WO2023152260A1 - Anti-alpha-synuclein therapeutic vaccines - Google Patents

Anti-alpha-synuclein therapeutic vaccines Download PDF

Info

Publication number
WO2023152260A1
WO2023152260A1 PCT/EP2023/053259 EP2023053259W WO2023152260A1 WO 2023152260 A1 WO2023152260 A1 WO 2023152260A1 EP 2023053259 W EP2023053259 W EP 2023053259W WO 2023152260 A1 WO2023152260 A1 WO 2023152260A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
peptide
vaccine composition
amino acid
disease
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2023/053259
Other languages
English (en)
French (fr)
Inventor
Andrea Pfeifer
Maxime AYER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AC Immune SA
Original Assignee
AC Immune SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by AC Immune SA filed Critical AC Immune SA
Priority to CA3248093A priority Critical patent/CA3248093A1/en
Priority to IL314865A priority patent/IL314865A/en
Priority to EP23703593.6A priority patent/EP4475878A1/en
Priority to JP2024547294A priority patent/JP2025506472A/ja
Priority to MX2024009485A priority patent/MX2024009485A/es
Priority to US18/836,298 priority patent/US20250152684A1/en
Priority to CR20240371A priority patent/CR20240371A/es
Priority to CN202380020628.5A priority patent/CN118660717A/zh
Priority to AU2023219059A priority patent/AU2023219059A1/en
Priority to KR1020247025028A priority patent/KR20240147981A/ko
Publication of WO2023152260A1 publication Critical patent/WO2023152260A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0007Nervous system antigens; Prions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/127Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55516Proteins; Peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55561CpG containing adjuvants; Oligonucleotide containing adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6037Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]

