconstituted in HBS-EP to 25 mM and a series of dilutions prepared for injection over IgM surfaces.
  • the contact time was 60 s and the dissociation time 120 s (mono-, di-) or 180 s (tri-, tetra-, penta-).
  • the following concentration ranges were injected: mono- (1 mM – 62.5 ⁇ M), di- (200 ⁇ M – 12.5 ⁇ M) and tri-, tetra- and penta- (10 ⁇ M – 625 nM).
  • Mcat lgt2/4 an oligosaccharide from Moraxella catarrhalis, served as a control and was injected at 10 ⁇ M.
  • Mab development A mouse with the best titers to PAO1 LPS (NRCC 6667) following glycoconjugate immunisation was selected for mAb development and its spleen was fused to the myeloid cell line as described in the experimental section. Three mAbs, 3C4 (IgG2b), 3B8 (IgM) and 1B1 (IgM) were obtained. The heavy and light chain variable regions of these mAbs were sequenced and their amino acid sequences are shown in Table 4.
  • Each mAb could 44 recognise the homologous PAO1 (wzy::Gm) LPS and in the case of mAb 1B1, P. aeruginosa purified LPS from the A-band locus mutants PAO1 (wzy::Gm)( ⁇ pa5457) and PAO1 (wzy::Gm)( ⁇ pa5458) (Fig.10).
  • each mAb could recognise killed whole cells of the wt serotype 5 strains PAO1 BAA-47 and 5937, and once again, corroborating the LPS ELISA data, mAb 1B1 was the only mAb that was cross reactive to killed whole cells of the A-band locus mutants PAO1 (wzy::Gm)( ⁇ pa5457), PAO1 (wzy::Gm)( ⁇ pa5458) and PAO1 (wzy::Gm)( ⁇ pa5459) and a sub-set including the ATCC type strains corresponding to the most commonly encountered clinical serotypes (Figs. 11A to 11C). This behaviour was replicated when a set of clinical isolates was examined (Fig.
  • mAb epitope mapping Preliminary experiments were conducted to examine if the mAbs recognised the same, different or overlapping epitopes on the 3-O-Me rhamnan. Competition ELISA studies suggested that mAb 1B1 recognised a unique epitope compared to 3C4, whereas 3C4 and 3B8 recognised similar overlapping epitopes (Figs.
  • Inhibition ELISA with synthetic oligosaccharides In order to further characterise the immunogenic epitope recognised by the mAbs, synthetic oligosaccharides representing mono- (D- and L-isomers), di- (with and without a linker), tri-, tetra- and pentasaccharides of the 3- O-methyl D-rhamnan terminal unit were prepared as described herein and examined in an inhibition ELISA experiment. Initially the experiment was validated using LPS molecules known to be recognised or not recognised by the three mAbs.
  • NMR spectra were measured on a Varian ( 1 H 500 MHz, 13 C 125 MHz, 31 P 200 MHz) spectrometer reported with the solvent residual signal (CDCl 3 , 7.26 ppm for 1 H and 77.1 ppm for 13 C, CD 3 OD, 3.31 ppm for 1 H and 49.0 ppm for 13 C D2O, 4.79 ppm for 1 H and externally with dioxane (67.2 ppm) for 13 C and in a separate experiment prior measuring the spectra with 85% H 3 PO 4 for 31 P).
  • Compound assignments were confirmed using standard two dimensional NMR experiments such as HMBC, COSY, HSQC and 13 C NMR.
  • benzyl bromide (4.70 mL, 39.5 mmol) was added dropwise and the reaction was stirred for 1 h before reaching completion by TLC. Once complete, the reaction was quenched with Et 3 N (8 mL), and poured into a cold solution of saturated NH4Cl (500 mL). As the product crashed out of solution, it was filtered off, washed 47 with water, and dried under high vacuum overnight to generate the product, 4 (12.6 g, 32.9 mmol, 100 %) as a beige solid.
  • reaction mixture 48 was cooled to RT and diluted with EtOAc (300 mL), washed with water (5 x 60 mL), saturated NaHCO 3 (1 x 60 mL), and brine (1 x 60 mL). The combined organic layers were then dried with Na2SO4, evaporated and purified by flash chromatography (eluent: EtOAc/hexane) to yield 6 as a pale oil (23.7 g, 66.3 mmol, 91% – 2 steps).
