WO2023129937A1 - Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof - Google Patents
Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof Download PDFInfo
- Publication number
- WO2023129937A1 WO2023129937A1 PCT/US2022/082441 US2022082441W WO2023129937A1 WO 2023129937 A1 WO2023129937 A1 WO 2023129937A1 US 2022082441 W US2022082441 W US 2022082441W WO 2023129937 A1 WO2023129937 A1 WO 2023129937A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cell
- seq
- ipsc
- domain
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4212—CD22, BL-CAM, siglec-2 or sialic acid binding Ig-related lectin 2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
- A61K2239/13—Antibody-based
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- This application provides genetically engineered induced pluripotent stem cells (iPSCs) and derivative cells thereof. Also provided are uses of the iPSCs or derivative cells thereof to express a chimeric antigen receptor for allogenic cell therapy. Also provided are related vectors, polynucleotides, and pharmaceutical compositions.
- iPSCs genetically engineered induced pluripotent stem cells
- This application contains a sequence listing, which is submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name “SequenceListing_ST26.xml” and a creation date of December 23, 2022 having a size of 381 kb.
- the sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.
- Chimeric antigen receptors have shown remarkable activity in the treatment of acute lymphocytic leukemia by enhancing anti-tumor activity of immune effector cells.
- Autologous, patient-specific CAR-T therapy has emerged as a powerful and potentially curative therapy for cancer, especially for CD 19- and CD 22- associated malignancies.
- CAR-T cells with dual-antigen targeting e.g., using two CARs by co-administration or co-transduction into an immune cell
- the autologous T cells must be generated on a custom-made basis, which remains a significant limiting factor for large-scale clinical application due to the production costs and the risk of production failure.
- CAR-T technology and its wider application is also limited due to a number of other key shortcomings, including, e.g., a) an inefficient anti -tumor response in solid tumors, b) limited penetration and susceptibility of adoptively transferred CAR T cells to an immunosuppressive tumor microenvironment (TME), c) poor persistence of CAR-T cells in vivo, d) serious adverse events in the patients including cytokine release syndrome (CRS) and graft-versus-host disease (GVHD) mediated by the CAR-T, and e) the time required for manufacturing.
- TEE immunosuppressive tumor microenvironment
- CRS cytokine release syndrome
- GVHD graft-versus-host disease
- the present disclosure provides an induced pluripotent stem cell (iPSC) or a derivative cell thereof comprising: one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) comprising an antigen binding domain targeting a CD22 antigen; and optionally, at least one of: (i) a CD 19 antigen-binding domain encoded by the one or more exogenous polynucleotides; (ii) a deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5, RFXAP genes; (iii) an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G); (iv) an exogenous polynucleotide encoding an NK cell receptor immunoglobulin gamma Fc region receptor III (FcyR
- the CD 19 antigen-binding domain wherein: (i) the CAR is a bispecific CAR comprising the CD 19 antigen-binding domain, or (ii) the one or more exogenous polynucleotides encode a additional CAR comprising the CD 19 antigenbinding domain.
- the CAR comprises an anti-CD22 VHH domain, and/or wherein the CD 19 antigen-binding domain comprises an anti-CD19 VHH domain.
- the cytokine comprises an IL- 15 protein.
- the IL- 15 protein comprises an inactivated cell surface receptor that comprises a monoclonal antibody-specific epitope and an interleukin 15 (IL- 15), and wherein the inactivated cell surface receptor and the IL- 15 are operably linked by an autoprotease peptide.
- the IL- 15 protein comprises a fusion polypeptide comprising an IL- 15 and an IL- 15 receptor alpha (IL-15Ra).
- the IL- 15 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 72.
- the iPSC or the derivative cell comprises the deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes.
- the iPSC or the derivative cell comprises an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G).
- HLA-E human leukocyte antigen E
- HLA-G human leukocyte antigen G
- the CD 16 is a CD 16 variant protein.
- the CD 16 variant protein is a high affinity CD 16 variant.
- the CD 16 variant protein is a non-cleavable CD 16 variant.
- the CD 16 variant protein comprises one or more amino acid substitutions selected from the group consisting of F158V, F176V, S197P, D205A, S219A, T220A.
- the CD 16 variant protein comprises an amino acid sequence having at least 90% sequence identity to any one of SEQ ID NOS: 181 and 182.
- the iPSC or the derivative cell comprises an exogenous polynucleotide encoding the CD 16 protein and the NKG2D protein, wherein the CD 16 protein and the NKG2D protein are operably linked by an autoprotease peptide.
- the NKG2D protein is a wildtype NKG2D protein.
- the NKG2D protein comprises an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 184.
- the autoprotease peptide is selected from the group consisting of a porcine tesehovirus-1 2A (P2A) peptide, a foot-and-mouth disease virus 2A (F2A) peptide, an Equine Rhinitis A Virus (ERAV) 2A (E2A) peptide, a Thosea asigna virus 2A (T2A) peptide, a cytoplasmic polyhedrosis virus 2A (BmCPV2A) peptide, and a Flacherie Virus 2A (BmIFV2A) peptide.
- P2A porcine tesehovirus-1 2A
- F2A foot-and-mouth disease virus 2A
- E2A Equine Rhinitis A Virus
- T2A cytoplasmic polyhedrosis virus 2A
- BmCPV2A cytoplasmic polyhe
- the autoprotease peptide is a P2A peptide comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 186.
- the exogenous polynucleotide encoding the CD 16 protein and the NKG2D protein comprises a nucleic acid sequence having at least 90% sequence identity to SEQ ID NO: 186.
- one or more of the exogenous polynucleotides are integrated at one or more loci on the chromosome of the cell selected from the group consisting of AAVS1, CCR5, ROSA26, collagen, HTRP, Hl 1, GAPDH, RUNX1, B2M, TAPI, TAP2, Tapasin, NLRC5, RFXANK, CIITA, RFX5, RFXAP, TCR a or b constant region, NKG2A, NKG2D, CD38, CIS, CBL-B, SOCS2, PD1, CTLA4, LAG3, TIM3, and TIGIT genes, provided at least one of the exogenous polynucleotides is integrated at a locus of a gene selected from the group consisting of AAVS1, B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes to thereby result in a deletion or reduced expression of the gene.
- one or more of the exogenous polynucleotides are integrated at the loci of the AAVS1 and B2M genes.
- the iPSC or the derivative cell comprises a deletion or reduced expression of one or more of B2M or CIITA genes.
- the iPSC or the derivative cell thereof comprises the deletion or reduced expression of B2M and CIITA genes.
- the iPSC is reprogrammed from whole peripheral blood mononuclear cells (PBMCs).
- PBMCs peripheral blood mononuclear cells
- the iPSC is derived from a re-programmed T-cell.
- the CAR comprises: (i) a signal peptide; (ii) a extracellular domain comprising the antigen binding domain targeting the CD22 antigen; (iii) a hinge region; (iv) a transmembrane domain, (v) an intracellular signaling domain; and (vi) a costimulatory domain.
- the extracellular domain comprises a VHH single domain antibody that specifically binds the CD22 antigen.
- the extracellular domain comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one of SEQ ID NOs: 96-98, 152, and 155.
- the extracellular domain comprises a polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one of SEQ ID NOs: 99-101, 153, and 156.
- the additional CAR comprises: (i) a signal peptide; (ii) an additional extracellular domain comprising a binding domain that specifically binds the CD 19 antigen; (iii) a hinge region; (iv) a transmembrane domain, (v) an intracellular signaling domain; and (vi) a co-stimulatory domain.
- the additional extracellular domain comprises an scFv derived from an antibody that specifically binds the CD 19 antigen.
- the additional extracellular domain comprises (i) an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more of SEQ ID NOs: 2, 4, and 7, or (ii) is encoded by a polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more of SEQ ID NOs: 145 and 147.
- the signal peptide comprises a GMCSFR signal peptide.
- the hinge region for each of the CAR and the additional CAR are independently selected from the group consisting of a CD28 hinge region, an IgG4 hinge region, and a CD8 hinge region.
- the transmembrane domain for each of the CAR and the additional CAR are independently selected from the group consisting of a CD28 transmembrane domain and a Cd8 transmembrane domain.
- the intracellular signaling domain comprises a CD3 ⁇ intracellular domain.