Definitions

  • the present invention relates to anti-alpha-synuclein therapeutic vaccines that can be employed for the prevention, alleviation and/or treatment of diseases, disorders and abnormalities associated with alpha-synuclein (a-synuclein, A-synuclein, aSynuclein, A-syn, a-syn, aSyn, a- syn) aggregates including, but not limited to, Lewy bodies and/or Lewy neurites and/or glial cytoplasmic inclusions, such as Parkinson’s disease, Multiple System Atrophy, Lewy Body dementia (LBD; dementia with Lewy bodies (DLB) (“pure” Lewy body dementia), Parkinson’s disease dementia (PDD)), or Diffuse Lewy Body Disease.
  • LBD Lewy Body dementia
  • DLB dementia with Lewy bodies
  • PPD Parkinson’s disease dementia
  • amyloid beta amyloid beta
  • Amyloid-like proteins that form mainly intracellular aggregates include, but are not limited to alpha-synuclein, tau, and huntingtin (htt).
  • aSyn is a 14 kD naturally monomeric protein that is normally located to presynaptic terminals either bound to membranes of the synaptic vesicles or in the cytosol. Its natural function remains poorly understood and is likely involved in the synaptic transmission.
  • aSyn During pathogenesis misfolding and aggregation of aSyn occurs in the central nervous system (CNS) and the peripheral nervous system, possibly as a consequence of posttranslational modification, including among others C-terminal protease cleavage (Dufty 2007, Bassil 2016). Aggregation leads to the generation of different aSyn species that have been associated with the pathogenesis of LB diseases, such as oligomers, protofibrils, and fibrils. The fibrillar forms of aSyn are detected mostly in LBs which are located in neuronal cell body (Kosaka et al., 1990, Dickson et al, 1989).
  • Aggregates of aSyn can be also detected in astroglial cells (Braak 2007). Not only fibrils, but various oligomeric aSyn species were detected in diseased human brains. In contrast to fibrillar aSyn, oligomeric aggregates are most likely located in neuronal projections and presynaptic terminals where they might damage the synapses, thus oligomeric aSyn has been attributed to cellular cytotoxicity.
  • aSyn can form different types of aggregates with different appearances, conformations, cytotoxicities and chemical properties under different in vitro conditions.
  • different types of aggregates can develop, possessing different structural characteristics.
  • distinct aSyn-strains impress (e.g. “fibrils” or “ribbons”) their conformation upon the receiving cell and generate aggregates of the same strain in a process termed “conformational templating”. If they are injected into rat brains, these types of aggregates show varying properties in terms of inclusion formation and generation of behavioral and neurotoxic phenotypes in vivo.
  • aSyn aggregates expose different polypeptide chains due to their distinct conformations. These differentially exposed surfaces would allow different sets of intramolecular interactions.
  • the conformation of a given aSyn-strain dictates its properties such as their propensity for seeding or the predilection for certain cell types.
  • Experimental data start to emerge that demonstrate the different properties of aSyn-strains extracted from PD and Multiple System Atrophy (MSA) material; Analysis of pathologic brain material from patients with PD or MSA demonstrated different properties of transmissible aSyn aggregates.
  • synucleinopathies or a- synucleinopathies, or alpha-synucleinopathies
  • these include, but are not limited to, Parkinson’s disease (PD).
  • PD Parkinson’s disease
  • Synucleinopathies include Parkinson's disease (sporadic, familial with alpha-synuclein mutations, familial with mutations other than alpha-synuclein, pure autonomic failure and Lewy body dysphagia), Lewy Body dementia (LBD; dementia with Lewy bodies (DLB) (“pure” Lewy body dementia), Parkinson’s disease dementia (PDD)), diffuse Lewy body disease (DLBD), sporadic Alzheimer’s disease, familial Alzheimer's disease with APP mutations, familial Alzheimer's disease with PS-1, PS-2 or other mutations, familial British dementia, Lewy body variant of Alzheimer’s disease, and Down syndrome.
  • Parkinson's disease sporadic, familial with alpha-synuclein mutations, familial with mutations other than alpha-synuclein, pure autonomic failure and Lewy body dysphagia
  • LBD Lewy Body dementia
  • DLB dementia with Lewy bodies
  • Parkinson’s disease dementia Parkinson
  • Synucleinopathies with neuronal and glial aggregates of alpha-synuclein include but are not limited to multiple system atrophy (Shy-Drager syndrome, striatonigral degeneration and olivopontocerebellar atrophy).
  • alpha-synuclein-immunoreactive lesions include traumatic brain injury, chronic traumatic encephalopathy, dementia puglistica, tauopathies (Pick's disease, frontotemporal dementia, progressive supranuclear palsy, corticobasal degeneration and Niemann-Pick type Cl disease, frontotemporal dementia with Parkinsonism linked to chromosome 17), motor neuron disease, Huntington’s disease, amyotrophic lateral sclerosis (sporadic, familial and ALS-dementia complex of Guam), neuroaxonal dystrophy, neurodegeneration with brain iron accumulation type 1 (Hallervorden- Spatz syndrome), prion diseases, Creutzfeldt-Jakob disease, ataxia telangiectatica, Meige’s syndrome, subacute sclerosing panencephalitis, Gerstmann-Straussler-Scheinker disease, inclusion-body myositis, Gaucher disease, Krabbe disease as well as other
  • Parkinson’s Disease is a synucleinopathy and the second most common neurodegenerative movement disease. PD prevalence ranges between 100 and 200/100,000 in the general population, and affects approximately 1 % of the population above the age of 60 with an annual incidence of about 15/100,000. It is a chronic progressive disorder, defined by a combination of motoric syndromes (bradykinesia, rigidity, resting tremor and postural instability) and by non-motoric syndromes (a variety of autonomic dysfunctions, sensory abnormalities, and psychiatric abnormalities) that usually precede motoric syndromes.
  • motoric syndromes bradykinesia, rigidity, resting tremor and postural instability
  • non-motoric syndromes a variety of autonomic dysfunctions, sensory abnormalities, and psychiatric abnormalities
  • LB filamentous protein inclusions
  • PD, DLB and other LB diseases show accumulation and redistribution of aSyn in various brains regions and cellular populations.
  • MSA is another very important synucleinopathy.
  • MSA is a sporadic neurodegenerative disorder that is characterized by symptoms of L-DOPA-resistant parkinsonism, cerebellar ataxia, and dysautonomia. Patients suffer from multisystem neuronal loss affecting various brain areas including striatum, substantia nigra, cerebellum, pons, as well as the inferior olives and the spinal cord.
  • MSA is characterized by aSyn-positive glial cytoplasmic (GCI) and rare neuronal inclusions throughout the central nervous system. These inclusions are associated with striatonigral degeneration, olivopontocerebellar atrophy, and involvement of autonomic nuclei in medulla and spinal cord.
  • GCI glial cytoplasmic
  • GCIs for the pathogenesis of MSA are generally acknowledged and underscored by recent analysis of transgenic mouse models analysing the effect of aSyn overexpression in oligodendroglia. In tg mice overexpressing human aSyn both GCI-like aggregates and biochemical markers of MSA were observed.
  • DLB is the second most common type of neurodegenerative dementias in western society after Alzheimer's disease (AD). It makes up for 4-7% of clinically diagnosed dementia, with the same number of cases predicted to escape correct clinical diagnosis. Diagnosis of DLB is challenging, as the disease represents an “in-between” of AD and PD and shows overlapping features of both entities.
  • the four clinical consensus criteria, of which two must be present to diagnose “probable DLB” are fluctuation in cognition and attention, recurrent visual hallucinations, REM sleep behavior disorder and spontaneous parkinsonian motor signs, which occur later in the disease than the other criteria.
  • DLB pathology is characterized by proteinaceous inclusions termed Lewy Bodies (LB), predominantly composed of alpha synuclein (aSyn) that has a role in the loss of function and structure of the neurons.
  • LB proteinaceous inclusions
  • ASyn alpha synuclein
  • the LB in DLB are less well demarcated, less eosinophilic and less filamentous than those of PD.
  • amyloid plaques containing mainly carboxy- terminally elongated forms of amyloid beta (Abeta) such as Abetal-42 can be found in the brains of DLB patients. Cortical amyloid deposition is associated with lower temporal lobe perfusion and a trend to hippocampal atrophy.
  • UB-312 Another alpha synuclein targeting active immunotherapy, UB-312, was tested in a human alpha synuclein transgenic mouse model and has been shown to reduce the accumulation of alpha synuclein in the brain and gut. This was accompanied by an improvement in motor performance of treated animals (Nimmo JT et al., 2022 Acta Neuropathol, Jan;143(l):55-73). UB-312 is currently being tested in a Phase 1/2 clinical trial. This study will determine the safety, tolerability, and immunogenicity of UB-312 in healthy participants and PD and MSA patients (Fleming SM et al., 2022, Neuropharmacology 202).
  • the inventors have designed vaccine compositions comprising antigenic peptides, which are shown herein to be highly immunogenic and which induce high amounts of aSyn-specific antibodies in the periphery.
  • the vaccine compositions are predicted to increase target binding of the induced antibodies due to an oligoclonal antibody response.
  • the present invention relates to a liposomal composition
  • a liposomal composition comprising an antigenic peptide displayed on the surface of the liposome and an adjuvant, wherein the antigenic peptide has the structure:
  • E glutamic acid, P is proline; V is Valine, D is aspartic acid, N is asparagine;
  • Xi is present or not and, if present, is G, wherein G is glycine;
  • X2 is present or not and, if present, is I or G, wherein I is isoleucine and G is defined as above;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X 4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine or methionine sulfoxide
  • Xe is A, K or S, wherein A is alanine and K and S are as defined above.
  • the invention provides a liposomal vaccine composition
  • a liposomal vaccine composition comprising an antigenic peptide displayed on the surface of the liposome and an adjuvant, wherein the antigenic peptide has the structure:
  • L leucine
  • E glutamic acid
  • M methionine or methionine sulfoxide
  • P proline
  • V valine
  • D aspartic acid
  • N asparagine
  • A is alanine
  • Xi is present or not and, if present, is G, wherein G is glycine; X2, is present or not and, if present, is I or G, wherein I is isoleucine and G is defined as above.
  • the invention relates to a liposomal vaccine composition
  • a liposomal vaccine composition comprising an antigenic peptide displayed on the surface of the liposome and an adjuvant, wherein the antigenic peptide comprises, consists essentially of, or consists of the amino acid sequence G- I-L-E-D-M-P-V-D-P-D-N-E-A (SEQ ID NO: 1).
  • the invention in one aspect encompasses the use of a native aSyn-peptide (amino acid position 111-124, with reference to SEQ ID NO: 28) in the liposomal vaccine composition.
  • the invention relates to a liposomal vaccine composition
  • a liposomal vaccine composition comprising an antigenic peptide displayed on the surface of the liposome and an adjuvant, wherein the antigenic peptide comprises, consists essentially of or consists of the amino acid sequence L- E-D-M-P-V-D-P-D-N-E-A (SEQ ID NO: 38).
  • the invention in another aspect encompasses the use of a native aSyn-peptide (amino acid position 113-124, with reference to SEQ ID NO: 28) in the liposomal vaccine composition.
  • the antigenic peptide of the liposomal vaccine composition may comprise, consist essentially of, or consist of the amino acid sequence G-G-L-E-D-M-P-V-D-P-D-N-E-A (SEQ ID NO: 45). Therefore, the invention may encompass the use of aSyn-peptide (amino acid position 111- 124) with one I to G substitution at amino acid position 112 where X2 is G and therefore the aSyn-peptide of the liposomal vaccine composition has the amino acid sequence: G-G-L-E-D- M-P-V-D-P-D-N-E-A (SEQ ID NO: 45).
  • the antigenic peptide may optionally comprise between 1 and 2 amino acid differences (i.e. 1, 2 differences) compared with the amino acid sequence G-I-L-E-D-M-P-V-D-P-D-N-E-A.
  • the differences are generally amino acid substitutions according to the options set out for each position. These differences can be selected from any of amino acids X1-X2. Absence of Xi and/or X2 is considered a difference.
  • SEQ ID NO: 38 is lacking amino acids in positions Xi and X2 and thus presents two differences compared to SEQ ID NO: 1 and SEQ ID NO: 45 presents an amino acid substitution in position X2 (wherein I is substituted for G) and therefore presents one difference as compared to the amino acid sequence G-I-L-E-D-M-P-V- D-P-D-N-E-A.
  • the antigenic peptide of the liposomal vaccine composition comprising the amino acid sequences: SEQ ID NO: 1, SEQ ID NO: 38 or SEQ ID NO: 45, does not comprise the dipeptide Y-E immediately following the alanine residue (i.e. in position Xe), wherein Y is tyrosine and E is glutamic acid.
  • the antigenic peptides comprised in the liposomal vaccine composition of the invention do not comprise further alpha synuclein amino acid residues after the alanine of SEQ ID NO: 1 or SEQ ID NO: 38. In particular, they do not comprise the dipeptide Y-E immediately following the alanine.
  • the antigenic peptides of the liposomal vaccine compositions may comprise, consist of, or consist essentially of the amino acid sequences selected from SEQ ID NO: 1, SEQ ID NO: 38 or SEQ ID NO: 45.
  • the antigenic peptides may, however, comprise a limited number of further N and/or C terminal amino acid residues in order to allow the insertion of the antigenic peptide into the liposome (in a manner that permits the peptide antigen to be displayed on the surface of the liposome).
  • the antigenic peptide can include additional residues, such as lysine residues to facilitate palmitoylation. Those residues are typically found at the N and/or C terminus of the antigenic peptide sequence. In some embodiments, there may be 1-4 lysine residues added to the N and/or C terminus, preferably 2 lysine residues added at the N and C terminus.
  • the term “consists essentially of’ means that the alpha-synuclein-derived peptide antigen includes the 10 to 14 contiguous amino acids starting on position 111 or 113 of the alpha-synuclein (SEQ ID NO: 28) but can include a limited number of additional residues, such as two to four lysine residues to facilitate presentation on the surface of the liposome.
  • the peptide antigen comprising, consisting of, or consisting essentially of the amino acid sequences SEQ ID NO: 1, SEQ ID NO: 38 or SEQ ID NO: 45 included in the liposomal compositions of the invention may further comprise at least one chemical modification. Modifications, such as amidation, esterification, palmitoylation, formylation, acetylation, other chemical substitution etc. may be made to a free C-terminal (or N-terminal) end of a peptide or its side chains. Such modifications are within the scope of the term “consisting essentially of’ as used herein even if not separately specified. Palmitoylation is a preferred modification to facilitate peptide antigen display on the surface of the liposome, which may be in a structural arrangement conducive to production of neutralizing antibodies.
  • a liposomal vaccine composition comprising:
  • L leucine
  • E glutamic acid
  • M methionine or methionine sulfoxide
  • P proline
  • V valine
  • D aspartic acid
  • N asparagine
  • A is alanine
  • Xi is present or not and, if present, is G, wherein G is glycine;
  • X2 is present or not and, if present, is I or G, wherein I is isoleucine and G is defined as above; wherein the peptide antigen does not comprise the dipeptide Y-E immediately following A, wherein Y is tyrosine and E is as defined above.
  • liposomal vaccine composition of any one of the preceding clauses, wherein one or both ends of the peptide antigen further comprise at least one arginine I or glutamic acid I residue.
  • liposomal vaccine composition of any one of the preceding clauses, wherein one or both ends the peptide antigen further comprise at least 3 arginine I or glutamic acid I residues.
  • the peptide comprising a T-cell epitope comprises at least one amino acid sequence selected from the group consisting of SEQ ID NO: 35 (PaDre), SEQ ID NO: 36 (P2), SEQ ID NO: 37 (P30), SEQ ID NO: 21 (SAT13), SEQ ID NO: 22 (SAT15), SEQ ID NO: 23 (SAT17), SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 , SEQ ID NO: 27 and any combination thereof.
  • the peptide comprising a T-cell epitope comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 29 (SAT42), SEQ ID NO: 30 (SAT43), SEQ ID NO: 31 (SAT44), SEQ ID NO: 32 (SAT47), SEQ ID NO: 35 (PaDre), SEQ ID NO: 36 (P2) and SEQ ID NO: 37 (P30), or a close sequence analogue thereof. 12.
  • toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA) and/or wherein the toll-like receptor 9 ligand comprises CpG.
  • MPLA monophosphoryl lipid A
  • composition of any one of the preceding clauses, wherein the adjuvant comprises monophosphoryl lipid A (MPLA).
  • MPLA monophosphoryl lipid A
  • a liposomal vaccine composition comprising: a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from G-I-L-E-D-M-P-V-D-P-D- N-E-A (SEQ ID NO: 1), L-E-D-M-P-V-D-P-D-N-E-A (SEQ ID NO: 38), and G-G-L-E-D-M- P-V-D-P-D-N-E-A (SEQ ID NO: 45); and a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 32 (SAT47) or a close sequence analogue thereof; and an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand; and wherein the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA).
  • peptide antigen comprises, consists essentially of or consists of the amino acid sequence G-I-L-E-D-M-P-V-D-P-D-N-E- A (SEQ ID NO: 1).
  • a pharmaceutical composition comprising the liposomal vaccine composition of any one of the clauses 1 to 20, and a pharmaceutically acceptable carrier, diluent and/or excipient.
  • a kit comprising a liposomal vaccine composition as defined in any one of clauses 1 to 20 or the pharmaceutical composition of clause 21 and a container.
  • liposomal vaccine composition for use of clause 23, wherein the disease, disorder or abnormality associated with alpha-synuclein aggregates is a synucleinopathy.
  • LBD Lewy Body dementia
  • DLB dementia with Lewy bodies
  • PPD Parkinson’s disease dementia
  • a method for prophylaxis, treatment and alleviation of diseases associated with the disease, disorder or abnormality associated with alpha-synuclein aggregates comprising administering to the subject the liposomal vaccine composition of any one of clauses 1 to 20 or the pharmaceutical composition of clause 21.
  • the present invention relates to a liposomal composition
  • a liposomal composition comprising an antigenic peptide displayed on the surface of the liposome and an adjuvant, wherein the antigenic peptide has the structure:
  • E glutamic acid, P is proline; V is Valine, D is aspartic acid, N is asparagine;
  • Xi is present or not and, if present, is G, wherein G is glycine;
  • X2 is present or not and, if present, is I or G, wherein I is isoleucine and G is defined as above;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X 4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine or methionine sulfoxide
  • Xe is A, K or S, wherein A is alanine and K and S are as defined above.
  • the peptide is modified as compared to this peptide sequence.
  • Such peptides are able to elicit a strong anti-aSyn antibody response and the induced antibodies show high cross-reactivity with human aSyn even though these peptides have a sequence which is different from the native sequence.
  • Immune responses superior to the response with the native sequence i.e. targeting the same native structures was achieved with the peptides according to the present invention.
  • the invention relates to a liposomal vaccine composition
  • a liposomal vaccine composition comprising: an antigenic peptide displayed on the surface of a liposome; and an adjuvant; wherein the antigenic peptide comprises, consists essentially of, or consists of the structure: XI-X2-X3-E-X 4 -X 5 -P-V-D-P-D-N-E-X 6 , wherein:
  • E glutamic acid, P is proline; V is Valine, D is aspartic acid, N is asparagine,
  • Xi is present or not and, if present, is G, wherein G is glycine;
  • X2 is present or not and, if present, is G, wherein G is defined as above;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X 4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine or methionine sulfoxide
  • Xe is A, K or S, wherein A is alanine and K, and S are as defined above; with the proviso that X3-E-X4-X5 -P-V-D-P-D-N-E-Xe is not L-E-D-M-P-V-D-P-D-N-E-A and wherein the antigenic peptide does not comprise the dipeptide Y-E immediately following Xe, wherein Y is tyrosine and E is as defined above.
  • single letter amino acid code is generally used herein.
  • the antigenic peptide herein described may comprise between 1 and 5 amino acid differences (i.e. 1, 2, 3, 4 or 5 differences) or preferably between 1 and 4 amino acid differences compared with the amino acid sequence G-I-L-E-D-M-P-V-D-P-D-N-E-A.
  • the differences are generally amino acid substitutions according to the options set out for each position. In some embodiments, however, Xe is deleted. It is more preferred that there are 2, 3, 4 or 5 amino acid differences from the amino acid sequence G-I-L-E-D-M-P-V-D-P-D-N-E-A (SEQ ID NO: 1, which is the wild type alpha synuclein sequence from amino acids 111-124 of SEQ ID NO: 28).
  • the antigenic peptide comprises amino acid differences compared with the amino acid sequence G-I-L-E-D-M-P-V-D-P-D-N-E-A at one or more positions selected from Xi, X2, X3, X 4 , X5 and Xe. Absence of Xi, X2 and/or Xe is considered a difference.
  • Methionine is an amino acid that occurs naturally.
  • the sulfur-containing amino acids methionine and cysteine are more easily oxidized than the other amino acids. Oxidation of the sulfur of methionine results in methionine sulfoxide or methionine sulfone.
  • the antigenic peptides of the liposomal composition of the present invention comprise methionine in its oxidized form methionine sulfoxide.
  • a liposomal composition of the invention comprises an antigenic peptide comprising methionine sulfoxide.
  • X5 is methionine or methionine sulfoxide.
  • X5 is methionine.
  • X5 is methionine sulfoxide.
  • the liposomal composition of the invention comprises antigenic peptide that retain their ability to generate aSyn-specific antibodies when employed as an immunogen. Moreover, antigenic peptides of the invention are more immunogenic than the corresponding wild type aSyn peptide (comprising the 14-mer G-I-L-E-D-M-P-V-D-P-D-N-E-A, (SEQ ID NO: 1)) in terms of generating aSyn-specific antibodies, as demonstrated in the comparative experiments herein (example 2). They are also more immunogenic than other aSyn peptides from the C terminal region of aSyn, see Tables 2 and 4 below.
  • the antigenic peptides comprised into the liposomal vaccine composition of the invention typically do not comprise further alpha synuclein amino acid residues following Xe. In particular they do not comprise the dipeptide Y-E immediately following Xe.
  • peptides including the amino acids Y125 and E126 are predicted by in silico analyses to bind with high affinity to different allelic variants of MHC I and thus represent potential aSyn specific cytotoxic T cell epitopes (www. sy fpeithi . de).
  • no amino acid extensions should (in contrast to the fusion proteins disclosed e.g. in WO 2005/108423 Al) be present C- terminally which represent the native amino acid sequence of aSyn, i.e.
  • the antigenic peptides included in the liposomal vaccine compositions may, however, comprise a limited number of further N terminal amino acid residues.
  • the antigenic peptides may, additionally or alternatively, comprise a limited number of further C terminal amino acid residues in order to allow the insertion of the antigenic peptide into the liposome (in a manner that permits the peptide antigen to be displayed on the surface of the liposome).
  • the peptide can include additional residues, such as lysine residues to facilitate palmitoylation. Those residues are typically found at the N and/or C terminus of the peptide.
  • the alpha-synuclein- derived peptide antigen includes the 10 to 14 contiguous amino acids starting on position 111 or 113 of the alpha-synuclein (SEQ ID NO: 28) but can include a limited number of additional residues, such as two to four lysine residues to facilitate presentation on the surface of the liposome.
  • one or both ends of the peptide antigen may include additional residues, which are not derived from the alpha-synuclein protein sequence but rather designed to modify the properties of the peptide.
  • the peptide antigen of the invention further comprises a patch comprising, consisting essentially of or consisting of at least one amino acid, optionally arginine (R) or glutamic acid (E).
  • the peptide antigen of the invention further comprises a patch comprising, consisting essentially of or consisting of at least three amino acids, optionally arginine (R) or glutamic acid (E).
  • R repeat arginine
  • E repeat glutamic acid sequences consisting of between 3 (EEE) and 8 (EEEEEEEE) glutamic acids.
  • the antigenic peptides of the invention are thus typically 11-22 amino acids in length, preferably 12-14 amino acids in length (i.e. 12, 13 or 14 amino acids in length). It is particularly preferred that the antigenic peptides are 12 or 14 amino acids in length.
  • the antigenic peptides of the liposomal vaccine composition produce an antibody response in the absence of a T-cell response.
  • the antigenic peptides of the invention themselves do not typically contain T- cell epitopes, in particular cytotoxic T-cell epitopes.
  • Liposomal vaccine compositions of the invention comprising antigenic peptides described herein are expected to be highly immunogenic and induced antibody responses are expected to have a low patient-to-patient variability. Furthermore, liposomal vaccine compositions of the invention incorporating palmitoylated peptides can also preferentially generate antibodies against alpha-synuclein sequences in a P-sheet conformation, leading to an increased affinity for pathological and/or aggregated aSyn species. Periodic peptide arrangements, such as in the liposomal formulation, are known to crosslink the immunoglobulin antigen receptor on B cells in a very effective way providing a strong stimulus for antibody production (Pihlgren et al., 2013).
  • a liposomal composition comprising an antigenic peptide displayed on the surface of the liposome, wherein the antigenic peptide has the structure:
  • Xi is present or not and, if present, is G, wherein G is glycine;
  • X2 is present or not and, if present, is I or G, wherein I is isoleucine and G is defined as above;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine or Methionine sulfoxide;
  • Xe is A, K or S, wherein A is alanine and K, and S are as defined above.
  • a liposomal composition comprising an antigenic peptide displayed on the surface of the liposome, wherein the antigenic peptide has the structure:
  • E glutamic acid, P is proline; V is Valine, D is aspartic acid, N is asparagine;
  • Xi is present or not and, if present, is G wherein G is glycine;
  • X2 is present or not and, if present, is G, wherein G is defined as above;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X 4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine or Methionine sulfoxide;
  • Xe is A, K or S, wherein A is alanine and K, and S are as defined above; with the proviso that X3-E-X4-M-P-V-D-P-D-N-E-X6 is not L-E-D-M-P-V-D-P-D-N-E-A.
  • Xi and X2 are absent.
  • the present invention relates to a liposomal composition comprising an antigenic peptide having the structure:
  • E glutamic acid, P is proline; V is Valine, D is aspartic acid, N is asparagine;
  • X3 is L, K, or S, wherein L is leucine, K is lysine, and S is serine;
  • X 4 is D, K or S, wherein D, K and S are as defined above;
  • X5 is M, wherein M is methionine, or methionine sulfoxide;
  • Xe is A, K or S, wherein A is alanine and K, and S are as defined above; with the proviso that X3-E-X4-X5-P-V-D-P-D-N-E-X6 is not L-E-D-M-P-V-D-P-D-N-E-A.
  • Xi is present and is G.
  • X2 is present and is G.
  • X3 is L, K, or S.
  • X4 is D, S or K.
  • X5 is Methionine or Methionine sulfoxide, preferably Methionine sulfoxide.
  • Xe is A, K or S.
  • Xi, X2 are present and are each G, and X3 is K.
  • Xi, X2 are present and are each G, X3 is K, and Xe is A.
  • Xi, X2 are present and are each G, X3 is K, X4 is S and Xe is A. In preferred embodiments, Xi, X2 are present and are each G, X3 is K, X4 is D and Xe is A.
  • X3 is L or K.
  • X4 is D or S.
  • X5 is M.
  • Xe is A or S.
  • Xi and X2 are absent.
  • Xi, X2 are absent, and X3 is L.
  • Xi, X2 are absent, X3 is L, Xe is S. In another preferred embodiment, Xi, X2 are absent, X3 is L and X4is D.
  • the peptide antigen included in the liposomal compositions of the invention may further comprise at least one chemical modification.
  • Modifications such as amidation, esterification, palmitoylation, formylation, acetylation, other chemical substitution etc. of a free C-terminal (or N-terminal) end of a peptide or its side chains are explicitly included within the scope of the invention. Such modifications are within the scope of the term “consisting essentially of’ as used herein even if not separately specified. Palmityolation is a preferred modification to facilitate peptide antigen display on the surface of the liposome, which may be in a structural arrangement conducive to production of neutralizing antibodies.
  • the peptides according to the present invention can be provided in compositions suitable for the intended use for preventing and/or treating synucleinopathies, especially in pharmaceutical compositions, preferably combined with a pharmaceutically acceptable carrier.
  • Such pharmaceutical compositions can be administered to a patient in need thereof in an effective amount to achieve the preventive and/or therapeutic effect, as discussed in further detail herein.
  • the antigenic peptide according to the present invention is selected from the group consisting of GILEDMPVDPDNEA (SEQ ID NO: 1), GGKESMPVDPDNEA (SEQ ID NO: 2), GGKEDMPVDPDNEA (SEQ ID NO: 3), LESMPVDPDNES (SEQ ID NO: 4), LEKMPVDPDNEA (SEQ ID NO: 5), GGSESMPVDPDNEA (SEQ ID NO: 6), GGSESMPVDPDNES (SEQ ID NO: 7), KEDMPVDPDNEA (SEQ ID NO: 8), SESMPVDPDNEA (SEQ ID NO: 9), LESMPVDPDNEA (SEQ ID NO: 10),
  • GGKESMPVDPDNES SEQ ID NO: 11
  • KESMPVDPDNEA SEQ ID NO: 12
  • KESMPVDPDNES SEQ ID NO: 13
  • SEKMPVDPDNEA SEQ ID NO: 14
  • LEKMPVDPDNEK (SEQ ID NO: 17), GGKEKMPVDPDNEA (SEQ ID NO: 18),
  • GGKESMPVDPDNEK (SEQ ID NO: 19), GGKEKMPVDPDNEK (SEQ ID NO: 20), LEDMPVDPDNEA (SEQ ID NO: 38) and GGLEDMPVDPDNEA (SEQ ID NO: 45).
  • the antigenic peptide according to the present invention is selected from the group consisting of GGKESMPVDPDNEA (SEQ ID NO: 2),
  • GGKEDMPVDPDNEA SEQ ID NO: 3
  • LESMPVDPDNES SEQ ID NO: 4
  • GGSESMPVDPDNES SEQ ID NO: 7
  • KEDMPVDPDNEA SEQ ID NO: 8
  • SESMPVDPDNEA SEQ ID NO: 9
  • LESMPVDPDNEA SEQ ID NO: 10
  • GGKESMPVDPDNES SEQ ID NO: 11
  • KESMPVDPDNEA SEQ ID NO: 12
  • KESMPVDPDNES SEQ ID NO: 13
  • SEKMPVDPDNEA SEQ ID NO: 14
  • LEKMPVDPDNEK (SEQ ID NO: 17), GGKEKMPVDPDNEA (SEQ ID NO: 18),
  • GGKESMPVDPDNEK (SEQ ID NO: 19) and GGKEKMPVDPDNEK (SEQ ID NO: 20).
  • the antigenic peptide according to the present invention is selected from the group consisting of GGKESMPVDPDNEA (SEQ ID NO: 2), GGKEDMPVDPDNEA (SEQ ID NO: 3), LESMPVDPDNES (SEQ ID NO: 4), LEKMPVDPDNEA (SEQ ID NO: 5) and KESMPVDPDNEA (SEQ ID NO: 12).
  • the antigenic peptide according to the present invention is selected from the group consisting of GGKESMPVDPDNEA (SEQ ID NO: 2), GGKEDMPVDPDNEA (SEQ ID NO: 3), LESMPVDPDNES (SEQ ID NO: 4).
  • the antigenic peptide according to the present invention is GGKESMPVDPDNEA (SEQ ID NO: 2). In one embodiment, the antigenic peptide according to the present invention is KESMPVDPDNEA (SEQ ID NO: 12).
  • the antigenic peptide compared with the native G-I-L-E-D-M-P-V-D-P-D- N-E-A sequence.
  • the mutations are amino acid substitutions according to the options set out for each position Xi to Xe.
  • the alpha-synuclein-derived peptide antigen is displayed on the surface of the liposome. This is typically by insertion into the outer surface of the liposome. Insertion into the outer surface of the liposome may be facilitated through attachment of the alpha-synuclein-derived peptide antigen to a moiety that inserts into the outer surface of the liposome.
  • the liposome may be any liposome that is suitable to present the alpha-synuclein-derived peptide antigen on the surface and also encapsulate a peptide comprising a T-cell epitope, in particular an aSyn irrelevant peptide comprising a universal T-helper cell epitope.
  • the moiety comprises a hydrophobic moiety to ensure insertion into the lipid bilayer of a liposome.
  • the moiety may be any suitable moiety but is preferably a fatty acid.
  • the fatty acid may comprise a palmitoyl residue.
  • the liposomal composition comprises an antigenic peptide described herein attached to one or two palmitoyl residues in the N or in the C terminal regions of the peptide.
  • the antigenic peptide is mono- or di-palmitolyated on one and optionally both, of the terminal regions of the peptide. This may be facilitated by incorporating lysine residues in the N and C terminal regions of the alpha-synuclein-derived peptide antigen. The lysine residues are palmitoylated.
  • the liposomal composition comprises an antigenic peptide described herein attached to at least one palmitoyl residue in the N and C terminal regions of the antigenic peptide.
  • the antigenic peptide is dipalmitolyated. This may be facilitated by incorporating at least one lysine residue in the N and C terminal regions of the alpha-synuclein-derived peptide antigen.
  • the lysine residues are palmitoylated.
  • the liposomal composition comprises the antigenic peptide attached to two palmitoyl residues in the N and C terminal regions of the peptide.
  • the antigenic peptide is tetrapalmitolyated. This may be facilitated by incorporating two lysine residues in the N and C terminal regions of the alpha-synuclein-derived peptide antigen.
  • the lysine residues are palmitoylated.
  • the liposomal vaccine compositions of the invention comprise a peptide comprising a T- cell epitope, in particular a T-helper cell epitope.
  • the peptide comprising a T-cell epitope comprises at least two T-cell epitopes.
  • the peptide comprising a T-cell epitope may be at least partially encapsulated in the liposome and/or may be also presented on the surface of the liposome and/or may be at least partially incorporated into the lipid bilayer of the liposome. It is preferred that the peptide comprising a T-cell epitope is encapsulated. This is typically achieved by forming the liposome in a solution containing the peptide comprising a T-cell epitope.
  • a proportion of the peptide comprising a T-cell epitope may adsorb to the outer surface of the liposome and a proportion of the peptide comprising a T-cell epitope may become incorporated into the lipid bilayer of the liposome.
  • an encapsulated T-cell epitope it is intended to mean that at least some of the peptide comprising a T-cell epitope is encapsulated.
  • the total peptide comprising a T-cell epitope which is associated with the liposome may represent at least 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80% or 90% (with the remainder adsorbed to the surface and incorporated in the lipid bilayer).
  • the precise degree of encapsulation will depend upon the properties of the peptide comprising a T- cell epitope.
  • the liposomal vaccine composition comprises at least one or at least two (2) T-cell epitopes.
  • the T-cell epitopes can be at least two (2) linear T-cell epitopes, or a conjugate of several T-cell epitopes linked together with or without a spacer.
  • the T-cell epitopes comprises several T-cell epitopes linked together with a spacer comprising at least one amino acid, preferably at least three amino acids, more preferably an amino acid sequence comprising VVR.
  • the conjugate comprises at least two, three or four different T-cell epitopes encapsulated within the liposome.
  • the T-cell epitopes are derived from diphtheria toxin, tetanus toxin, Epstein Barr Virus, influenza hemagglutinin and/or keyhole limpet hemocyanin.
  • Specific preferred combinations of T-cell epitopes are therefore selected from: a) A combination of a diphtheria toxin and tetanus toxin T-cell epitope b) A combination of an Epstein Barr Virus and tetanus toxin T-cell epitope c) A combination of an Epstein Barr Virus, tetanus toxin and keyhole limpet hemocyanin T-cell epitope; or d) A combination of an influenza hemagglutinin, diphtheria toxin, tetanus toxin and Epstein Barr Virus T-cell epitope.
  • T-cell epitopes Whilst the above combinations are preferably included in the order specified, they may be included in an alternative order. For example, if there are three T-cell epitopes, A, B and C, they may be included in any of orders ABC, ACB, BAC, BCA, CAB or CBA.
  • peptides are preferably included in the vaccine compositions of the invention.
  • peptides useful in the invention comprise, consist essentially of or consist of an amino acid sequence selected from SEQ ID NO: 21 (SAT13), SEQ ID NO: 22 (SAT15), SEQ ID NO: 23 (SAT17), SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and/or any combination thereof.
  • the T-cell epitope comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27 and/or any combination thereof.
  • the T-cell epitope comprises, consists essentially of or consists of SEQ ID NO: 24. In some embodiments, the T-cell epitope comprises, consists essentially of or consists of SEQ ID NO: 25. In some embodiments, the T-cell epitope comprises, consists essentially of or consists of SEQ ID NO: 26. In some embodiments, the T-cell epitope comprises, consists essentially of or consists of SEQ ID NO: 27. In other embodiments, the T-cell epitope comprises at least two amino acid sequences selected from SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 and SEQ ID NO: 27.
  • the T-cell epitope comprises at least three amino acid sequences selected from SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 and SEQ ID NO: 27. In a most preferred embodiment the T-cell epitope comprises SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 and SEQ ID NO: 27. Combinations of these peptides, trimmed to 10-20 amino acids in length as appropriate, can also be included in the vaccine compositions of the invention. The combined peptides are preferably joined by one or more linkers as defined herein.
  • the T-cell epitopes of the invention may include one or more modifications, such as, but not limited to amino acid substitutions and post-translational modification. In a more preferred embodiment, the T-cell epitopes of the inventions include one to five amino acid modifications.
  • Pan DR epitope (PADRE or PaDre) peptides having sequence AKFVAAWTLKAAA (SEQ ID NO: 35) are known, see, e.g., Alexander et al. (1994), and de Guercio et a.l (1997). It has been found that PADRE peptides are peptides that deliver help for antibody responses and provide helper T-cell activity in vivo. These properties suggest that constructs containing the PADRE peptides might be as efficient at generating an immune response as large multivalent antigens.
  • P2 having the amino acid sequence: QYIKANSKFIGITEL (SEQ ID NO: 36)
  • P30 peptides having the amino acid sequence: FNNFTVSFWLRVPKVSASHLE (SEQ ID NO: 37)
  • tetanus toxin see, e.g., Panina-Bordignon et al (1989); and Boeckler et al., (1999).
  • the liposomal vaccine composition of the invention comprises a universal T-cell epitope comprising, consisting essentially of or consisting of an amino acid sequence selected from SEQ ID NO: 29 (SAT42), SEQ ID NO: 32 (SAT47) or a close sequence analogue as defined herein. In some embodiments, the liposomal vaccine composition of the invention comprises a universal T-cell epitope comprising, consisting essentially of or consisting of SEQ ID NO: 32 (SAT47) or a close sequence analogue as defined herein.
  • the liposomal vaccine composition of the invention comprises a peptide having a universal T-cell epitope comprising, consisting essentially of, or consisting of SEQ ID NO: 32 (SAT47) or SEQ ID NO: 33 (SAT58). In some embodiments, the liposomal vaccine composition of the invention comprises a peptide having a universal T-cell epitope comprising, consisting essentially of, or consisting of SEQ ID NO: 33 (SAT58).