  • reaction was then cooled to -78 o C under an atmosphere of nitrogen gas and N-iodosuccinimide (406 51 mg, 1.80 mmol) was added followed by triflic acid (20 ⁇ L, 226 ⁇ mol). The reaction was stirred for 3 h before reaching completion. The reaction was then filtered through a Buchner funnel and diluted with 20 mL of CH2Cl2, washed with 10 % Na2S2O3 (2 x 20 mL) and a saturated NaHCO 3 solution (1 x 20 mL).
  • reaction was then cooled to -78 o C under an atmosphere of nitrogen gas and N- iodosuccinimide (33.7 mg, 150 ⁇ mol) was added followed by triflic acid (10 ⁇ L, 115 ⁇ mol). The reaction was stirred for 3 hours before reaching completion. The reaction was then filtered through a Buchner funnel and diluted with 10.0 mL of methylene chloride, washed with 10 % Na2S2O3 (2 x 10 mL) and a saturated sodium bicarbonate solution (1 x 10 mL).
  • EXAMPLE 4 Pseudomonas aeruginosa methylated rhamnan synthetic pentasaccharide conjugation with HSA (without handles or linkers) [00295] 1.25 mg of HSA in water had 5mg of methylated rhamnan synthetic pentasaccharide produced according to Example 3 (without handle or linker) in 300 ⁇ l of 20% methanol added to it. It was then left at room temperature for 1 h and lyophilized.
  • Lyophilized material was immediately dissolved in 300 ⁇ l of 0.2M sodium borate containing 0.5 M sodium sulfate and 15 mg/ml of sodium cyanoborohydride and left for 72 h at 55 °C.
  • the sample was converted to water (spun 3X with water) using a Millipore ultra-1530K MWCO spin column. An aliquot was checked by MALDI and SDS-PAGE, the remainder was lyophilized (1.1mg) and stored at -20°C until used to immunise mice.
  • Six Balb/C mice were immunised via a prime and two boost schedule of the glycoconjugate with adjuvant. Sera following the second boost were examined in ELISA for cross-reactivity against LPS and whole cells from P.
  • SDS-PAGE illustrated conjugation (Figs. 26A and 26B) by virtue of the change in migration of the HSA molecule versus the conjugate.
  • MALDI analysis indicated ⁇ 6 pentasaccharides had been conjugated to HSA (Fig. 27) by virtue in the mass increase of ⁇ 5kDa as each pentasaccharide unit is 872 amu.
  • ELISA analyses indicated that the derived sera 63 recognised LPS (Figs. 28A to 28F) and killed whole cells (Fig. 29) from P. aeruginosa, highlighting the ability of glycoconjugates of the synthetic pentasaccharide to achieve the required response to recognise the target P.
  • EXAMPLE 5 Synthesis of 3-O-methyl tri-, tetra-, and penta-rhamnose oligosaccharides with a handle and optionally a linker
  • ⁇ - ⁇ -mannopyranoside (S1) [00300] In a 2000 mL round bottom flask, acetylated mannose (142.5 g, 365.1 mmol) was dissolved in 800 mL of anhydrous CH2Cl2 and the solution was cooled to 0 ⁇ C under an atmosphere of N2. Next, thiocresol (63.5 g, 511.0 mmol) was added, followed by boron trifluoride diethethyl etherate (63.1 mL, 511.0 mmol) and the solution was stirred at RT for 48 h at which point the TLC had shown completion.
  • the reaction was then washed with water (2 x 200 mL) and NaHCO 3 (2 x 200 mL). The organic layer was isolated and dried with Na 2 SO 4 , filtered, and evaporated under reduced pressure.
  • the crude product was then dissolved in 1000 mL of anhydrous MeOH, and cooled to 0 o C. Sodium metal (0.873 g, 36.4 mmol) was then added and the reaction was stirred at RT for 30 h before reaching completion. The solution was neutralized with Dowex H + , filtered, and evaporated. The crude product was then dissolved in water (500 mL) and extracted with CH2Cl2 (3 x 150 mL).
  • reaction was then cooled to -78 o C under an atmosphere of N2 and N- iodosuccinimide (1.13 g, 4.11 mmol) was added followed by triflic acid (0.50 mL, 5.66 mmol). The reaction was stirred for 3 h before reaching completion. The reaction was then filtered through a Buchner funnel, diluted with CH 2 Cl 2 (100 mL), washed with 10 % Na 2 S 2 O 3 (2 x 100 mL) and saturated NaHCO3 (100 mL).