- the co-stimulatory domain for each of the CAR and the additional CAR are independently selected from the group consisting of a CD28 signaling domain, a 4 IBB signaling domain, a DAP 10 signaling domain, an IL18R1 signaling domain, and an IL18RAP signaling domain.
- the additional CAR comprises: (i) the signal peptide comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs: 1, 103, or 144; (ii) the additional extracellular domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs: 2, 4, or 7, or the additional extracellular domain encoded by a polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs: 145 or 147; (iii) the hinge region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs:
- the additional CAR comprises: (i) the signal peptide comprising the amino acid sequence of SEQ ID NOs: 1, 103, or 144; (ii) the additional extracellular domain (i) comprising the amino acid sequence of SEQ ID NO: 2, 4, and 7, or (ii) encoded by the polynucleotide sequence of SEQ ID NOs: 145 and 147; (iii) the hinge region comprising the amino acid sequence of SEQ ID NO: 22; (iv) the transmembrane domain comprising the amino acid sequence of SEQ ID NO: 24; (v) the intracellular signaling domain comprising the amino acid sequence of SEQ ID NO: 6, or the intracellular signaling domain encoded by the polynucleotide sequence of SEQ ID NO: 149; and (vi) the co-stimulatory domain comprising the amino acid sequence of SEQ ID NO: 20.
- the CAR comprises: (i) the signal peptide comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs: 1, 103, or 144; (ii) the extracellular domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one of SEQ ID NOs: 96-98, 152, and 155; (iii) the hinge region comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 21 or 102; (iv) the transmembrane domain comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ
- the CAR comprises: (i) the signal peptide comprising the amino acid sequence of SEQ ID NO: 1, 103, or 144; (ii) the extracellular domain comprising the amino acid sequence of one of SEQ ID NOs: 96-98, 152, and 155; (iii) the hinge region comprising the amino acid sequence of SEQ ID NO: 21 or 102; (iv) the transmembrane domain comprising the amino acid sequence of SEQ ID NO: 23 or 24; (v) the intracellular signaling domain comprising the amino acid sequence of SEQ ID NO: 6, 198, or 199, or the intracellular signaling domain encoded by the polynucleotide sequence of SEQ ID NO: 149; and (vi) the co-stimulatory domain comprising the amino acid sequence of SEQ ID NO: 8, 17, 198, or 199.
- the iPSC or the derivative cell comprises an exogenous polynucleotide encoding a safety switch.
- the safety switch comprises an exogenous polynucleotide encoding an inactivated cell surface receptor that comprises a monoclonal antibody-specific epitope.
- the inactivated cell surface protein is selected from the group of monoclonal antibody specific epitopes selected from epitopes specifically recognized by ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, polatuzumab vedotin, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, den
- the inactivated cell surface protein is a truncated epithelial growth factor (tEGFR) variant.
- the tEGFR variant consists of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 71.
- the safety switch comprises (i) an intracellular domain having a herpes simplex virus thymidine kinase (HSV-TK) or (ii) an inducible Caspase 9 (iCasp9).
- the iPSC or the derivative cell comprises the exogeneous polynucleotide encoding the PSMA cell tracer, wherein the PSMA cell tracer comprises an extracellular domain comprising a PSMA extracellular domain or fragment thereof.
- the iPSC or the derivative cell comprises a combined artificial cell death/reporter system polypeptide comprising an intracellular domain having a herpes simplex virus thymidine kinase (HSV-TK) and a linker, a transmembrane region, and an extracellular domain comprising the PSMA extracellular domain or fragment thereof.
- HSV-TK herpes simplex virus thymidine kinase
- the HSV-TK comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 187 or 188
- the iCasp9 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 200 or 201.
- the combined artificial cell death/reporter system polypeptide comprises the HSV-TK fused to a truncated variant PSMA polypeptide via the linker.
- the truncated variant PSMA polypeptide comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 189.
- the linker comprises an autoprotease peptide sequence selected from the group consisting of P2A peptide sequence, T2A peptide sequence, E2A peptide sequence, and F2A peptide sequence.
- the artificial cell death/reporter system polypeptide comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 190. In some embodiments, the artificial cell death/reporter system polypeptide comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOS: 191-193.
- the artificial cell death/reporter system polypeptide comprises nucleic acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOS: 194-196.
- the HLA-E comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 66 or the HLA-G comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 69.
- the one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) comprising an antigen binding domain targeting a CD22 and/or CD 19 antigen comprises a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more polynucleotide sequences selected from the group consisting of SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178;
- the exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G) comprises the polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
- the one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) comprising an antigen binding domain targeting a CD22 and/or CD 19 antigen comprises one or more sequences selected from the group consisting of SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178;
- the exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G) comprises the polynucleotide sequence having the sequence SEQ ID NO: 67 or 70;
- the exogenous polynucleotides are integrated into a gene locus independently selected from the group consisting of an AAVS1 locus, a B2M locus, a CIITA locus, a CCR5 locus, a CD70 locus, a CLYBL locus, an NKG2A locus, an NKG2D locus, a CD33 locus, a CD38 locus, a TRAC locus, a TRBC1 locus, a ROSA26 locus, an HTRP locus, a GAPDH locus, a RUNX1 locus, a TAPI locus, a TAP2 locus, a TAPBP locus, an NLRC5 locus, a RFXANK locus, a RFX5 locus, a RFXAP locus, a CISH locus, a CBLB locus, a SOCS2 locus, a PD1 locus, a CTLA4 locus,
- the one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) comprising one or more antigen binding domains targeting CD22 and/or CD 19 antigens is integrated at a locus of the AAVS1 gene;
- the exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G) is integrated at a locus of the B2M gene;
- the exogenous polynucleotide encoding an NK cell receptor immunoglobulin gamma Fc region receptor III (FcyRIII, cluster of differentiation 16 (CD 16)) and/or an NKG2D is integrated at a locus of the CD70 gene;
- the exogeneous polynucleotide encoding the cytokine is integrated at the locus of the NKG2A gene;
- the CAR is a bispecific CAR comprising a CD22/CD19 loop.
- the bispecific CAR comprises one or more amino acid sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 61, 96-98, 104-111, 120-131, 152, 155, 157, 159, 161, 163, 165-167, 171, and 173-175.
- the bispecific CAR comprises one or more polynucleotide sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178.
- the derivative cell is a natural killer (NK) cell or a T cell.
- the derivative cell is a natural killer (NK) cell.
- the derivative cell is a T cell.
- the T cell is a gamma delta T cell.
- the T cell is a gamma delta Vy9/V51 T cell.
- the present disclosure provides a composition comprising any of the iPSC or derivative cells of the present disclosure.
- the composition further comprises or is used in combination with one or more therapeutic agents selected from the group consisting of a peptide, a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, a vector comprising one or more polynucleic acids of interest, an antibody, a chemotherapeutic agent or a radioactive moiety, or an immunomodulatory drug (IMiD).
- one or more therapeutic agents selected from the group consisting of a peptide, a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, a vector comprising
- the present disclosure provides an induced pluripotent stem cell (iPSC) or a derivative cell thereof comprising: one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) targeting a CD22 antigen and a CD 19 antigen; and at least one of: (i) a deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5, RFXAP genes; (ii) an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G); (iii) an exogenous polynucleotide encoding an NK cell receptor immunoglobulin gamma Fc region receptor III (FcyRIII, cluster of differentiation 16 (CD 16) and/or an NKG2D protein; (iv) a deletion or reduced expression of one or more of
- the CAR is a bispecific CAR comprising a CD22/CD19 loop. In some embodiments, the CAR comprises an anti-CD22 VHH domain. In some embodiments, the one or more exogenous polynucleotides each comprise a sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more sequences independently selected from the group consisting of SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178.
- the present disclosure provides a CD34+ hematopoietic progenitor cell (HPC) derived from an induced pluripotent stem cell (iPSC) comprising: one or more exogenous polynucleotides encoding a chimeric antigen receptor (CAR) comprising an antigen binding domain targeting a CD22 antigen; and optionally, at least one of: (i) a CD 19 antigen-binding domain encoded by the one or more exogenous polynucleotides; (ii) a deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5, and RFXAP genes; (iii) an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G); (iv) an exogenous polynucleotide encoding an NK cell
- the CD34+ HPC comprises the CD 19 antigen-binding domain, wherein: (i) the CAR is a bispecific CAR comprising the CD 19 antigen-binding domain, or (ii) the one or more exogenous polynucleotides encode an additional CAR comprising the CD 19 antigen-binding domain.