  • the combination of T-cell epitopes are provided in a peptide comprising the amino acid sequence of SEQ ID NO: 29 (SAT42), SEQ ID NO: 30 (SAT43), SEQ ID NO: 31 (SAT44), SEQ ID NO: 32 (SAT47), SEQ ID NO: 35 (PaDre), SEQ ID NO: 36 (P2), SEQ ID NO: 37 (P30), SEQ ID NO: 21 (SAT 13), SEQ ID NO: 22 (SAT 15), SEQ ID NO: 23 (SAT 17), SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26 or SEQ ID NO: 27, or a variant (which may be referred to as a close sequence analogue) having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or preferably 99% sequence identity therewith or a variant comprising between one and five amino acid substitutions, with the proviso that the resultant peptide retains a T-cell epitope.
  • a variant which may be
  • the combination of T-cell epitopes are provided in a peptide comprising the amino acid sequence of SEQ ID NO: 32 (SAT47), or a variant (which may be referred to as a close sequence analogue) having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or preferably 99% sequence identity therewith or a variant comprising between one and five amino acid substitutions, with the proviso that the resultant peptide retains a T-cell epitope.
  • SAT47 amino acid sequence of SEQ ID NO: 32
  • a variant which may be referred to as a close sequence analogue having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or preferably 99% sequence identity therewith or a variant comprising between one and five amino acid substitutions, with the proviso that the resultant peptide retains a T-cell epitope.
  • the combination of T-cell epitopes are provided in a peptide comprising the amino acid sequence of SEQ ID NO: 33 (SAT58), or a variant (which may be referred to as a close sequence analogue) having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or preferably 99% sequence identity therewith or a variant comprising between one and five amino acid substitutions, with the proviso that the resultant peptide retains a T-cell epitope.
  • SAT58 amino acid sequence of SEQ ID NO: 33
  • the liposomal vaccine composition of the invention comprises a peptide comprising the amino acid sequence of SEQ ID NO: 29 (SAT42), SEQ ID NO: 32 (SAT47) or a close sequence analogue thereof as defined herein.
  • the liposomal vaccine composition comprises a peptide comprising the amino acid sequence of SEQ ID NO: 32 (SAT 47) or a close sequence analogue thereof.
  • the liposomal vaccine composition may comprise a peptide comprising the amino acid sequence of SEQ ID NO 33 (SAT58).
  • the T-cell epitopes may be encapsulated or displayed on the surface of the liposome. Depending on the nature of the T-cell epitope, it may to some extent bind or associate with the liposome membrane enabling some level of surface display and/or some level within the liposomal membrane.
  • the liposome has a negative surface charge; the liposome is anionic.
  • the liposome comprises phospholipids and even more preferably, the phospholipids comprise dimyrsitoylphosphatidyl-choline (DMPC) and dimyrsitoylphosphatidyl-glycerol (DMPG).
  • DMPC dimyrsitoylphosphatidyl-choline
  • DMPG dimyrsitoylphosphatidyl-glycerol
  • the liposome may further comprise cholesterol.
  • the molar ratios of these three components may be 9: 1 :7 in some embodiments.
  • compositions of the invention typically comprise at least one adjuvant.
  • the compositions of the invention comprise two adjuvants.
  • the purpose of the adjuvant(s) is to increase or stimulate the immune response in the subject.
  • the at least one adjuvant is part of the carrier (as opposed to being encapsulated within the carrier).
  • the at least one adjuvant may form part of a liposome; it may form part of the lipid bilayer.
  • the adjuvant may be a TLR agonist.
  • the adjuvant may therefore be a lipid-based adjuvant.
  • the adjuvant may be, at least in part, displayed on the surface of the liposome; this may be as a consequence of the adjuvant forming part of the lipid bilayer.
  • the adjuvant may comprise a TLR4 agonist and/or a TLR9 agonist.
  • TLR4 ligands useful for the invention include a TLR4 agonist, including, but not limited to, monophosphoryl lipid A (MPLA).
  • MPLA monophosphoryl lipid A
  • MPLA refers to a modified form of lipid A, which is the biologically active part of Gram-negative bacterial lipopolysaccharide (LPS) endotoxin.
  • LPS Gram-negative bacterial lipopolysaccharide
  • MPLA is less toxic than LPS while maintaining the immunostimulatory activity.
  • MPLA stimulates both cellular and humoral responses to the vaccine antigen.
  • MPLA examples include, but are not limited to, 3 -O-desacyl-4 '-monophosphoryl lipid A, monophosphoryl hexa-acyl lipid A, 3 -deacyl, monophosphoryl 3 -deacyl lipid A, and structurally related variants thereof.
  • MPLA useful for the invention can be obtained using methods known in the art, or from a commercial source, such as 3D-(6-acyl) PHAD®, PHAD®, PHAD®-504, 3D-PHAD® from Avanti Polar Lipids (Alabaster, Alabama, USA) or MPLTM from various commercial sources.
  • the TLR4 agonist is MPLA.
  • TLR9 ligands useful for the invention include a TLR9 agonist including, but not limited to, CpG oligonucleotides.
  • adjuvants that may be employed according to the invention include aluminium hydroxide (Alum) and/or CpG amongst others.
  • Alum aluminium hydroxide
  • CpG any suitable CpG known to those skilled in the art can be used in the invention in view of the present disclosure.
  • Examples of such CpG oligonucleotides include, but are not limited to CpG2006 (also known as CpG 7909), CpG 1018, CpG2395, CpG2216 or CpG2336.
  • a CpG can be lipidated using methods known in the art in view of the present disclosure.
  • CpG oligonucleotide 3' terminus or 5’ terminus of a CpG oligonucleotide is covalently linked to a cholesterol molecule through a phosphate bond, optionally via a PEG linker.
  • a preferred adjuvant is CpG-chol (cholesterol).
  • the CpG comprises CpG 2006 (also known as CpG 7909) as defined by the following nucleotide sequence (SEQ ID NO: 34):
  • a liposomal vaccine composition comprises: a.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20;
  • a peptide comprising a T-cell epitope and c.
  • the liposomal vaccine composition comprises: a.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20;
  • b. A peptide comprising a T-cell epitope; and c.
  • An adjuvant, wherein the adjuvant comprises at least one TLR ligand.
  • the liposomal vaccine composition comprises: a.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20;
  • b. A peptide comprising a T-cell epitope; and c.
  • the liposomal vaccine composition comprises: a.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20; b.
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27 or any combination thereof; and c.
  • the liposomal vaccine composition comprises: a.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, and SEQ ID NO: 20; b.
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; and c.
  • An adjuvant wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 24 and/or SEQ ID NO: 25 and/or SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • MPLA monophosphoryl lipid A
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 24, and SEQ ID NO: 25, and SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • MPLA monophosphoryl lipid A
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 46 and/or SEQ ID NO: 25 and/or SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 or
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5 or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 46, and SEQ ID NO: 25, and SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • MPLA monophosphoryl lipid A
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 46, and/or SEQ ID NO: 25, and/or SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • MPLA monophosphoryl lipid A
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, or SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of, or consists of the amino acid sequence of SEQ ID NO: 46, and SEQ ID NO: 25, and SEQ ID NO: 27 and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand, preferably monophosphoryl lipid A (MPLA), and/or a toll-like receptor 9 ligand, preferably CpG.
  • MPLA monophosphoryl lipid A
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4; b. a peptide comprising a T-cell epitope; and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 12; b. a peptide comprising a T-cell epitope; and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4; b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27 or any combination thereof; and c. an adjuvant.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4
  • b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 12; b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequences SEQ ID NO: 24 and SEQ ID NO: 25 and SEQ ID NO: 26, and SEQ ID NO: 27 or any combination thereof; and c. an adjuvant.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 12
  • b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, and SEQ ID NO: 4; b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 46, SEQ ID NO: 25, SEQ ID NO: 26, and SEQ ID NO: 27, and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 12; b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 46 and SEQ ID NO: 25 and SEQ ID NO: 26, and SEQ ID NO: 27; and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32 and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 33 (SAT58) and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32 and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 12, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 33 (SAT58) and c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 33 (SAT58); and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand and/or a tolllike receptor 9 ligand.
  • the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA) and the toll-like receptor 9 ligand comprises CpG.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4
  • b) a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 12; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 12
  • b) a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of S
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID No: 4, SEQ ID NO: 5 or SEQ ID NO: 12; and b) a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 32 (SAT47) or a close sequence analogue thereof; and c) an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand; and wherein the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA).
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID No: 4, SEQ ID NO: 5 or SEQ ID NO:
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2, b) a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 32 (SAT47) or a close sequence analogue thereof; and c) an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand and/or a toll-like receptor 9 ligand; and wherein the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA), wherein the toll-like receptor 9 ligand comprises CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 2
  • a peptide comprising a T-cell epitope which comprises, consists essentially
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 2
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32
  • SAT47 a TLR4 ligand comprising monophospho
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 33 (SAT58); c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a liposomal vaccine composition comprising: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID No: 4, SEQ ID NO: 5 or SEQ ID NO: 12; and b) a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 33 (SAT58); and c) an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand; and wherein the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA).
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID No: 4, SEQ ID NO: 5 or SEQ ID NO: 12; and b) a
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 3; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 3
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32
  • SAT47 a TLR4 ligand comprising monophospho
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 4; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 4
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32
  • SAT47 a TLR4 ligand comprising monophospho
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 12; b) a peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) a TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) a TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 12
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32
  • SAT47 a TLR4 ligand comprising monophospho
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4; b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N and/or in the C terminal regions of the peptide.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 12; b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N and/or in the C terminal regions of the peptide.
  • a liposomal vaccine composition comprises: d) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4; e) a peptide comprising a T-cell epitope; and f) an adjuvant, wherein the peptide antigen comprises two palmitoyl residues in the N or in the C terminal regions of the peptide.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4; b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises two palmitoyl residues in the N and in the C terminal regions of the peptide.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 or SEQ ID NO: 12; b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N terminal regions of the peptide.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 2, b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N terminal regions of the peptide.
  • a liposomal vaccine composition comprises: a) a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 12, b) a peptide comprising a T-cell epitope; and c) an adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N terminal regions of the peptide.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope; and c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, or SEQ ID NO: 27 or any combination thereof; and c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 24 and SEQ ID NO: 25 and SEQ ID NO: 26 and SEQ ID NO: 27. c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 46, SEQ ID NO: 25, SEQ ID NO: 26 or SEQ ID NO: 27. c. an adjuvant.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of an amino acid sequence SEQ ID NO: 46 and SEQ ID NO: 25 and SEQ ID NO: 26 and SEQ ID NO: 27. c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; and c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 33 (SAT58); and c. an adjuvant, wherein the adjuvant comprises at least one of a TLR4 ligand and/or a TLR9 ligand.
  • the liposomal vaccine composition comprises: a. a peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of an amino acid sequence selected from SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45, b. a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of the amino acid sequence of SEQ ID NO: 33 (SAT58); and c. an adjuvant; wherein the adjuvant comprises a toll-like receptor 4 ligand and/or a tolllike receptor 9 ligand.
  • the toll-like receptor 4 ligand comprises monophosphoryl lipid A (MPLA) and the toll-like receptor 9 ligand comprises CpG.
  • a liposomal vaccine composition comprises: a) A peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45; b) A peptide comprising a T-cell epitope, which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of SEQ ID NO: 32; c) A TLR4 ligand comprising monophosphoryl lipid A (MPLA); and d) A TLR9 ligand comprising CpG.
  • a peptide antigen displayed on the surface of the liposome which comprises, consists essentially of or consists of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45
  • a peptide comprising a T-cell epitope which comprises, consists essentially of or consists of SEQ ID NO: 32 (SAT47) or a close sequence analogue of S
  • a liposomal vaccine composition comprises: a) A peptide antigen displayed on the surface of the liposome, which comprises, consists essentially of or consists of SEQ ID NO: 1, SEQ ID NO: 38, and SEQ ID NO: 45; b) A peptide comprising a T-cell epitope; and c) An adjuvant, wherein the peptide antigen comprises one or two palmitoyl residues in the N and/or in the C terminal regions of the peptide.
  • the liposomal vaccine compositions of the invention can be administered a single time to the subject to generate a protective immune response. However, in some embodiments, the vaccine compositions of the invention are administered multiple times to the same subject. Thus, so-called prime-boost regimens may be employed according to the invention. Administration of the vaccine is typically separated by an intervening period of at least 1 week and often around 1-12 months.
  • the timing of administration can vary significantly from once a day, to once a year, to once a decade.
  • a typical regimen consists of an immunization followed by booster administration (e.g. by injection) at regular time intervals, such as 4- to 6-week intervals.
  • booster administration e.g. by injection
  • less regular booster administration such as annual boosting may be preferred for reasons of convenience and compliance.
  • One or more immunizations can be administered.
  • a typical regimen consists of an immunization followed by booster injections at time intervals, such as 4-6 weeks intervals.
  • Another regimen may consist of an immunization followed by booster injections 1, 2, 6, 9 and/or 12 months later.
  • booster injections can be on an irregular basis as indicated by monitoring of immune response (e.g. when the level of the antibodies is below a threshold determined by a doctor or a person skilled in the art).
  • the vaccine compositions of the invention represent a powerful new therapeutic option for prevention and treatment of a disease, disorder or abnormality associated with alpha-synuclein aggregates including, but not limited to, Lewy bodies and/or Lewy neurites and/or glial cytoplasmic inclusions, such as Parkinson’s disease, Multiple System Atrophy, Lewy Body dementia (LBD; dementia with Lewy bodies (DLB) (“pure” Lewy body dementia), Parkinson’s disease dementia (PDD)), or Diffuse Lewy Body Disease.
  • LBD Lewy Body dementia
  • DBD Parkinson’s disease dementia
  • the same vaccine composition is administered each time - a homologous vaccination regimen.
  • Homologous vaccination refers to an immunization regimen using the same vaccine for both the prime (first immunization) and boost (second or any further immunization).
  • vaccine compositions of the invention may be administered to the subject by any appropriate route of administration.
  • vaccine compositions may be administered by topical, oral, rectal, nasal or parenteral (such as intravenous, intradermal, subcutaneous, or intramuscular) routes.
  • vaccine compositions may be incorporated into sustained release matrices such as biodegradable polymers, the polymers being implanted in the vicinity of, or in close proximity to, where delivery is desired.
  • sustained release matrices such as biodegradable polymers, the polymers being implanted in the vicinity of, or in close proximity to, where delivery is desired.
  • the vaccine composition is administered intramuscularly or subcutaneously.
  • the vaccine compositions of the invention are administered to subjects in order to treat, prevent, induce a protective immune response against or alleviate the symptoms associated with a disease, disorder or abnormality associated with alpha-synuclein aggregates.
  • the vaccine compositions can thus have both prophylactic and therapeutic applications.
  • the subject is a mammal and typically a human.
  • the disease, disorder or abnormality associated with alpha- synuclein aggregates is a synucleinopathy.
  • the disease, disorder or abnormality associated with alpha-synuclein aggregates, or the synucleinopathy may be selected from the group consisting of: the Parkinson’s disease (sporadic, familial with alpha-synuclein mutations, familial with mutations other than alpha-synuclein, pure autonomic failure and Lewy body dysphagia), Lewy Body dementia (LBD; dementia with Lewy bodies (DLB) (“pure” Lewy body dementia), Parkinson’s disease dementia (PDD)), diffuse Lewy body disease (DLBD), sporadic Alzheimer’s disease, familial Alzheimer’s disease with APP mutations, familial Alzheimer’s disease with PS-1, PS-2 or other mutations, familial British dementia, Lewy body variant of Alzheimer’s disease, and Down syndrome, multiple system atrophy (Shy -Drager syndrome, striatonigral degeneration and olivopontocerebellar atrophy), traumatic brain injury, chronic traumatic encephal