  • EXAMPLE 6 Screening of new oligosaccharide linkers in inhibition ELISA vs mAb 1B1 [00346] The oligosaccharides with the linkers attached (from Example 5) are shown to effectively mimic the methyl rhamnan tip epitope. 1B1 mAb previously identified as specific for the methyl rhamnan tip at a constant concentration of 10ug/ml in PBS-Tween was incubated 79 at a ratio of 1:1 with dilutions of P. aeruginosa (Pa) PAO1 BAA-47 (wt) lipopolysaccharide (LPS) (positive control for inhibition) and N.
  • Paeruginosa P. aeruginosa
  • PAO1 BAA-47 wt
  • LPS lipopolysaccharide
  • mAb 1B1 meningitidis (Nm) galE/lpt3 LPS (negative control for inhibition) and the synthetic oligosaccharides with linkers (S19-21).
  • the final concentration of mAb 1B1 was 5ug/ml.
  • Pa and Nm LPS and the synthetic oligosaccharides were titrated starting at a concentration of 3mg/ml (final 1.5mg/ml) and diluted 2-fold, 12 times in PBS-Tween. This mixture was incubated together for 1h at room temp before adding to Pa wt LPS coated ELISA plates for 1h at room temp.
  • the irrelevant Nm LPS does not block 1B1 from binding, nor does the PBS.
  • the oligosaccharides block 1B1 binding with the tetra- and penta-saccharide behaving similarly and only being titered out at approximately 5 ⁇ g/ml, whereas the tri-saccharide also blocks binding but titers out earlier at approximately 100 ⁇ g/ml.
  • These results therefore corroborate with the data from earlier prepared oligosaccharides (without linkers).
  • the addition of the linker in these oligosaccharides does not alter the conformation of the oligosaccharide nor affect the oligosaccharide from binding and blocking mAb 1B1.
  • Example 7 Conjugation of oligosaccharide linkers to activated CRM (for immunisation) and activated BSA (for screening) to prepare glycoconjugates
  • Aminooxy activation of CRM & BSA Initially the lysines of the protein (CRM or BSA) were activated by dissolving it at 10mg/ml in 200mM sodium phosphate buffer pH 7.4 and cooling to 40C.
  • Activation of linker to create aldehyde functionality To convert the linkers on S22, S23 & S24 to the active aldehyde function, the oligosaccharides (S22-24) were dissolved at 3mg/ml in 50% acetic acid and left at 370C for 7hrs. Once cool the reaction mixture was then lyophilized.
  • Each mouse in group MRha3V received 3ug of the trisaccharide conjugate resulting in 28ug of CRM, along with 50% v/v SIGMA adjuvant, and PBS buffer totalling 100ul, administered intraperitoneally.
  • Each mouse in group MRha4V received 3ug of the tetrasaccharide conjugate resulting in 25.5ug of CRM, along with 50% v/v SIGMA adjuvant, and PBS buffer totalling 100ul, administered intraperitoneally.
  • mice in group MRha5V received 3ug of the pentasaccharide resulting in 23ug of CRM, along with 50% v/v SIGMA adjuvant, and PBS buffer totalling 100ul, administered intraperitoneally. Blood samples were obtained by submandibular vein collection method to yield approximately 100ul of serum after blood separation.
  • Example 9 Screening of derived mice sera vs. BSA-conjugates and LPS [00359] Individual sera from mice that had received a prime and two boost immunisation schedule were screened for their ability to recognise the BSA-oligosaccharide conjugates and Pa wt LPS in ELISA.
  • mice produced a good IgM response to the conjugates as illustrated by their recognition of the BSA-oligosaccharide conjugates (Fig.35A-C) in ELISA relative to the pre- immune sera (Fig. 34A) and a moderate response to the LPS (Fig. 35D) relative to the pre- immune sera (Fig. 34B). All mice produced a moderate IgG response to the conjugates as illustrated by their recognition of the BSA-oligosaccharide conjugates (Fig. 37A) in ELISA relative to the pre-immune sera (Fig. 36A).