- the CAR comprises an anti-CD22 VHH domain, and/or wherein the CD 19 antigen-binding domain comprises an anti-CD19 VHH domain.
- the cytokine comprises an IL- 15 protein.
- the IL- 15 protein comprises an inactivated cell surface receptor that comprises a monoclonal antibody-specific epitope and an interleukin 15 (IL- 15), and wherein the inactivated cell surface receptor and the IL- 15 are operably linked by an autoprotease peptide.
- the IL- 15 protein comprises a fusion polypeptide comprising an IL- 15 and an IL- 15 receptor alpha (IL-15Ra).
- the IL- 15 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 72.
- the deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes are included in the exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G).
- HLA-E human leukocyte antigen E
- HLA-G human leukocyte antigen G
- one or more of the exogenous polynucleotides are integrated at one or more loci on the chromosome of the cell independently selected from the group consisting of AAVS1, CCR5, ROSA26, collagen, HTRP, Hl 1, GAPDH, RUNX1, B2M, TAPI, TAP2, Tapasin, NLRC5, RFXANK, CIITA, RFX5, RFXAP, TCR a or b constant region, NKG2A, NKG2D, CD38, CIS, CBL-B, SOCS2, PD1, CTLA4, LAG3, TIM3, and TIGIT genes, provided at least one of the exogenous polynucleotides is integrated at a locus of a gene selected from the group consisting of AAVS1, B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes to thereby result in a deletion or reduced expression of the gene.
- the exogenous polynucleotides are integrated at the loci of the CIITA, AAVS1 and B2M genes.
- the CD34+ HPC comprises a deletion or reduced expression of one or more of B2M or CIITA genes.
- the CAR comprises: (i) a signal peptide; (ii) a extracellular domain comprising a binding domain that specifically binds the CD22 antigen and, optionally, a binding domain that specifically binds the CD 19 antigen; (iii) a hinge region; (iv) a transmembrane domain; (v) an intracellular signaling domain; and (vi) a co- stimulatory domain.
- the extracellular domain comprises a VHH single domain antibody that specifically binds the CD22 antigen.
- the extracellular domain comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one of SEQ ID NOs: 96-98, 152, and 155.
- the extracellular domain comprises a polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one of SEQ ID NOs: 99-101, 153, and 156.
- the bispecific CAR wherein the bispecific CAR comprises one or more amino acid sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 61, 96-98, 104-111, 120- 131, 152, 155, 157, 159, 161, 163, 165-167, 171, and 173-175.
- the bispecific CAR wherein the bispecific CAR comprises an amino acid sequence encoded by one or more polynucleotide sequences having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178.
- the additional CAR comprises: (i) a signal peptide; (ii) an additional extracellular domain comprising a binding domain that specifically binds the CD 19 antigen; (iii) a hinge region; (iv) a transmembrane domain; (v) an intracellular signaling domain; and (vi) a co-stimulatory domain.
- the additional extracellular domain comprises an scFv derived from an antibody that specifically binds the CD 19 antigen.
- the additional extracellular domain comprises (i) an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more of SEQ ID NOs: 2, 4, and 7, or (ii) is encoded by a polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to one or more of SEQ ID NOs: 145 and 147.
- the present disclosure provides a chimeric antigen receptor (CAR) polypeptide comprising an extracellular domain that specifically binds to CD22 having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NOs: 62, 99-101, 112-119, 132-143, 153, 156, 158, 160, 162, 164, 168-170, 172, and 176-178.
- CAR chimeric antigen receptor
- the present disclosure provides a method of treating cancer in a subject in need thereof, comprising administering any of the derivative cells of the present disclosure, or any of the compositions of the present disclosure to a subject in need thereof.
- the cancer is selected from the group consisting of leukemia, such as AML, CML, acute lymphocytic leukemia (ALL), B-cell acute lymphocytic leukemia (B-ALL), and chronic lymphocytic leukemia (CLL), lymphomas, such as Hodgkin lymphoma, non-Hodgkin lymphoma, multiple myeloma, and follicular lymphoma, and solid cancers such as sarcomas, skin cancer, melanoma, bladder cancer, brain cancer, breast cancer, uterus cancer, ovary cancer, prostate cancer, lung cancer, colorectal cancer, cervical cancer, liver cancer, head and neck cancer, esophageal cancer, pancreatic cancer, renal cancer, adrenal cancer, stomach cancer, test
- the cancer is a B-cell malignancy, acute lymphocytic leukemia (ALL), B-cell acute lymphocytic leukemia (B-ALL), chronic lymphocytic leukemia (CLL), or non-Hodgkin lymphoma, follicular lymphoma.
- ALL acute lymphocytic leukemia
- B-ALL B-cell acute lymphocytic leukemia
- CLL chronic lymphocytic leukemia
- non-Hodgkin lymphoma follicular lymphoma.
- the subject has minimal residual disease (MRD) after an initial cancer treatment.
- the subject has no minimal residual disease (MRD) after one or more cancer treatments or repeated dosing.
- the present disclosure provides a method of manufacturing any of the derivative cells of the present disclosure, the method comprising differentiating the iPSC cell under conditions for cell differentiation to thereby obtain the derivative cell.
- the iPSC is obtained by genomic engineering an unmodified iPSC, wherein the genomic engineering comprises targeted editing.
- the targeted editing comprises deletion, insertion, or in/del carried out by CRISPR, ZFN, TALEN, homing nuclease, homology recombination, or any other functional variation of these methods.
- the present disclosure provides a method of differentiating an induced pluripotent stem cell (iPSC) into an NK cell, comprising subjecting the iPSCs to a differentiation protocol including culturing the cells in a medium containing a recombinant human IL- 12 for the final 24 hours of culturing under the differentiation protocol.
- the recombinant IL- 12 comprises IL12p70.
- FIGs 1A-C show results of VHH-Fc fusion proteins that were examined by flow cytometry for CD22 cellular binding in Raji cells.
- A) PROT739 and PROT740 from VHH phage libraries show binding to Raji cells with EC50 values of approximately 2nM. No binding was seen to Raji CD22 knock-out cells.
- B) PROT265 and PROT810 (an affinity matured variant of PROT265) bind to Raji cells, with PROT810 showing improved binding relative to PROT265.
- FIG. 2 shows schematics of VHH-Fc fusion proteins that were examined for binding to full length CD22, CD22A2-3 and CD22AV-1.
- PROT265 D04
- PROT739 A01
- PROT740 E04
- FIGs. 3A-B show VHH-CAR constructs that were transduced into Jurkat cells.
- Cells were tested for activation by co-culture with cells expressing the CD22 target protein at an effectortarget (E:T) ratio of approximately 4: 1.
- E:T effectortarget
- Cells were stained for CD3 and CD69 expression using BV421 -anti-human CD69 antibody (Biolegend) and PE-anti- CD3 clone OKT3 (Biolegend).
- A) Jurkat CAR-T cells (CD3 + ) bearing clones A01 (P952) and E04 (P953) show activation of CD69 expression following 48 hours of co-incubation with various CD22 + or CD22" cell lines.
- Jurkat CAR-T cells bearing clone D04 (D04.P262) show activation of CD69 expression following 48 hours of co-incubation with various CD22 + or CD22" cell lines.
- FIGs. 4A-B show cytotoxicity of VHH-CAR expressing cells towards Raji cells.
- VHH-CAR lentivirus was transduced into primary T-cells. Cells were grown for 14 days, then co-cultured with CD22+ Raji cells at E:T ratios of 2: 1 and 5:1 for 48 hours. Raji cell killing was assessed by flow cytometry.
- A) P403 (D04), P1278 (D04 AM D11) and P456 (a positive control scFv-CAR) were transduced into T-cells and assessed for cytotoxicity towards Raji cells.
- the P403 construct (CD22 D04) showed modest Raji cell killing over background (untransduced cells; UTD).
- the affinity improved variant Pl 278 (CD22_DO4_AM_D11) had significantly better cytotoxicity, up to 80% at the 5:1 E:T ratio.