  • the disease, disorder or abnormality associated with alpha-synuclein aggregates, or the synucleinopathy is selected from the group consisting of Lewy bodies and/or Lewy neurites and/or glial cytoplasmic inclusions, such as Parkinson’s disease, Multiple System Atrophy, Lewy Body dementia (LBD; dementia with Lewy bodies (DLB) (“pure” Lewy body dementia), Parkinson’s disease dementia (PDD)), or Diffuse Lewy Body Disease.
  • LBD Lewy Body dementia
  • DBD dementia with Lewy bodies
  • Parkinson’s disease dementia dementia
  • the disease, disorder or abnormality associated with alpha-synuclein aggregates, or the synucleinopathy is Parkinson’s disease or Multiple System Atrophy, more preferably Multiple System Atrophy.
  • the invention provides a method of treating, preventing, inducing a protective immune response against or alleviating the symptoms associated with alpha-synuclein aggregates in a subject, the method comprising administering a vaccine composition of the invention to the subject.
  • the invention also provides a vaccine composition of the invention for use in treating, preventing, inducing a protective immune response against or alleviating the symptoms associated with a disease, disorder or abnormality associated with alpha-synuclein aggregates in a subject.
  • the invention further includes administering to the subject the liposomal vaccine composition or the pharmaceutical composition according to the invention for inducing an immune response against alpha-synuclein aggregates.
  • the invention further includes administering to the subject the liposomal vaccine composition or the pharmaceutical composition according to the invention for inducing an immune response against alpha-synuclein protein.
  • administering to the subject the liposomal vaccine composition or the pharmaceutical composition according to the invention induces a protective immune response against alpha-synuclein aggregates.
  • administering to the subject the liposomal vaccine composition or the pharmaceutical composition according to the invention induces an immune response against alpha-synuclein protein, preferably human alpha-synuclein protein.
  • the invention provides for the use of the vaccine compositions of the invention in the manufacture of a medicament for use in treating, preventing, inducing a protective immune response against or alleviating the symptoms associated with a disease, disorder or abnormality associated with alpha-synuclein aggregates in a subject.
  • the present invention provides Liposomal vaccine compositions comprising the antigenic peptide in a therapeutically effective amount.
  • therapeutically effective amount refers to the amount of antigenic/immunogenic composition which, when administered to a human or animal, elicits an immune response. The effective amount is readily determined by one of skill in the art following routine procedures.
  • kits containing vaccine compositions according to the invention Accordingly, there is provided a kit for treating, preventing, inducing a protective immune response against or alleviating the symptoms associated with a disease, disorder or abnormality associated with alpha-synuclein aggregates in a subject comprising a liposomal vaccine composition of the invention as described herein. Such kits may be provided with suitable instructions for use.
  • the instructions for use may explain the administration schedule for the compositions.
  • the kits may therefore comprise multiple (separate) doses of the vaccine compositions of the invention.
  • the instructions for use may further explain the storage conditions for the compositions, particularly during the time period between administration of the doses of the vaccine compositions. These kits may be applied to all relevant methods of the invention as disclosed herein.
  • Methods for producing liposomal vaccine compositions of the invention may rely upon crossflow injection, as exemplified herein. Such methods may comprise the following steps: a) Dissolving the lipids (and adjuvant, if lipid based) that form the liposome in solution b) Dissolving the peptide comprising a (universal) T-cell epitope in solution c) Mixing the solutions from steps a. and b.
  • the methods use crossflow injection to encapsulate the peptide comprising a universal T-cell epitope and to insert the alpha-synuclein-derived peptide antigen into the lipid bilayer of the liposomes.
  • T-cell epitope is meant an epitope that is specific to T-cells that are present in the majority of the human population. They commonly originate from antigens to which humans are normally exposed during their lifetime. Examples include antigens incorporated in routinely administered vaccines. Specific examples of T-cell epitopes include, but are not limited to, tetanus, influenza and diphtheria (including non-toxic mutants thereof such as CRM 197), Keyhole limpet hemocyanin (KLH), Epstein Barr virus (EBV) and PaDre (pan HLA DR- binding Epitope).
  • KLH Keyhole limpet hemocyanin
  • EBV Epstein Barr virus
  • PaDre pan HLA DR- binding Epitope
  • T-cell epitope to activate T cells is the result of at least two complementary properties: i) affinity of binding to the HLA groove, meaning the strength of the binding, as well as ii) its capacity to bind differrent HLA haplotypes in a promiscuous manner, meaning the ability to cover very diverse human populations, with regards to the differences in the expression of HLA molecules.
  • the T-cell epitopes may bind to a majority of MHC class II alleles present in the human population.
  • the T-cell epitopes included in the vaccine compositions of the invention may thus be capable of stimulating a CD4 T-cell response.
  • the T-cell epitopes included in the vaccine compositions of the invention may thus be capable of stimulating a helper T-cell response that enhances alpha-synuclein related antibody production by B-cells. They may be referred to as “universal” T-cell epitopes herein, a term commonly used in the art.
  • T-cell epitope herein is therefore to be understood as an epitope capable of stimulating a helper T-cell or T-cell helper response.
  • a “close sequence analogue” of the invention may include one or more modifications, such as, but not limited to amino acid substitutions, post-translational modification, extensions (addition of additional amino acids), shortening the length (removal of some amino acids), of a herein described sequence.
  • a close sequence analogue of the T- cell epitopes of the inventions include one to five amino acid modifications, preferably one, two or three modifications.
  • TLR4 refers to any compound that acts as an agonist of TLR4. Any suitable TLR4 agonist known to, or discovered by, those skilled in the art can be used in the invention. Examples of TLR4 ligands useful for the invention include TLR4 agonists, including, but not limited to, monophosphoryl lipid A (MPLA).
  • MPLA monophosphoryl lipid A
  • TLR9 refers to any compound that acts as an agonist of TLR9. Any suitable TLR9 agonist known to, or discovered by, those skilled in the art can be used in the invention. Examples of TLR9 ligands useful for the invention include TLR9 agonists including, but not limited to, CpG oligonucleotides.
  • Pharmaceutically acceptable carriers, diluents, adjuvants and excipients are well known in the pharmaceutical art and are described, for example, in Remington’s Pharmaceutical Sciences, 15 th or 18 th Ed. (Alfonso R. Gennaro, ed.; Mack Publishing Company, Easton, PA, 1990); Remington: the Science and Practice of Pharmacy 19 th Ed. (Lippincott, Williams & Wilkins, 1995); Handbook of Pharmaceutical Excipients, 3 rd Ed. (Arthur H. Kibbe, ed.; Amer. Pharmaceutical Assoc, 1999); Pharmaceutical Codex: Principles and Practice of Pharmaceutics 12 th Ed.
  • the carriers, diluents, adjuvants and pharmaceutical excipients can be selected with regard to the intended route of administration and standard pharmaceutical practice. These compounds must be acceptable in the sense of being not deleterious to the recipient thereof. See Remington’s Pharmaceutical Sciences, 15 th or 18 th Ed. (Alfonso R. Gennaro, ed.; Mack Publishing Company, Easton, PA, 1990); Remington: the Science and Practice of Pharmacy 19 th Ed. (Lippincott, Williams & Wilkins, 1995); Handbook of Pharmaceutical Excipients, 3 rd Ed. (Arthur H. Kibbe, ed.; Amer. Pharmaceutical Assoc, 1999); Pharmaceutical Codex: Principles and Practice of Pharmaceutics 12 th Ed.
  • liposomal vaccine composition may be used interchangeably with “liposomal immunogenic composition” herein.
  • a “close sequence analogue” of the invention may include one or more modifications, such as, but not limited to amino acid substitutions, post- translational modification, extensions (addition of additional amino acids), shortening the length (removal of some amino acids), of a herein described sequence.
  • amino acid is typically the natural amino acid.
  • the reference to an amino acid also encompasses non-natural amino acids (e.g., beta-amino acids, gamma-amino acids, D-amino acids) and, in the context of an overall peptide, a combination of natural and non-natural amino acids.
  • the native sequence of human alpha-synuclein is: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVA TVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAP QEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA (SEQ ID NO: 28).
  • an “immune response” involves the production of anti-aSyn antibodies, preferably of antibodies that specifically bind to alpha-synuclein.
  • the production of such antibodies can be tested by any suitable method, such as an immunoassay, and specifically by ELISA.
  • Figure l is a graph showing IgG titers against SEQ ID NO:2 peptide in mice immunized with SEQ ID NO:2 -liposomal or SEQ ID NO:2 conjugate vaccines.
  • the Y axis shows anti-SEQ ID NO: 2 IgG titers (AU/mL) and the X axis shows time measured by days post immunization.
  • the liposomal vaccine treated group black circles
  • Figure 2 is a graph showing IgG titers against a-syn protein in mice immunized with SEQ ID NO:2 -liposomal or SEQ ID NO:2 conjugate vaccines.
  • the Y axis shows anti-a-syn protein IgG titers (AU/mL) and the X axis shows time measured by days post immunization.
  • the liposomal vaccine treated group black circles
  • Figure 3 is a graph showing IgG titers against a-syn aggregates in mice immunized with SEQ ID NO:2 -liposomal or SEQ ID NO:2 conjugate vaccines.
  • the Y axis shows anti-a-syn aggregates IgG titers (AU/mL) and the X axis shows time measured by days post immunization.
  • the liposomal vaccine treated group black circles
  • the vaccine is produced as follows in a three-step approach, i.e., preparation of intermediate liposome followed by integration of CpG-Chol to generate the fully adjuvanted liposomes and finally insertion of an antigenic peptide.
  • lipids DMPG, DMPC, cholesterol and monophosphoryl Hexaacyl Lipid A, 3-Deacyl, the first adjuvant
  • lipid/ethanol solution is filtered through a 0.2 pm pore size filter into an injection system preheated at 60°C.
  • the peptide comprising a T-cell epitope e.g. SAT47, or a close sequence analogue
  • 10 mM Histidine, 250 mM Sucrose This solution is filtered through a 0.2 pm pore size filter and heated to 40°C.
  • the lipid/ethanol solution and the peptide comprising a T-cell epitope (e.g. SAT47 or a close sequence analogue) solution are then mixed using a crossflow injection module to form the intermediate liposomes, which are subsequently subjected to active cooling followed by size reduction using repeated extrusion cycles. Finally ultra-/diafiltration (UDF) is performed to remove ethanol.
  • the intermediate liposomes are filtered through a 0.2 pm pore size filter and stored at 4°C until used.
  • CpG-Chol integration The intermediate liposomes are diluted to a concentration of 1 mg/mL of lipid and warmed up to 60°C.
  • the second adjuvant, CpG-Chol is added to the liposomes dropwise.
  • the liposomal dispersion is incubated at 60°C for an additional 30 minutes whilst stirring.
  • the fully adjuvanted liposomes are purified by UDF and then filtered through a 0.45 pm followed by a 0.2 pm pore size filter and stored at 4°C.
  • Alpha-synuclein (Asyn) derived antigenic peptide insertion The fully adjuvanted liposomes are diluted to a desired concentration of lipid. Concomitantly, the palmitoylated antigenic peptide (such as a peptide having the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 3 or SEQ ID NO: 4) is dissolved to a final concentration between 0.1 and 10 mg/mL of peptide. The liposomes and the peptide solution are finally mixed using a crossflow module and the liposomal dispersion is incubated at temperature between 30°C and 60°C under stirring. A UDF step is performed to exchange the buffer to the formulation system. The product is concentrated down to its final volume, filtered through a 0.45 pm pore size filter followed by a 0.2 pm pore size filter. The bulk drug product is stored at 4°C.
  • 96-well plates (Nunc-Maxisorp) were coated with recombinant human alpha synuclein (1 pg/ml) and titers were calculated as EC50-values with PRISM® 5.04 (GraphPad Inc, San Diego, CA) by non-linear regression analysis (four-parameter logistic fit function).
  • Table 2 Treatment groups and the peptide sequences present in individual vaccines are shown. Group one was immunized with the vaccine containing the native sequence for direct comparison.
  • Vaccines containing peptides with either serine exchanges at position 1 and 3 (group 3) or at position 3 and 12 (group 2) induced 4 to 6 times higher alpha synuclein-specific IgG responses than the vaccine containing the native peptide sequence (group 1).
  • Vaccines containing peptides with serine exchanges at position 4 (groups 4, 6 and 7) did not increase the immunogenicity as significantly relative to the vaccine containing the native sequence (Table 3).
  • a vaccine containing peptides with serine exchanges at positions 1 and 12 (group 5) increased the immunogenicity less than two-fold relative to the vaccine containing the native sequence (Table 3).
  • Table 3 The titers to alpha synuclein were evaluated in single mice and values represent medians relative to the median obtained with the native sequence.
  • Table 4 Treatment groups and the peptide sequences present in individual vaccines are shown. Group one was immunized with the vaccine containing the peptide sequence LESMPVDPDNES (group 2 Table 2) for bridging this experiment to the previous experiment.
  • Table 5 The titers to alpha synuclein were evaluated in single mice and values represent medians relative to the median obtained with the vaccine containing the antigenic peptide LESMPVDPDNES.
  • SEQ ID NO: 2 liposomal vaccine a liposomal vaccine containing SEQ ID NO: 2 as antigenic peptide
  • SEQ ID NO: 2 conjugate vaccine a protein-conjugate vaccine containing SEQ ID NO:2 as antigenic peptide coupled to the protein carrier CRM197
  • the vaccine is produced as follows in a three-step approach, according to Example 1,.
  • lipids DMPG, DMPC, cholesterol and monophosphoryl Hexaacyl Lipid A, (3D-(6-acyl) PHADTM (Avanti Polar Lipids, USA)
  • the first adjuvant were dissolved in ethanol at 60°C.
  • the lipid/ethanol solution is filtered through a 0.2 pm pore size filter into an injection system preheated at 60°C.
  • the peptide comprising T-cell epitope SAT58 was dispersed in ethanol at room temperature by the aid of sonication and solubilized by dilution with 10 mM Histidine, 250 mM Sucrose.
  • the SAT58 solution was filtered through a 0.2 pm pore size filter and heated up to 40°C.
  • the lipid/ethanol solution and the SAT58 solution were then mixed using a crossflow injection module to form the intermediate liposomes, which were subsequently subjected to active cooling followed by size reduction using repeated extrusion cycles. Finally ultra-/diafiltration (UDF) was performed to remove ethanol.
  • the intermediate SAT58 liposomes were filtered through a 0.2 pm pore size filter and stored at 4°C until used.
  • CpG-Chol integration The intermediate liposomes were diluted to a concentration of 1 mg/mL of lipid in 20 mM Histidine, 145 mM NaCl and warmed up to 60°C.
  • the second adjuvant, CpG-Cholesterol was added to the liposomes dropwise.
  • the liposomal dispersion was incubated at 60°C for an additional 30 minutes whilst stirring.
  • the fully adjuvanted liposomes were purified by UDF and then filtered through a 0.45 pm followed by a 0.2 pm pore size filter and stored at 4°C.
  • Alpha-synuclein (Asyn) derived antigenic peptide insertion The fully adjuvanted liposomes were diluted to a concentration of 1 mg/mL of total lipid content in 20 mM Histidine, 145 mM NaCl. Concomitantly, the N-terminal di-palmitoylated SEQ ID NO:2 peptide was dissolved to a final concentration of 1 mg/mL in 20 mM Histidine, 145 mM NaCl at 60°C and the solution was filtered through a 0.2 pm pore size filter.
  • the liposomes and the peptide solution were finally mixed using a crossflow module and the liposomal dispersion was incubated at temperature of 60°C under stirring for 30 minutes.
  • a UDF step was performed to exchange the buffer to the final formulation system i.e. with 10 mM Histidine, 250 mM Sucrose buffer .
  • the product was concentrated down to its final volume, filtered through a 0.45 pm pore size filter followed by a 0.2 pm pore size filter.
  • the bulk drug product was stored at 4°C.
  • the SEQ ID NO: 2 conjugate vaccine is a conjugate of the antigenic peptide SEQ ID NO: 2 to the carrier protein CRM197.
  • the antigenic peptide is modified so as that it contains a cysteine residue.
  • the antigenic peptide is coupled to the carrier protein CRM197 through the cysteine residue.
  • the conjugation is a directed procedure using the side chain amino groups of lysine residues in CRM 197 and the free thiol group of the amino (N) -terminal cysteine in the peptide.
  • the aqueous CRM197 solution is adjusted to 10 mM phosphate buffered saline (PBS) and is then gently shaken with the bifunctional linker 4- maleimidobutyric acid N-hydroxysuccinimide ester (GMBS). Subsequently, excess of unreacted GMBS is removed by either dialysis or ultrafiltration.
  • mice in group 1 A total of 20 C57BL/6J female mice, approximately 10 weeks old at 1 st immunization, were allocated to two groups (10 mice in group 1 and 10 mice in group 2) as indicated in Table 6. The two groups were immunized three times by subcutaneous (s.c) injection into the subcutis of the dorsum on Days 1, 15 and 29 with either SEQ ID NO:2 conjugate vaccine (group 1) or SEQ ID NO: 2 liposomal vaccine (group 2).
  • Immunogenicity against SEQ ID NO:2 peptide, a-syn full-length human protein and a-syn aggregates was assessed in plasma samples collected on day 1 (pre-dose before the first administration) and one week after each immunization (on Days 8, 22 and 36).
  • the a-syn aggregates were prepared according to the protocol described by Kumar et al. 2020.
  • the anti-SEQ ID NO: 2, anti-a-syn protein or anti-a-syn aggregates IgG titers were analyzed at each timepoint by an enzyme-linked immune sorbent assay (ELISA). Briefly, BSA conjugated SEQ ID NO: 2 peptide or a-syn protein or a-syn oligomers/aggregates were immobilized on 96-well micro titers plates overnight. After washing and blocking, plates were incubated with the plasma samples for two hours at 37°C, allowing the antibodies present in plasma to bind the peptide or the proteins. After incubation, the plates were washed to remove non-reactive plasma components.
  • ELISA enzyme-linked immune sorbent assay
  • the antibody/antigen complex was detected via a secondary anti-mouse IgG antibody conjugated to alkaline phosphatase.
  • pNPP p-Nitrophenyl Phosphate
  • the anti-SEQ ID NO: 2 peptide, anti-a-syn protein or anti-a-syn aggregate IgG titers were back-calculated against a calibration curve in eight two-fold serial dilution, using an unweighted four-parameter logistic regression model using the Gen5 software (BioTek, Switzerland). Results are expressed as AU/mL.
  • results confirm the potential of SEQ ID NO: 2 liposomal vaccine to induce a strong immune response in vivo against alpha-synuclein proteins and aggregated alpha- synuclein. Furthermore the results show the SEQ ID NO: 2 liposomal vaccine to provide a surprisingly increased immune response in vivo against anti-SEQ ID NO:2 peptide, alpha- synuclein proteins and aggregated alpha-synuclein compared to the SEQ ID NO:2 conjugate vaccine.
  • Winder-Rhodes SE Garcia-Reitbdck P, Ban M, et al. Genetic and pathological links between Parkinson’s disease and the lysosomal disorder Sanfilippo syndrome. Mov Disord 2012;27(2):312- ⁇ 315