  • mice that received the tetra- and penta-saccharide conjugates produced a moderate IgG response to the conjugates as illustrated by their recognition of the LPS (Fig.37B) in ELISA relative to the pre-immune sera (Fig.36B). Since mice that received immunisations with the CRM-tetra- and pentasaccharide conjugates showed an improved IgG response to Pa wt LPS in ELISA relative to mice that received the tri-saccharide conjugate (Fig.37B), it may be suggested from the mice data that the minimum length of oligosaccharide required to effectively mimic the natural antigen is a tetra-saccharide.
  • Example 11 Screening of derived mice and rabbit sera vs. killed whole cells
  • Whole cell ELISA was performed on a range of P. aeruginosa killed cells (Table 7) including a wild type strain, strains with mutations in genes thought to be related to the A-band methyl rhamnan and serotype strains most commonly encountered in a clinical setting.
  • Table 7 List of cells screened in whole cell ELISA.
  • Species Strain NRCC Serotype Details Source # recognised the cells as shown in Fig 39A.
  • Campodónico et al. Efficacy of a conjugate vaccine containing polymannuronic acid and flagellin against experimental Pseudomonas aeruginosa lung infection in mice, Infect. Imun.79 (2011) 3455-3464. 7. Hegerie et al., Development of a broad spectrum glycoconjugate vaccine to prevent wound and disseminated infections with Klebsiella pneuoniae and Pseudomonas aeruginosa, PLOS ONE (2016) https://doi.org/10.1371/journal.pone.0203143. 8.
  • DiGiandomenico et al. Identification of broadly protective human antibodies to Pseudomonas aeruginosa exopolysaccharide Psl by phenotypic screening. J Exp Med 209 (2012) 1273-1287 9. DiGiandomenico et al., A multifunctional bispecific antibody protects against Pseudomonas aeruginosa. Sci Transl Med 6 (2014) 262ra155 10. Horn et al., Preclinical in vitro and in vivo characterization of the fully human monoclonal IgM antibody KBPA101 specific for Pseudomonas aeruginosa serotype IATS-O11. (2010) Antimicrob. Ag. Chemother.54:2338-2344.
  • Yokota et al. Characterization of a polysaccharide component of lipopolysaccharide from Pseudomonas aeruginosa IID 1008 (ATCC 27584) as D-rhamnan. Eur.J.Biochem.167 (1987) 203-209. 19. Vinogradov et al., Structures of lipopolysaccharides from Klebsiella pneumoniae. Eluicidation of the structure of the linkage region between core and polysaccharide O chain and identification of the residues at the non-reducing termini of the O chains. J Biol Chem. (2002) 277:25070-25081. 20.
  • Lam et al. Occurrence of a common lipopolysaccharide antigen in standard and clinical strains of Pseudomonas aeruginosa. (1989) J. Clin. Microbiol.27:962–967. 86 27. Richard et al., Antibody binding to the O-specific antigen of Pseudomonas aeruginosa O6 inhibits cell growth. Antimrob. Ag. Chemother. (2020) 64: e02168-19 28. Zunk, M. and Kiefel, M. J., An efficient synthesis of selectively functionalized d-rhamnose derivatives, Tetrahedron Lett., 52 (2011) 1296-1299. 29.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Wood Science & Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Virology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
PCT/CA2023/050297 2022-03-07 2023-03-07 Preventing/treating pseudomonas aeruginosa infection Ceased WO2023168520A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
EP23765629.3A EP4490181A1 (en) 2022-03-07 2023-03-07 Preventing/treating pseudomonas aeruginosa infection
AU2023232838A AU2023232838A1 (en) 2022-03-07 2023-03-07 Preventing/treating pseudomonas aeruginosa infection
JP2024553416A JP2025509292A (ja) 2022-03-07 2023-03-07 緑膿菌感染症の予防/治療
CA3254311A CA3254311A1 (en) 2022-03-07 2023-03-07 PREVENTION/TREATMENT OF PSEUDOMONAS AERUGINOSA INFECTION
CN202380036901.3A CN119095871A (zh) 2022-03-07 2023-03-07 预防/治疗铜绿假单胞菌感染
US18/841,818 US20250161428A1 (en) 2022-03-07 2023-03-07 Preventing/treating pseudomonas aeruginosa infection
IL315298A IL315298A (en) 2022-03-07 2023-03-07 Prevention/treatment of Pseudomonas aeruginosa infection
KR1020247033164A KR20240161137A (ko) 2022-03-07 2023-03-07 녹농균 감염의 예방/치료