- the P952 (CD22_CNTY_VHH1_AO1) and P953 (CD22_CNTY_VHH1_EO4) constructs showed modest cytotoxicity above background.
- FIGs. 5A-B show cytotoxicity of tandem VHH-CAR expressing cells towards (A) Raji cells and (B) K-562 cells.
- VHH-CAR lentivirus was transduced into primary T- cells. Cells were grown for 14 days, then co-cultured with CD22 + Raji cells at E:T ratios of 1 :2, 1 :1 and 2: 1 for 48 hours. Target cell killing was assessed by flow cytometry.
- the single VHH (D04 AM D11) CAR (P1729) demonstrated minimal killing of Raji cells.
- the tandem VHH of E04 - D04 AM D11 (P1738) showed slightly improved Raji cell killing, up to 20% at the 2: 1 E:T ratio.
- FIGs. 6A-R show various bispecific CAR constructs (targeting CD 19 and CD22 antigens) which are used in various embodiments of the present disclosure.
- CAR ectodomains were engineered with select CD22 binders in combination with FMC63. Selected CARs were expressed and tested for cytotoxicity activity in T-cells along with mono-specific CAR-T cells.
- FIGs. 7A-B show (A) CD 19 dependent killing of Cho-CD19 cells and Raji-CD22 knockout cells using therapeutic cells expressing the mono- and bispecific CAR constructs of the present disclosure at a 1.25: 1 E:T ratio. All of the bispecific CAR-T cells tested exhibited CD19-targeted cytotoxicity activity equivalent to the FMC63 CAR (e.g., P1209). The bispecific CARS showed comparable CD22-directed cytotoxicity as the mono-specific tandem CARs (e.g., P1631, P1633, P1702 and P1734).
- Bispecific CAR T cells showed CD22-dependent activity that was comparable to CD22 mono-specific CARs.
- P2015 and p2016 had reduced activity on CHO-CD22, the highest activity on Raji-CD19 knockout cells and Nalm6-CD19 knockout cells.
- FIG. 8 shows CD19/CD22 double-positive killing of Reh cells, Raji cells, Jeko cells, and Nalm6 cells using therapeutic cells expressing the mono- and bispecific CAR constructs of the present disclosure at a 1.25: 1 E:T ratio.
- FIG. 9 shows the percent expression of various mono- and bispecific CAR constructs of the present disclosure in T cells.
- FIGs. 10A-B show (A) various mono-, bi- and tri-specific CAR constructs of the present disclosure, and (B) the percent expression of the various CAR constructs in T cells.
- FIGs. 11A-B show (A) various bi- and tri-specific CAR constructs of the present disclosure, and (B) the target-dependent cytotoxicity of therapeutic cells expressing the various CAR constructs against Cho cells.
- FIGs. 12A-G show results of a cytotoxicity analysis of therapeutic cells expressing various mono-, bi- and tri-specific CAR constructs of the present disclosure at E:T ratios between 0 and 10:1 in (A) Cho cells (CD22-/CD19-), (B) Cho-CD22 cells (CD22+/CD19-), (C) Cho-CD19 cells (CD22-/CD19+), (D) Raji cells (CD22+/CD19+), (E) Raji-CD22KO cells (CD22-/CD19+), (F) Raji-CD19KO cells (CD22+/CD19-), and (G) Jeko cells (CD22+/CD19+).
- FIG. 13 shows CD19-, CD22-, and CD 19/CD22- dependent killing of Reh cells, Jeko cells, Cho-CD22 cells, Cho-CD19 cells, Cho cells, Raji-CD22 KO cells, Raji-CD19 KO cells, Raji cells, Nalm6-CD19 KO cells, and Nalm6 cells using therapeutics cells expressing various mono- and bispecific CARs of the present disclosure.
- FIGs. 14A-J shows results of cumulative cytotoxicity analysis of therapeutic cells expressing various mono- and bispecific CAR constructs of the present disclosure at E:T ratios between 0 and 5: 1 in (A) Cho cells (CD22-/CD19-), (B) Cho-CD22 cells (CD22+/CD19-), (C) Cho-CD19 cells (CD22-/CD19+), (D) Raji cells (CD22+/CD19+), (E) Raji-CD19KO cells (CD22+/CD19-), (F) Raji-CD22KO cells (CD22-/CD19+), (G) Nalm6 cells (CD22+/CD19+), (H) Nalm6-CD19KO cells (CD22+/CD19-), (I) Reh cells (CD22+/CD19+), and (J) Jeko cells (CD22+/CD19+).
- FIGs. 15A-C show results of a cytotoxicity analysis of therapeutic cells expressing various mono- and bispecific CAR constructs of the present disclosure at E:T ratios between 0 and 5: 1 in (A) Cho cells (CD22-/CD19-), (B) Cho-CD22 cells (CD22+/CD19-), and (C) Cho-CD19 cells (CD22-/CD19+).
- FIG. 16 shows the target-dependent cytotoxicity of therapeutic cells expressing mono- and bispecific CAR constructs against Cho cells, Cho-CD19 cells, and Cho-CD22 cells.
- FIGs. 17A-B show results of a cytotoxicity analysis of therapeutic cells expressing various mono- and bispecific CAR constructs of the present disclosure at E:T ratios between 0 and 5: 1 in (A) Nalm6 cells (CD22+/CD19+) and (B) Nalm6-CD19KO cells (CD22+/CD19-).
- FIG. 18 shows the target-dependent cytotoxicity of therapeutic cells expressing mono- and bispecific CAR constructs against Nalm6 cells, and Nalm6-CD19 cells.
- FIGs. 19A-C show results of a cytotoxicity analysis of therapeutic cells expressing various mono- and bispecific CAR constructs of the present disclosure at E:T ratios between 0 and 5: 1 in (A) Raji cells (CD22+/CD19+), (B) Raji-CD22KO cells (CD22-/CD19+), and (C) Raji-CD19KO cells (CD22+/CD19-).
- FIG. 20 shows the target-dependent cytotoxicity of therapeutic cells expressing mono- and bispecific CAR constructs against Raji cells, Raji-CD19KO cells, and Raji- CD22 KO cells.
- FIG. 21 shows a diagram of an exemplary cell of the present disclosure, which expresses an anti-CD22/CD19 loop CAR on the cell surface.
- FIG. 22 shows CAR expression in cells of the present disclosure are engineered to express a bispecific CAR that recognizes both CD 19 and CD22.
- iPSCs were genetically modified to express a transgene for the CD19/CD22 CAR or a control CD19 CAR (or cells were not engineered for the CAR-less control).
- Those iPSCs were differentiated into T cells (iT cells) and CAR expression was evaluated by staining with either anti-idiotype antibody that binds to the CD 19 recognition domain of the CAR (left) or anti-VHH antibody that binds to the CD22 recognition domain of the CAR (right). Staining of cells was evaluated using flow cytometry.
- CAR-less iT cells were not stained with either antibody.
- the CD19/CD22 CAR-iT cells were stained with antibodies for both the CD 19 recognition domain and the CD 22 recognition domain.
- the CD 19 CAR- iT cells were stained with the antibody for the CD 19 recognition domain but not the CD22 recognition domain.
- FIG. 23 shows antigen specific cytolysis of tumor cells by CD19/CD22 bispecific CAR-iT cells.
- CAR-iT cells with a bispecific CAR eliminate tumor cells through recognition of either CD 19 or CD22.
- Either CD 19 CAR-iT cells or CD19/CD22 CAR-iT cells were co-cultured with tumor cells at a 1 :1 effector to target ratio for 24 hours. Cytolysis (%) was calculated based on the number of tumor cells present after 24 hours of co-culture with iT cells compared to the number of tumor cells present when cultured alone. Data was collected using an IncuCyte live cell imaging platform and red fluorescent labeled tumor cells.
- both CD 19 and CD22 were present on the surface of tumor cells (Daudi B cell lymphoma), both the CD 19 CAR-iT cells and CD19/CD22 CAR-iT cells mediated tumor killing.
- B When tumor cells expressed CD22 but not CD19 (Daudi CD19-knockout cells), only the bispecific CD19/CD22 CAR-iT cells mediated tumor killing.