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Dispersion Chemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
PCT/EP2023/053259 2022-02-09 2023-02-09 Anti-alpha-synuclein therapeutic vaccines Ceased WO2023152260A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CA3248093A CA3248093A1 (en) 2022-02-09 2023-02-09 ANTI-ALPHA-SYNUCLEIN THERAPEUTIC VACCINES
IL314865A IL314865A (en) 2022-02-09 2023-02-09 Anti-alpha-synuclein therapeutic vaccines
EP23703593.6A EP4475878A1 (en) 2022-02-09 2023-02-09 Anti-alpha-synuclein therapeutic vaccines
JP2024547294A JP2025506472A (ja) 2022-02-09 2023-02-09 抗アルファシヌクレイン治療的ワクチン
MX2024009485A MX2024009485A (es) 2022-02-09 2023-02-09 Vacunas terapeuticas anti-alfa-sinucleina.
US18/836,298 US20250152684A1 (en) 2022-02-09 2023-02-09 Anti-Alpha-Synuclein Therapeutic Vaccines
CR20240371A CR20240371A (es) 2022-02-09 2023-02-09 Vacunas terapéuticas anti-alfa-sinucleína
CN202380020628.5A CN118660717A (zh) 2022-02-09 2023-02-09 抗α-突触核蛋白的治疗性疫苗
AU2023219059A AU2023219059A1 (en) 2022-02-09 2023-02-09 Anti-alpha-synuclein therapeutic vaccines
KR1020247025028A KR20240147981A (ko) 2022-02-09 2023-02-09 항-알파시누클레인 치료 백신