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202263317245P 2022-03-07 2022-03-07
US63/317,245 2022-03-07

Publications (1)

Publication Number Publication Date
WO2023168520A1 true WO2023168520A1 (en) 2023-09-14

Family

ID=87936903

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2023/050297 Ceased WO2023168520A1 (en) 2022-03-07 2023-03-07 Preventing/treating pseudomonas aeruginosa infection

Country Status (9)

Country Link
US (1) US20250161428A1 (cg-RX-API-DMAC7.html)
EP (1) EP4490181A1 (cg-RX-API-DMAC7.html)
JP (1) JP2025509292A (cg-RX-API-DMAC7.html)
KR (1) KR20240161137A (cg-RX-API-DMAC7.html)
CN (1) CN119095871A (cg-RX-API-DMAC7.html)
AU (1) AU2023232838A1 (cg-RX-API-DMAC7.html)
CA (1) CA3254311A1 (cg-RX-API-DMAC7.html)
IL (1) IL315298A (cg-RX-API-DMAC7.html)
WO (1) WO2023168520A1 (cg-RX-API-DMAC7.html)

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
ARSENAULT TODD L., HUGHES DONALD W., MACLEAN DAVID B., SZAREK WALTER A., KROPINSKI ANDREW M. B., LAM JOSEPH S.: "Structural studies on the polysaccharide portion of "A-band" lipopolysaccharide from a mutant (AK1401) of Pseudomonas aeruginosa strain PAO1", CANADIAN JOURNAL OF CHEMISTRY, NRC RESEARCH PRESS, CA, vol. 69, no. 8, 1 August 1991 (1991-08-01), CA , pages 1273 - 1280, XP093091347, ISSN: 0008-4042, DOI: 10.1139/v91-190 *
MAKARENKO, T.A. ; KOCHAROVA, N.A. ; EDVABNAYA, L.S. ; TSVETKOV, Y.E. ; KHOLODKOVA, E.V. ; KNIREL, Y.A. ; BACKINOWSKY, L.V. ; KOCHE: "Immunological studies of an artificial antigen with specificity of a common polysaccharide antigen of Pseudomonas aeruginosa", FEMS IMMUNOLOGY & MEDICAL MICROBIOLOGY, NO LONGER PUBLISHED BY ELSEVIER, vol. 7, no. 3, 1 October 1993 (1993-10-01), pages 251 - 256, XP023924436, ISSN: 0928-8244, DOI: 10.1111/j.1574-695X.1993.tb00405.x *
MELAMED, J. ET AL.: "Biosynthesis of the Pseudomonas aeruginosa common polysaccharide antigen by D-Rhamnosyltransferases WbpXand WbpY", GLYCOCONJUGATE JOURNAL, vol. 39, 15 February 2022 (2022-02-15), pages 393 - 411, XP037822413, ISSN: 1573-4986, DOI: 10.1007/s10719-022-10040-4 *
STANISLAVSKY, E.S. ET AL.: "Pseudomonas aeruginosa antigens as potential vaccines", FEMS MICROBIOLOGY REVIEWS, vol. 21, 11 January 1997 (1997-01-11), pages 243 - 277, XP002108657, ISSN: 1574-6976, DOI: 10.1016/S0168-6445(97)00059-4 *

Also Published As

Publication number Publication date
CA3254311A1 (en) 2023-09-14
IL315298A (en) 2024-10-01
KR20240161137A (ko) 2024-11-12
AU2023232838A1 (en) 2024-09-26
CN119095871A (zh) 2024-12-06
JP2025509292A (ja) 2025-04-11
EP4490181A1 (en) 2025-01-15
US20250161428A1 (en) 2025-05-22

Similar Documents

Publication Publication Date Title
US9446109B2 (en) Glycoconjugates and their use as potential vaccines against infection by Shigella flexneri
US10087242B2 (en) Glycoconjugates and use thereof as vaccine against Shigella flexneri serotype 3a and X
US20230248839A1 (en) Immunogenic compositions
CA3004305C (en) Synthetic antigen constructs against campylobacter jejuni
KR102803369B1 (ko) 클로스트리듐 디피실에 대한 안정성 백신
US20250161428A1 (en) Preventing/treating pseudomonas aeruginosa infection
AU2021331377B2 (en) Pentavalent vaccine against neisseria meningitidis comprising a synthetic men a antigen
HK40113822A (zh) 预防/治疗铜绿假单胞菌感染
US20150290331A1 (en) Glycoconjugates and their use as potential vaccines against infection by shigella flexneri
US10500261B2 (en) Synthetic antigen constructs against campylobacter jejuni
DePass Campylobacter jejuni Serotype HS: 10 Capsular Polysaccharide and the Conjugate Vaccine thereof
CA2511084A1 (en) Carbohydrate-phosphorylcholine conjugate molecules and their use in vaccinal, therapeutic and diagnostic applications

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23765629

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: P2024-02291

Country of ref document: AE

WWE Wipo information: entry into national phase

Ref document number: 2024553416

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: AU23232838

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2023232838

Country of ref document: AU

Date of ref document: 20230307

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20247033164

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020247033164

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 202417075537

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2023765629

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023765629

Country of ref document: EP

Effective date: 20241007

WWE Wipo information: entry into national phase

Ref document number: 202380036901.3

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 11202406134Q

Country of ref document: SG

WWP Wipo information: published in national office

Ref document number: 18841818

Country of ref document: US