- C When tumor cells expressed CD 19 but not CD22 (Daudi CD22-knockout cells), both CD 19 CAR-iT cells and CD19/CD22 CAR-iT cells mediated tumor killing.
- a CD19/CD22 bispecific CAR-iT cell can target B cell malignancies that have lost expression of CD 19 but targeting CD22.
- any numerical values such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term “about.”
- a numerical value typically includes ⁇ 10% of the recited value.
- a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL.
- a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11% (w/v).
- the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
- the terms “comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended.
- a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus.
- “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
- the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or,” a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
- subject means any animal, preferably a mammal, most preferably a human.
- mammal encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
- nucleic acids or polypeptide sequences e.g., CAR polypeptides and the CAR polynucleotides that encode them
- sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat ’I. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
- Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
- M forward score for a pair of matching residues; always > 0
- N penalty score for mismatching residues; always ⁇ 0.
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- W wordlength
- E expectation
- BLOSUM62 scoring matrix see Henikoff & Henikoff, Proc. Natl. Acad. Set. USA 89:10915 (1989)).
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat ’I. Acad. Set. USA 90:5873-5787 (1993)).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- a further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
- Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
- isolated means a biological component (such as a nucleic acid, peptide, protein, or cell) has been substantially separated, produced apart from, or purified away from other biological components of the organism in which the component naturally occurs, e.g., other chromosomal and extrachromosomal DNA and RNA, proteins, cells, and tissues.
- Nucleic acids, peptides, proteins, and cells that have been “isolated” thus include nucleic acids, peptides, proteins, and cells purified by standard purification methods and purification methods described herein.
- isolated nucleic acids, peptides, proteins, and cells can be part of a composition and still be isolated if the composition is not part of the native environment of the nucleic acid, peptide, protein, or cell.
- the term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
- nucleic acid molecule As used herein, the term “polynucleotide,” synonymously referred to as “nucleic acid molecule,” “nucleotides” or “nucleic acids,” refers to any polyribonucleotide or polydeoxyribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA.
- Polynucleotides include, without limitation single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and doublestranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that can be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions.
- polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- the term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons.
- Modified bases include, for example, tritylated bases and unusual bases such as inosine.
- polynucleotide embraces chemically, enzymatically or metabolically modified forms of polynucleotides as typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells.
- Polynucleotide also embraces relatively short nucleic acid chains, often referred to as oligonucleotides.
- a “construct” refers to a macromolecule or complex of molecules comprising a polynucleotide to be delivered to a host cell, either in vitro or in vivo.
- a “vector,” as used herein refers to any nucleic acid construct capable of directing the delivery or transfer of a foreign genetic material to target cells, where it can be replicated and/or expressed.
- the term “vector” as used herein comprises the construct to be delivered.
- a vector can be a linear or a circular molecule.
- a vector can be integrating or non-integrating. The major types of vectors include, but are not limited to, plasmids, episomal vector, viral vectors, cosmids, and artificial chromosomes.
- Viral vectors include, but are not limited to, adenovirus vector, adeno-associated virus vector, retrovirus vector, lentivirus vector, Sendai virus vector, and the like.
- integration it is meant that one or more nucleotides of a construct is stably inserted into the cellular genome, e.g., covalently linked to the nucleic acid sequence within the cell’s chromosomal DNA.
- targeted integration it is meant that the nucleotide(s) of a construct is inserted into the cell's chromosomal or mitochondrial DNA at a pre-selected site or “integration site”.
- integration as used herein further refers to a process involving insertion of one or more exogenous sequences or nucleotides of the construct, with or without deletion of an endogenous sequence or nucleotide at the integration site.
- integration can further comprise replacement of the endogenous sequence or a nucleotide that is deleted with the one or more inserted nucleotides.
- the term “exogenous” is intended to mean that the referenced molecule or the referenced activity is introduced into, or non-native to, the host cell.
- the molecule can be introduced, for example, by introduction of an encoding nucleic acid into the host genetic material such as by integration into a host chromosome or as non- chromosomal genetic material such as a plasmid. Therefore, the term as it is used in reference to expression of an encoding nucleic acid refers to introduction of the encoding nucleic acid in an expressible form into the cell.
- the term “endogenous” refers to a referenced molecule or activity that is present in the host cell in its native form. Similarly, the term when used in reference to expression of an encoding nucleic acid refers to expression of an encoding nucleic acid natively contained within the cell and not exogenously introduced.
- a “gene of interest” or “a polynucleotide sequence of interest” is a DNA sequence that is transcribed into RNA and in some instances translated into a polypeptide in vivo when placed under the control of appropriate regulatory sequences.
- a gene or polynucleotide of interest can include, but is not limited to, prokaryotic sequences, cDNA from eukaryotic mRNA, genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and synthetic DNA sequences.
- a gene of interest may encode an miRNA, an shRNA, a native polypeptide (e.g., a polypeptide found in nature) or fragment thereof; a variant polypeptide (e.g., a mutant of the native polypeptide having less than 100% sequence identity with the native polypeptide) or fragment thereof; an engineered polypeptide or peptide fragment, a therapeutic peptide or polypeptide, an imaging marker, a selectable marker, and the like.
- a native polypeptide e.g., a polypeptide found in nature
- a variant polypeptide e.g., a mutant of the native polypeptide having less than 100% sequence identity with the native polypeptide
- an engineered polypeptide or peptide fragment e.g., a therapeutic peptide or polypeptide, an imaging marker, a selectable marker, and the like.
- “Operably-linked” refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other.
- a promoter is operably-linked with a coding sequence or functional RNA when it is capable of affecting the expression of that coding sequence or functional RNA (e.g., the coding sequence or functional RNA is under the transcriptional control of the promoter).
- Coding sequences can be operably-linked to regulatory sequences in sense or antisense orientation.
- the term encompasses the transcription of a gene into RNA.
- the term also encompasses translation of RNA into one or more polypeptides, and further encompasses all naturally occurring post-transcriptional and post-translational modifications.
- the expressed CAR can be within the cytoplasm of a host cell, into the extracellular milieu such as the growth medium of a cell culture or anchored to the cell membrane.
- peptide can refer to a molecule comprised of amino acids and can be recognized as a protein by those of skill in the art.
- the conventional one-letter or three-letter code for amino acid residues is used herein.
- peptide can be used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
- the peptide sequences described herein are written according to the usual convention whereby the N-terminal region of the peptide is on the left and the C-terminal region is on the right. Although isomeric forms of the amino acids are known, it is the L- form of the amino acid that is represented unless otherwise expressly indicated.
- the term “engineered immune cell” refers to an immune cell, also referred to as an immune effector cell, that has been genetically modified by the addition of exogenous genetic material in the form of DNA or RNA to the total genetic material of the cell.
- IPCs Induced Pluripotent Stem Cells (IPSCs) And Immune Effector Cells
- IPSCs have unlimited self-renewing capacity.
- Use of iPSCs enables cellular engineering to produce a controlled cell bank of modified cells that can be expanded and differentiated into desired immune effector cells, supplying large amounts of homogeneous allogeneic therapeutic products.
- IPSCs and derivative cells thereof.
- the selected genomic modifications provided herein enhance the therapeutic properties of the derivative cells.
- the derivative cells are functionally improved and suitable for allogenic off-the-shelf cell therapies following a combination of selective modalities being introduced to the cells at the level of iPSC through genomic engineering. This approach can help to reduce the side effects mediated by CRS/GVHD and prevent longterm autoimmunity while providing excellent efficacy.
- the term "differentiation” is the process by which an unspecialized ("uncommitted") or less specialized cell acquires the features of a specialized cell.
- Specialized cells include, for example, a blood cell or a muscle cell.
- a differentiated or differentiation- induced cell is one that has taken on a more specialized ("committed") position within the lineage of a cell.
- the term “committed”, when applied to the process of differentiation, refers to a cell that has proceeded in the differentiation pathway to a point where, under normal circumstances, it will continue to differentiate into a specific cell type or subset of cell types, and cannot, under normal circumstances, differentiate into a different cell type or revert to a less differentiated cell type.
- pluripotent refers to the ability of a cell to form all lineages of the body or soma or the embryo proper.
- embryonic stem cells are a type of pluripotent stem cells that are able to form cells from each of the three germs layers, the ectoderm, the mesoderm, and the endoderm.