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP22156006.3 2022-02-09
EP22156007 2022-02-09
EP22156007.1 2022-02-09
EP22156006 2022-02-09

Publications (1)

Publication Number Publication Date
WO2023152260A1 true WO2023152260A1 (en) 2023-08-17

Family

ID=85175955

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2023/053259 Ceased WO2023152260A1 (en) 2022-02-09 2023-02-09 Anti-alpha-synuclein therapeutic vaccines

Country Status (11)

Country Link
US (1) US20250152684A1 (cg-RX-API-DMAC7.html)
EP (1) EP4475878A1 (cg-RX-API-DMAC7.html)
JP (1) JP2025506472A (cg-RX-API-DMAC7.html)
KR (1) KR20240147981A (cg-RX-API-DMAC7.html)
AU (1) AU2023219059A1 (cg-RX-API-DMAC7.html)
CA (1) CA3248093A1 (cg-RX-API-DMAC7.html)
CL (1) CL2024002370A1 (cg-RX-API-DMAC7.html)
CR (1) CR20240371A (cg-RX-API-DMAC7.html)
IL (1) IL314865A (cg-RX-API-DMAC7.html)
MX (1) MX2024009485A (cg-RX-API-DMAC7.html)
WO (1) WO2023152260A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024156908A1 (en) * 2023-01-26 2024-08-02 Ac Immune Sa Liposomal construct
WO2025109524A1 (en) 2023-11-22 2025-05-30 Ac Immune Sa Assays and methods for assessing vaccine preparations

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005108423A1 (en) 2004-05-11 2005-11-17 Atgen Co., Ltd. Novel peptides conferring environmental stress resistance and fusion proteins including said peptides
WO2009103105A2 (en) 2008-02-22 2009-08-27 Affiris Ag Mimotope
WO2011020133A1 (en) 2009-08-21 2011-02-24 Affiris Ag Use of mimotopes of alpha-synuclein epitopes for treating lewy body diseases
WO2013164355A1 (en) * 2012-05-01 2013-11-07 Affiris Ag Compositions
WO2013173827A2 (en) * 2012-05-18 2013-11-21 Board Of Regents Of The University Of Nebraska Methods and compositions for inhibiting diseases of the central nervous system
WO2017076873A1 (en) 2015-11-03 2017-05-11 Affiris Ag Method for vaccination against a self-antigen in a human patient
WO2019084118A2 (en) * 2017-10-25 2019-05-02 Janssen Pharmaceuticals, Inc. PHOSPHORYLATED TUBE PEPTIDE COMPOSITIONS AND USES THEREOF
WO2019197414A1 (en) * 2018-04-10 2019-10-17 Ac Immune Sa Anti-abeta therapeutic vaccines
WO2022029181A1 (en) * 2020-08-04 2022-02-10 Ac Immune Sa Immunogenic compounds

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005108423A1 (en) 2004-05-11 2005-11-17 Atgen Co., Ltd. Novel peptides conferring environmental stress resistance and fusion proteins including said peptides
WO2009103105A2 (en) 2008-02-22 2009-08-27 Affiris Ag Mimotope
WO2011020133A1 (en) 2009-08-21 2011-02-24 Affiris Ag Use of mimotopes of alpha-synuclein epitopes for treating lewy body diseases
WO2013164355A1 (en) * 2012-05-01 2013-11-07 Affiris Ag Compositions
WO2013173827A2 (en) * 2012-05-18 2013-11-21 Board Of Regents Of The University Of Nebraska Methods and compositions for inhibiting diseases of the central nervous system
WO2017076873A1 (en) 2015-11-03 2017-05-11 Affiris Ag Method for vaccination against a self-antigen in a human patient
WO2019084118A2 (en) * 2017-10-25 2019-05-02 Janssen Pharmaceuticals, Inc. PHOSPHORYLATED TUBE PEPTIDE COMPOSITIONS AND USES THEREOF
WO2019197414A1 (en) * 2018-04-10 2019-10-17 Ac Immune Sa Anti-abeta therapeutic vaccines
WO2022029181A1 (en) * 2020-08-04 2022-02-10 Ac Immune Sa Immunogenic compounds