- Pluripotency is a continuum of developmental potencies ranging from the incompletely or partially pluripotent cell (e.g., an epiblast stem cell or EpiSC), which is unable to give rise to a complete organism to the more primitive, more pluripotent cell, which is able to give rise to a complete organism (e.g., an embryonic stem cell).
- reprogramming or “dedifferentiation” refers to a method of increasing the potency of a cell or dedifferentiating the cell to a less differentiated state.
- a cell that has an increased cell potency has more developmental plasticity (e.g., can differentiate into more cell types) compared to the same cell in the non-reprogrammed state.
- a reprogrammed cell is one that is in a less differentiated state than the same cell in a non-reprogrammed state.
- induced pluripotent stem cells or, iPSCs, means that the stem cells are produced from differentiated adult, neonatal or fetal cells that have been induced or changed or reprogrammed into cells capable of differentiating into tissues of all three germ or dermal layers: mesoderm, endoderm, and ectoderm.
- the iPSCs produced do not refer to cells as they are found in nature.
- hematopoietic stem and progenitor cells refers to cells which are committed to a hematopoietic lineage but are capable of further hematopoietic differentiation.
- Hematopoietic stem cells include, for example, multipotent hematopoietic stem cells (hematoblasts), myeloid progenitors, megakaryocyte progenitors, erythrocyte progenitors, and lymphoid progenitors.
- Hematopoietic stem and progenitor cells are multipotent stem cells that give rise to all the blood cell types including myeloid (monocytes and macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells), and lymphoid lineages (T cells, B cells, NK cells).
- myeloid monocytes and macrophages
- neutrophils neutrophils
- basophils basophils
- eosinophils neutrophils
- eosinophils neutrophils
- basophils basophils
- eosinophils neutrophils
- erythrocytes erythrocytes
- megakaryocytes/platelets dendritic cells
- dendritic cells lymphoid lineages
- CD34+ hematopoietic progenitor cell refers to an HPC that expresses CD34 on its surface.
- immune cell or “immune effector cell” refers to a cell that is involved in an immune response. Immune response includes, for example, the promotion of an immune effector response. Examples of immune cells include T cells, B cells, natural killer (NK) cells, mast cells, and myeloid-derived phagocytes.
- NK natural killer
- T lymphocyte and “T cell” are used interchangeably and refer to a type of white blood cell that completes maturation in the thymus and that has various roles in the immune system.
- a T cell can have the roles including, e.g., the identification of specific foreign antigens in the body and the activation and deactivation of other immune cells.
- a T cell can be any T cell, such as a cultured T cell, e.g., a primary T cell, or a T cell from a cultured T cell line, e.g., Jurkat, SupTl, etc., or a T cell obtained from a mammal.
- the T cell can be CD3+ cells.
- the T cell can be any type of T cell and can be of any developmental stage, including but not limited to, CD4+/CD8+ double positive T cells, CD4+ helper T cells (e.g., Thl and Th2 cells), CD8+ T cells (e.g., cytotoxic T cells), peripheral blood mononuclear cells (PBMCs), peripheral blood leukocytes (PBLs), tumor infiltrating lymphocytes (TILs), memory T cells, naive T cells, regulator T cells, gamma delta T cells (gd T cells), and the like.
- helper T cells include cells such as Th3 (Treg), Thl7, Th9, or Tfh cells.
- T cells such as central memory T cells (Tcm cells), effector memory T cells (Tern cells and TEMRA cells).
- the T cell can also refer to a genetically engineered T cell, such as a T cell modified to express a T cell receptor (TCR) or a chimeric antigen receptor (CAR).
- TCR T cell receptor
- CAR chimeric antigen receptor
- the T cell can also be differentiated from a stem cell or progenitor cell.
- CD4+ T cells refers to a subset of T cells that express CD4 on their surface and are associated with cell-mediated immune response. They are characterized by the secretion profiles following stimulation, which may include secretion of cytokines such as IFN-gamma, TNF-alpha, IL2, IL4 and IL10. “CD4” are 55-kD glycoproteins originally defined as differentiation antigens on T-lymphocytes, but also found on other cells including monocytes/macrophages. CD4 antigens are members of the immunoglobulin supergene family and are implicated as associative recognition elements in MHC (major histocompatibility complex) class Il-restricted immune responses. On T- lymphocytes they define the helper/inducer subset.
- CD8+ T cells refers to a subset of T cells which express CD8 on their surface, are MHC class I-restricted, and function as cytotoxic T cells.
- CD8 molecules are differentiation antigens found on thymocytes and on cytotoxic and suppressor T- lymphocytes. CD8 antigens are members of the immunoglobulin supergene family and are associative recognition elements in major histocompatibility complex class I- restricted interactions.
- NK cell or “Natural Killer cell” refers to a subset of peripheral blood lymphocytes defined by the expression of CD56 and CD45 and the absence of the T cell receptor (TCR chains).
- the NK cell can also refer to a genetically engineered NK cell, such as a NK cell modified to express a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the term “genetic imprint” refers to genetic or epigenetic information that contributes to preferential therapeutic attributes in a source cell or an iPSC, and is retainable in the source cell derived iPSCs, and/or the iPSC-derived hematopoietic lineage cells.
- a source cell is a non-pluripotent cell that may be used for generating iPSCs through reprogramming, and the source cell derived iPSCs may be further differentiated to specific cell types including any hematopoietic lineage cells.
- the source cell derived iPSCs, and differentiated cells therefrom are sometimes collectively called “derived” or “derivative” cells depending on the context.
- derivative effector cells or derivative NK or “iNK” cells or derivative T or “iT” cells, as used throughout this application are cells differentiated from an iPSC, as compared to their primary counterpart obtained from natural/native sources such as peripheral blood, umbilical cord blood, or other donor tissues.
- the genetic imprint(s) conferring a preferential therapeutic attribute is incorporated into the iPSCs either through reprogramming a selected source cell that is donor-, disease-, or treatment response- specific, or through introducing genetically modified modalities to iPSC using genomic editing.
- the induced pluripotent stem cell (iPSC) parental cell lines may be generated from peripheral blood mononuclear cells (PBMCs) or T-cells using any known method for introducing re-programming factors into non-pluripotent cells such as the episomal plasmid-based process as previously described in U.S. Pat. Nos. 8,546,140; 9,644,184; 9,328,332; and 8,765,470, the complete disclosures of which are incorporated herein by reference.
- the reprogramming factors may be in a form of polynucleotides, and thus are introduced to the non-pluripotent cells by vectors such as a retrovirus, a Sendai virus, an adenovirus, an episome, and a mini-circle.
- the one or more polynucleotides encoding at least one reprogramming factor are introduced by a lentiviral vector.
- the one or more polynucleotides are introduced by a Sendai viral vector.
- the iPSC’s are clonal iPSC’s or are obtained from a pool of iPSCs and the genome edits are introduced by making one or more targeted integration and/or in/del at one or more selected sites.
- the iPSC’s are obtained from human T cells having antigen specificity and a reconstituted TCR gene (hereinafter, also refer to as "T-iPS” cells) as described in US Pat. Nos. 9206394, and 10787642 hereby incorporated by reference into the present application.
- the application relates to an induced pluripotent stem cell (iPSC) cell or a derivative cell thereof comprising: (i) an exogenous polynucleotide encoding a chimeric antigen receptor (CAR); (ii) a deletion or reduced expression of B2M and CIITA genes; and optionally (iii) an exogenous polynucleotide encoding a chimeric IL-15RA and an interleukin 15 (IL- 15), wherein the IL-15RA and IL- 15 are operably linked.
- iPSC induced pluripotent stem cell
- an iPSC cell or a derivative cell thereof comprises one or more first exogenous polynucleotides encoding a first and a second chimeric antigen receptor (CAR), such as a CAR targeting one or more tumor antigens.
- CAR chimeric antigen receptor
- the CAR targets a CD 19 antigen
- the second CAR targets a CD22 antigen
- the CAR targets a CD 19 antigen
- the second CAR targets a CD22 antigen
- the targeting regions (e.g., the extracellular domains) of one or both of the CARs comprises an antibody fragment (e.g, a VHH domain).
- the CAR can be a bispecific CAR targeting two or more antigens (e.g., a CD19/CD22 CAR).
- a therapeutic cell of the present disclosure can express a bispecific CAR targeting CD 19 and CD22.
- the targeting domains of the CAR e.g., the antigen binding regions
- the CAR can be a bispecific CAR in a loop configuration.
- chimeric antigen receptor refers to a recombinant polypeptide comprising at least an extracellular domain that binds specifically to an antigen or a target, a transmembrane domain and an intracellular signaling domain. Engagement of the extracellular domain of the CAR with the target antigen on the surface of a target cell results in clustering of the CAR and delivers an activation stimulus to the CAR-containing cell. CARs redirect the specificity of immune effector cells and trigger proliferation, cytokine production, phagocytosis and/or production of molecules that can mediate cell death of the target antigen-expressing cell in a major histocompatibility (MHC)-independent manner.
- MHC major histocompatibility
- signal peptide refers to a leader sequence at the aminoterminus (N-terminus) of a nascent CAR protein, which co-translationally or post- translationally directs the nascent protein to the endoplasmic reticulum and subsequent surface expression.
- extracellular antigen-binding domain refers to the part of a CAR that is located outside of the cell membrane and is capable of binding to an antigen, target or ligand.
- hinge region or “hinge domain” refers to the part of a CAR that connects two adjacent domains of the CAR protein, e.g., the extracellular domain and the transmembrane domain of the CAR protein.
- transmembrane domain refers to the portion of a CAR that extends across the cell membrane and anchors the CAR to cell membrane.
- intracellular signaling domain refers to the part of a CAR that is located inside of the cell membrane and is capable of transducing an effector signal.
- the term “stimulatory molecule” refers to a molecule expressed by an immune cell (e.g., NK cell or T cell) that provides the primary cytoplasmic signaling sequence(s) that regulate primary activation of receptors in a stimulatory way for at least some aspect of the immune cell signaling pathway.
- Stimulatory molecules comprise two distinct classes of cytoplasmic signaling sequence, those that initiate antigen- dependent primary activation (referred to as “primary signaling domains”), and those that act in an antigen-independent manner to provide a secondary of co- stimulatory signal (referred to as “co-stimulatory signaling domains”).
- the extracellular domain comprises an antigen-binding domain and/or an antigen-binding fragment.
- the antigen-binding fragment can, for example, be an antibody or antigen-binding fragment thereof that specifically binds a tumor antigen.
- the antigen-binding fragments of the application possess one or more desirable functional properties, including but not limited to high-affinity binding to a tumor antigen, high specificity to a tumor antigen, the ability to stimulate complementdependent cytotoxicity (CDC), antibody-dependent phagocytosis (ADPC), and/or antibody-dependent cellular-mediated cytotoxicity (ADCC) against cells expressing a tumor antigen, and the ability to inhibit tumor growth in subjects in need thereof and in animal models when administered alone or in combination with other anti-cancer therapies.
- CDC complementdependent cytotoxicity
- ADPC antibody-dependent phagocytosis
- ADCC antibody-dependent cellular-mediated cytotoxicity
- antibody is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (e.g., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4.
- the antibodies of the application can be of any of the five major classes or corresponding sub-classes.
- the antibodies of the application are IgGl, IgG2, IgG3 or IgG4.
- Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains.
- the antibodies of the application can contain a kappa or lambda light chain constant domain.
- the antibodies of the application include heavy and/or light chain constant regions from rat or human antibodies.
- antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (e.g., complementarity determining regions 1-3; CDR1, CDR2, and CDR3).
- the light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCDR3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCDR2, and HCDR3.
- an “isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to the specific tumor antigen is substantially free of antibodies that do not bind to the tumor antigen). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
- the term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts.
- the monoclonal antibodies of the application can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods.
- the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
- the term “antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv 1 ), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdAb), a scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a minibody, a nanobody, a domain antibody, a bivalent domain antibody, a light chain variable domain (VL), a variable domain (VHH) of a camelid antibody, or any other antibody fragment that binds to an antigen-binding
- single-chain antibody refers to a conventional singlechain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids (e.g., a linker peptide).
- single domain antibody refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
- human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
- humanized antibody refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
- chimeric antibody refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
- multispecific antibody refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap or substantially overlap.
- the first and second epitopes do not overlap or do not substantially overlap.
- the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain.
- a multispecific antibody is a bispecific antibody molecule, a trispecific antibody molecule, or a tetraspecific antibody molecule.
- bispecific antibody refers to a multispecific antibody that binds no more than two epitopes or two antigens.
- a bispecific antibody is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first epitope and a second immunoglobulin variable domain sequence that has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap or substantially overlap.
- the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody comprises a VHH having binding specificity for a first epitope, and a VHH having binding specificity for a second epitope.
- the term X/Y loop refers to an extracellular region in which one scFv (either CD 19 or CD22) is nested in between the VL and VH of the other scFv.
- X and Y may be the same antigen.
- X and Y may be different antigens.
- X and Y are tumor antigens.
- an antigen-binding domain or antigen-binding fragment that “specifically binds to a tumor antigen” refers to an antigen-binding domain or antigenbinding fragment that binds a tumor antigen, with a KD of 1 xlO -7 M or less, preferably 1 x 1 CT 8 M or less, more preferably 5x1 CT 9 M or less, 1 x10 -9 M or less, 5x1 CT 10 M or less, or 1 xlO -10 M or less.
- KD refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (e.g., Kd/Ka) and is expressed as a molar concentration (M).
- KD values for antibodies can be determined using methods in the art in view of the present disclosure.
- the KD of an antigen-binding domain or antigen-binding fragment can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system.
- antibodies or antibody fragments suitable for use in the CAR of the present disclosure include, but are not limited to, monoclonal antibodies, bispecific antibodies, multispecific antibodies, chimeric antibodies, polypeptide-Fc fusions, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), masked antibodies (e.g., Probodies®), Small Modular ImmunoPharmaceuticals (“SMIPsTM”), intrabodies, minibodies, single domain antibody variable domains, nanobodies, VHHs, diabodies, tandem diabodies (TandAb®), anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antigen-specific TCR), and epitope-binding fragments of any of the above.
- Antibodies and/or antibody fragments may be derived from murine antibodies, rabbit antibodies, human antibodies, fully humanized antibodies, camelid antibody variable domain
- the antigen-binding fragment is an Fab fragment, an Fab 1 fragment, an F(ab')2 fragment, an scFv fragment, an Fv fragment, a dsFv diabody, a VHH, a VNAR, a single-domain antibody (sdAb) or nanobody, a dAb fragment, a Fd' fragment, a Fd fragment, a heavy chain variable region, an isolated complementarity determining region (CDR), a diabody, a triabody, or a decabody.
- the antigen-binding fragment is an scFv fragment.
- the antigenbinding fragment is a VHH.
- At least one of the extracellular tag-binding domain, the antigen-binding domain, or the tag comprises a single-domain antibody or nanobody. In some embodiments, at least one of the extracellular tag-binding domain, the antigenbinding domain, or the tag comprises a VHH.
- the extracellular tag-binding domain and the tag each comprise a VHH.
- the extracellular tag-binding domain, the tag, and the antigen-binding domain each comprise a VHH.
- At least one of the extracellular tag-binding domain, the antigenbinding domain, or the tag comprises an scFv.
- the extracellular tag-binding domain and the tag each comprise an scFv.
- the extracellular tag-binding domain, the tag, and the antigen-binding domain each comprise a scFv.
- Alternative scaffolds to immunoglobulin domains that exhibit similar functional characteristics, such as high-affinity and specific binding of target biomolecules, may also be used in the CARs of the present disclosure. Such scaffolds have been shown to yield molecules with improved characteristics, such as greater stability or reduced immunogenicity.
- Non-limiting examples of alternative scaffolds that may be used in the CAR of the present disclosure include engineered, tenascin-derived, tenascin type III domain (e.g., CentyrinTM); engineered, gamma-B crystallin-derived scaffold or engineered, ubiquitin-derived scaffold (e.g., Affilins); engineered, fibronectin- derived, 10th fibronectin type III (10Fn3) domain (e.g., monobodies, AdNectinsTM, or AdNexinsTM);; engineered, ankyrin repeat motif containing polypeptide (e.g., DARPinsTM); engineered, low-density-lipoprotein-receptor-derived, A domain (LDLR-A) (e.g., AvimersTM); lipocalin (e.g., anticalins); engineered, protease inhibitor-derived, Kunitz domain (e.g., EETI-II/AGRP,
- the alternative scaffold is Affilin or Centyrin.