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
"Handbook of Pharmaceutical Excipients", 1999, PHARMACEUTICAL ASSOC
"Pharmaceutical Codex: Principles and Practice of Pharmaceutics", 1994, PHARMACEUTICAL PRESS, LONDON
"Remington: the Science and Practice of Pharmacy", 1995, LIPPINCOTT, WILLIAMS & WILKINS
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY
ALEXANDER J, SIDNEY J, SOUTHWOOD S, RUPPERT J, OSEROFF C, MAEWAL A, SNOKE K, SERRA HM,KUBO RT, SETTE A: "Development of high potency universal DR-restricted helper epitopes by modification of high affinity DR-blocking peptides", IMMUNITY
ANDREAS PUSCHMANNROONGROJ BHIDAYASIRIWILLIAM J. WEINER: "Synucleinopathies from bench to bedside", PARKINSONISM & RELATED DISORDERS, vol. 18, 2012, pages S24 - S27
ASKANAS VENGEL WKALVAREZ RBMCFERRIN JBROCCOLINI A: "Novel immunolocalization of alpha-synuclein in human muscle of inclusion-body myositis, regenerating and necrotic muscle fibers, and at neuromuscular junctions", J NEUROPATHOL EXP NEUROL, vol. 59, no. 7, July 2000 (2000-07-01), pages 592 - 8
BASSIL FFERNAGUT POBEZARD EPRUVOST ALESTE-LASSERRE THOANG QQRINGE DPETSKO GAMEISSNER WG: "Reducing C-terminal truncation mitigates synucleinopathy and neurodegeneration in a transgenic model of multiple system atrophy", PROC NATL ACAD SCI U S A., vol. 113, no. 34, 23 August 2016 (2016-08-23), pages 9593 - 8, XP055496013, DOI: 10.1073/pnas.1609291113
BENGOA-VERGNIORY NROBERTS RFWADE-MARTINS RALEGRE-ABARRATEGUI J: "Alpha-synuclein oligomers: a new hope", ACTA NEUROPATHOL, vol. 134, no. 6, December 2017 (2017-12-01), pages 819 - 838, XP036351197, DOI: 10.1007/s00401-017-1755-1
BERNIS MEBABILA JTBREID SWIISTEN KAWULLNER UTAMGUNEY G.: "Prion-like propagation of human brain-derived alpha-synuclein in transgenic mice expressing human wild-type alpha-synuclein", ACTA NEUROPATHOL COMMUN, vol. 3, 26 November 2015 (2015-11-26), pages 75
BRAAL HSASTRE MDEL TREDICI K: "Development of alpha-synuclein immunoreactive astrocytes in the forebrain parallels stages of intraneuronal pathology in sporadic Parkinson's disease", ACTA NEUROPATHOL, vol. 114, no. 3, September 2007 (2007-09-01), pages 231 - 41, XP019541562, DOI: 10.1007/s00401-007-0244-3
CHARLES ET AL., NEUROSCI LETT, vol. 289, no. 1, 28 July 2000 (2000-07-28), pages 29 - 32
CHARLES VMEZEY EREDDY P.HDEHEJIA AYOUNG T.APOLYMEROPOULOS M.HBROWNSTEIN M.JTAGLE D.A: "Alpha-synuclein immunoreactivity of huntingtin polyglutamine aggregates in striatum and cortex of Huntington's disease patients and transgenic mouse models", NEUROSCI. LETT, vol. 289, 2000, pages 29 - 32, XP000992380, DOI: 10.1016/S0304-3940(00)01247-7
DEL GUERCIO M.FJEFF ALEXANDERRALPH T. KUBOTHOMAS ARRHENIUSAJESH MAEWALETTORE APPELLASTEPHEN L. HOFFMANTREVOR JONESDANILA VALMORIKA: "Howard M. Grey, Alessandro Sette, Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan DR T Helper Epitopes (PADRE) for antibody responses in vivo", VACCINE, vol. 15, 1997, pages 441 - 448
DICKSON DWCRYSTAL HMATTIACE LAKRESS YSCHWAGERL AKSIEZAK-REDING HDAVIES PYEN SH: "Diffuse Lewy body disease: light and electron microscopic immunocytochemistry of senile plaques", ACTA NEUROPATHOL, vol. 78, no. 6, 1989, pages 572 - 84
DUFTY BMWARNER LRHOU STJIANG SXGOMEZ-ISLA TLEENHOUTS KMOXFORD JTFEANY MBMASLIAH EROHN TT: "Calpain-cleavage of alpha-synuclein: connecting proteolytic processing to disease-linked aggregation", AM J PATHOL, vol. 170, no. 5, May 2007 (2007-05-01), pages 1725 - 38
FERMAN ET AL., J INT NEUROPSYCHOL SOC, vol. 8, no. 7, 2002, pages 907 - 914
FERMAN, T., BOEVE, B., SMITH, G., SILBER, M., LUCAS, J., GRAFF-RADFORD, N.,IVNIK, R.: "Dementia with Lewy bodies may present as dementia and REM sleep behavior disorder without parkinsonism or hallucinations", JOURNAL OF THE INTERNATIONAL NEUROPSYCHOLOGICAL SOCIETY, vol. 8, no. 7, 2002, pages 907 - 914
FIEDLER: "The Handbook of Pharmaceutical Excipients", 2002, AMERICAN PHARMACEUTICALS ASSOCIATION, article "Lexikon der Hilfstoffe"
FLEMING S.MASHLEY DAVISEMILY SIMONS: "Targeting alpha-synuclein via the immune system in Parkinson's disease: Current vaccine therapies, Neuropharmacology", VOLUME, vol. 202, 2022, pages 108870
FLEMING SM ET AL., NEUROPHARMACOLOGY, 2022, pages 202
GALVIN ET AL., JAMA NEUROLOGY, vol. 58, no. 2, 2001, pages 186 - 190
GALVIN JELEE VMTROJANOWSKI JQ: "Synucleinopathies: Clinical and Pathological Implications", ARCH NEUROL, vol. 58, no. 2, 2001, pages 186 - 190, XP002753644, DOI: 10.1001/archneur.58.2.186
GOODMANGILMAN'S: "the Pharmacological Basis of Therapeutics", 1992, MCGRAW HILL
JELLINGER KA: "Neuropathological spectrum of synucleinopathies", MOV DISORD, vol. 18, September 2003 (2003-09-01), pages 2 - 12
JELLINGER, MOV DISORD, vol. 18, 2003, pages S2 - 12
KOSAKA K: "Diffuse Lewy body disease in Japan", J NEUROL, vol. 237, no. 3, June 1990 (1990-06-01), pages 197 - 204
KOVARI EBURKHARDT KLOBRINUS JABOURAS C: "Lewy body dysphagia", ACTA NEUROPATHOL, vol. 114, no. 3, 19 June 2007 (2007-06-19), pages 295 - 8, XP019541557, DOI: 10.1007/s00401-007-0233-6
KOVARI ET AL., ACTA NEUROPATHOL, vol. 114, no. 3, 2007, pages 295 - 8
LASHUEL HAOVERK CROUESLATI AMASLIAH E: "The many faces of a-synuclein: from structure and toxicity to therapeutic target", NAT REV NEUROSCI, vol. 14, no. 1, January 2013 (2013-01-01), pages 38 - 48, XP055230475, DOI: 10.1038/nrn3406
LEE HJSUK JEBAE EJLEE JHPAIK SRLEE SJ: "Assembly-dependent endocytosis and clearance of extracellular alpha-synuclein", INT J BIOCHEM CELL BIOL, vol. 40, no. 9, 2008, pages 1835 - 49, XP022734738, DOI: 10.1016/j.biocel.2008.01.017
LIPPA CFSCHMIDT MLLEE VMTROJANOWSKI JQ: "Antibodies to alpha-synuclein detect Lewy bodies in many Down's syndrome brains with Alzheimer's disease", ANN NEUROL, vol. 45, 1999, pages 353 - 7, XP008074304, DOI: 10.1002/1531-8249(199903)45:3<353::AID-ANA11>3.0.CO;2-4
LIPPA ET AL., ANN NEUROL, vol. 45, no. 3, March 1999 (1999-03-01), pages 353 - 7
MANDLER MVALERA EROCKENSTEIN EWENINGER HPATRICK CADAME ASANTIC RMEINDL SVIGL BSMRZKA O: "Next-generation active immunization approach for synucleinopathies: implications for Parkinson's disease clinical trials", ACTA NEUROPATHOL, vol. 127, no. 6, 2014, pages 861 - 79, XP055203363, DOI: 10.1007/s00401-014-1256-4
MCKEE ACSTERN RANOWINSKI CJSTEIN TDALVAREZ VEDANESHVAR DHLEE HSWOJTOWICZ SMHALL GBAUGH CM: "The spectrum of disease in chronic traumatic encephalopathy", BRAIN, vol. 136, 2 December 2012 (2012-12-02), pages 43 - 64, XP055422672, DOI: 10.1093/brain/aws307
MCKEE ET AL., BRAIN, vol. 136, 2013, pages 43 - 64
NIMMO JTSMITH HWANG CYTEELING JLNICOLL JARVERMA ADODART JCLIU ZLIN FCARARE RO: "Immunisation with UB-312 in the Thy 1SNCA mouse prevents motor performance deficits and oligomeric a-synuclein accumulation in the brain and gut", ACTA NEUROPATHOL, vol. 143, no. 1, January 2022 (2022-01-01), pages 55 - 73, XP037656723, DOI: 10.1007/s00401-021-02381-5
PANINA-BORDIGNON PTAN ATERMIJTELEN ADEMOTZ SADIN GLANZAVECCHIA A: "Universally immunogenic T cell epitopes: promiscuous binding to human MHC class II and promiscuous recognition by T cells", EUR J IMMUNOL., vol. 19, no. 12, December 1989 (1989-12-01), pages 2237 - 42, XP009033650, DOI: 10.1002/eji.1830191209
PIHLGREN MSILVA A.BMADANI RGIRIENS VWAECKERLE-MEN YFETTELSCHOSS AHICKMAN D.TL6PEZ-DEBER M.PNDAO D.MVUKICEVIC M: "TLR4-and TRIF-dependent stimulation of B lymphocytes by peptide liposomes enables T eel/-independent isotype switch in mice", BLOOD, vol. 121, no. 1, 3 January 2013 (2013-01-03), pages 85 - 94, XP055552884, DOI: 10.1182/blood-2012-02-413831
PUSCHMANN ET AL., PARKINSONISM RELAT DISORD, vol. 18S1, 2012, pages S24 - S27
SCHMITZ ET AL., MOL NEUROBIOL, 22 August 2018 (2018-08-22)
SCHMITZ, MVILLAR-PIQUE, ALLORENS, F ET AL.: "Cerebrospinal Fluid Total and Phosphorylated a-Synuclein in Patients with Creutzfeldt-Jakob Disease and Synucleinopathy", MOL NEUROBIOL, vol. 56, 2019, pages 3476 - 3483, XP036763071, Retrieved from the Internet <URL:https://doi.org/10.1007/s12035-018-1313-4> DOI: 10.1007/s12035-018-1313-4
SMITH BRSANTOS MBMARSHALL MSCANTUTI-CASTELVETRI LLOPEZ-ROSAS ALI GVAN BREEMEN RCLAYCOMB KIGALLEA JICELEJ MS: "Neuronal inclusions of alpha-synuclein contribute to the pathogenesis of Krabbe disease", J PATHOL, vol. 232, 2014, pages 509 - 521
SPILLANTINI MGSCHMIDT MLLEE VMTROJANOWSKI JQJAKES RGOEDERT M: "Alpha-synuclein in Lewy bodies", NATURE, vol. 388, no. 6645, 28 August 1997 (1997-08-28), pages 839 - 40, XP002090996, DOI: 10.1038/42166
USENOVIC ET AL., J NEUROSCI, vol. 32, no. 12, 2012, pages 4240 - 4246
USENOVIC MTRESSE EMAZZULLI JRTAYLOR JPKRAINC D: "Deficiency of ATP13A2 leads to lysosomal dysfunction, a-synuclein accumulation, and neurotoxicity", J NEUROSCI, vol. 32, no. 12, 21 March 2012 (2012-03-21), pages 4240 - 6
VOLE DPOEWE WKUTZELNIGG ALUHRS PTHUN-HOHENSTEIN CSCHNEEBERGER AGALABOVA GMAJBOUR NVAIKATH NEL-AGNAF O: "Safety and immunogenicity of the a-synuclein active immunotherapeutic PD01A in patients with Parkinson's disease: a randomised, single-blinded, phase 1 trial", LANCET NEUROL, vol. 19, no. 7, July 2020 (2020-07-01), pages 591 - 600, XP086202068, DOI: 10.1016/S1474-4422(20)30136-8
WILHELMSEN ET AL., ARCH NEUROL, vol. 61, no. 3, March 2004 (2004-03-01), pages 398 - 406
WILHELMSEN KCFORMAN MSROSEN HJALVING LIGOLDMAN JFEIGER J ET AL.: "17q-linked frontotemporal dementia-amyotrophic lateral sclerosis without tau mutations with tau and alpha-synuclein inclusions", ARCH NEUROL, vol. 61, no. 3, 2004, pages 398 - 406
WINDER-RHODES SEGARCIA-REITBOCKBAN M ET AL.: "Genetic and pathological links between Parkinson's disease and the lysosomal disorder Sanfilippo syndrome", MOV DISORD, vol. 27, no. 2, 2012, pages 312 - 315
YAMAGUCHI ET AL., J NEUROPATHOL EXP NEUROL, vol. 63, no. 4, 2004, pages 323 - 328
YUKO SAITOKINUKO SUZUKICHRISTINE M. HULETTESHIGEO MURAYAMA: "Journal of Neuropathology & Experimental Neurology", vol. 63, 4 April 2004, AMERICAN PHARMACEUTICALS ASSOCIATION,, article "Aberrant Phosphorylation of a-Synuclein in Human Niemann-Pick Type C1 Disease"

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024156908A1 (en) * 2023-01-26 2024-08-02 Ac Immune Sa Liposomal construct
WO2025109524A1 (en) 2023-11-22 2025-05-30 Ac Immune Sa Assays and methods for assessing vaccine preparations

Also Published As

Publication number Publication date
CR20240371A (es) 2024-10-16
AU2023219059A1 (en) 2024-07-25
JP2025506472A (ja) 2025-03-11
MX2024009485A (es) 2024-08-14
CA3248093A1 (en) 2023-08-17
US20250152684A1 (en) 2025-05-15
CL2024002370A1 (es) 2024-12-27
KR20240147981A (ko) 2024-10-10
IL314865A (en) 2024-10-01
EP4475878A1 (en) 2024-12-18

Similar Documents

Publication Publication Date Title
US20250326806A1 (en) Compositions of Phosphorylated Tau Peptides and Uses Thereof
US12324855B2 (en) Method of safe administration of phosphorylated Tau peptide vaccine
US20230257433A1 (en) Heterologous Administration of Tau Vaccines
KR102869640B1 (ko) 항-aveta 치료적 백신
US20250152684A1 (en) Anti-Alpha-Synuclein Therapeutic Vaccines
US20230287050A1 (en) Immunogenic Compounds
EA051687B1 (ru) Терапевтические вакцины против альфа-синуклеина
CN118660717A (zh) 抗α-突触核蛋白的治疗性疫苗
HK40087814A (zh) 免疫原性化合物
EA048154B1 (ru) Иммуногенные соединения
CN120583938A (zh) 脂质体构建体
HK40105209A (zh) 磷酸化tau肽的组合物及其用途
CN112165956A (zh) 抗Aβ治疗性疫苗
HK40043189A (en) Anti-abeta therapeutic vaccines
HK40039870B (zh) 磷酸化Tau肽的组合物及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23703593

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: AU2023219059

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 202417055624

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2023219059

Country of ref document: AU

Date of ref document: 20230209

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/009485

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2401005080

Country of ref document: TH

WWE Wipo information: entry into national phase

Ref document number: 202380020628.5

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 12024551898

Country of ref document: PH

Ref document number: P2024-02069

Country of ref document: AE

Ref document number: 2024547294

Country of ref document: JP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024016143

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202492000

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2023703593

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023703593

Country of ref document: EP

Effective date: 20240909

ENP Entry into the national phase

Ref document number: 112024016143

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240807

WWP Wipo information: published in national office

Ref document number: 18836298

Country of ref document: US