- the first polypeptide of the CARs of the present disclosure comprises a leader sequence.
- the leader sequence may be positioned at the N-terminus the extracellular tag-binding domain.
- the leader sequence may be optionally cleaved from the extracellular tag-binding domain during cellular processing and localization of the CAR to the cellular membrane. Any of various leader sequences known to one of skill in the art may be used as the leader sequence.
- Non-limiting examples of peptides from which the leader sequence may be derived include granulocyte-macrophage colonystimulating factor receptor (GMCSFR), FcsR, human immunoglobulin (IgG) heavy chain (HC) variable region, CD8a, or any of various other proteins secreted by T cells.
- the leader sequence is compatible with the secretory pathway of a T cell.
- the leader sequence is derived from human immunoglobulin heavy chain (HC).
- the leader sequence is derived from GMCSFR.
- the GMCSFR leader sequence comprises the amino acid sequence set forth in SEQ ID NO: 1, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 1.
- the first polypeptide of the CARs of the present disclosure comprise a transmembrane domain, fused in frame between the extracellular tag-binding domain and the cytoplasmic domain.
- the transmembrane domain may be derived from the protein contributing to the extracellular tag-binding domain, the protein contributing the signaling or co-signaling domain, or by a totally different protein.
- the transmembrane domain can be selected or modified by amino acid substitution, deletions, or insertions to minimize interactions with other members of the CAR complex.
- the transmembrane domain can be selected or modified by amino acid substitution, deletions, or insertions to avoid binding of proteins naturally associated with the transmembrane domain.
- the transmembrane domain includes additional amino acids to allow for flexibility and/or optimal distance between the domains connected to the transmembrane domain.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Non-limiting examples of transmembrane domains of particular use in this disclosure may be derived from (e.g., comprise at least the transmembrane region(s) of) the a or 0 chain of the T-cell receptor (TCR), CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD8a, CD9, CD16, CD22, CD28, CD33, CD37, CD40, CD64, CD80, CD86, CD134, CD137, or CD154.
- TCR T-cell receptor
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and/or valine can be found at each end of a synthetic transmembrane domain.
- the transmembrane domain of the c, n or FcsRly chains which contain a cysteine residue capable of disulfide bonding so that the resulting chimeric protein will be able to form disulfide linked dimers with itself, or with unmodified versions of the c, n or FcsRly chains or related proteins.
- the transmembrane domain will be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain is derived from CD8 or CD28.
- the CD8 transmembrane domain comprises the amino acid sequence set forth in SEQ ID NO: 23, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 23.
- the CD28 transmembrane domain comprises the amino acid sequence set forth in SEQ ID NO: 24, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 24.
- the first polypeptide of the CAR of the present disclosure comprises a spacer region between the extracellular tag-binding domain and the transmembrane domain, wherein the tag-binding domain, linker, and the transmembrane domain are in frame with each other.
- spacer region generally means any oligo- or polypeptide that functions to link the tag-binding domain to the transmembrane domain.
- a spacer region can be used to provide more flexibility and accessibility for the tagbinding domain.
- a spacer region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
- a spacer region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region.
- the spacer region may be a synthetic sequence that corresponds to a naturally occurring spacer region sequence, or may be an entirely synthetic spacer region sequence.
- Non-limiting examples of spacer regions which may be used in accordance to the disclosure include a part of human CD8a chain, partial extracellular domain of CD28, FcyRllla receptor, IgG, IgM, IgA, IgD, IgE, an Ig hinge, or functional fragment thereof.
- additional linking amino acids are added to the spacer region to ensure that the antigen-binding domain is an optimal distance from the transmembrane domain.
- the spacer when the spacer is derived from an Ig, the spacer may be mutated to prevent Fc receptor binding.
- the spacer region comprises a hinge domain.
- the hinge domain may be derived from CD8, CD8a, CD28, or an immunoglobulin (IgG).
- IgG immunoglobulin
- the IgG hinge may be from IgGl, IgG2, IgG3, IgG4, IgG4 CH3, IgMl, IgM2, IgAl, IgA2, IgD, IgE, or a chimera thereof.
- the hinge domain comprises an immunoglobulin IgG hinge or functional fragment thereof.
- the IgG hinge is from IgGl, IgG2, IgG3, IgG4, IgG4 CH3, IgMl, IgM2, IgAl, IgA2, IgD, IgE, or a chimera thereof.
- the hinge domain comprises the CHI, CH2, CH3 and/or hinge region of the immunoglobulin.
- the hinge domain comprises the core hinge region of the immunoglobulin.
- core hinge can be used interchangeably with the term “short hinge” (a.k.a “SH”).
- Non-limiting examples of suitable hinge domains are the core immunoglobulin hinge regions include EPKSCDKTHTCPPCP (SEQ ID NO: 57) from IgGl, ERKCCVECPPCP (SEQ ID NO: 58) from IgG2, ELKTPLGDTTHTCPRCP(EPKSCDTPPPCPRCP) 3 (SEQ ID NO: 59) from IgG3, ESKYGPPCPSCP (SEQ ID NO: 60) from IgG4 (see also Wypych et al., JBC 2008 283(23): 16194-16205, which is incorporated herein by reference in its entirety for all purposes), and ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLGK (SEQ ID NO: 102), or a variant thereof having at least 50, at
- the hinge domain is derived from CD8 or CD28.
- the CD8 hinge domain comprises the amino acid sequence set forth in SEQ ID NO: 21, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 21.
- the CD28 hinge domain comprises the amino acid sequence set forth in SEQ ID NO: 22, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 22.
- the transmembrane domain and/or hinge domain is derived from CD8 or CD28. In some embodiments, both the transmembrane domain and hinge domain are derived from CD8. In some embodiments, both the transmembrane domain and hinge domain are derived from CD28.
- the first polypeptide of CARs of the present disclosure comprise a cytoplasmic domain, which comprises at least one intracellular signaling domain. In some embodiments, cytoplasmic domain also comprises one or more costimulatory signaling domains.
- the cytoplasmic domain is responsible for activation of at least one of the normal effector functions of the host cell (e.g., T cell) in which the CAR has been placed in.
- effector function refers to a specialized function of a cell. Effector function of a T-cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire signaling domain is present, in many cases it is not necessary to use the entire chain.
- intracellular signaling domain is thus meant to include any truncated portion of the signaling domain sufficient to transduce the effector function signal.
- Non-limiting examples of signaling domains which can be used in the CARs of the present disclosure include, e.g., signaling domains derived from DAP10, DAP12, Fc epsilon receptor I y chain (FCER1G), FcR 0, CD35, CD3s, CD3y, CD3 ⁇ , CD5, CD22, CD226, CD66d, CD79A, CD79B, IL18R1, and IL18RAP.
- the signaling domain of the CAR can comprise the FIR domain sequence from IL18R1 or IL18RAP.
- the cytoplasmic domain comprises a CD3 ⁇ signaling domain.
- the CD3 ⁇ signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 6, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 6.
- the cytoplasmic domain further comprises one or more costimulatory signaling domains.
- the one or more co-stimulatory signaling domains are derived from CD28, 41BB, IL2Rb, IL18R1, IL18RAP, CD40, 0X40 (CD134), CD80, CD86, CD27, ICOS, NKG2D, DAP10, DAP12, 2B4 (CD244), BTLA, CD30, GITR, CD226, CD79A, and HVEM.
- the costimulatory signaling domain of the CAR can comprise the TIR domain sequence from IL18R1 or IL18RAP.
- the co-stimulatory signaling domain is derived from 4 IBB.
- the 4 IBB co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 8, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 8.
- the co-stimulatory signaling domain is derived from IL2Rb.
- the IL2Rb co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 9, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 9.
- the co-stimulatory signaling domain is derived from CD40.
- the CD40 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 10, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO:
- the co-stimulatory signaling domain is derived from 0X40.
- the 0X40 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 11, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO:
- the co-stimulatory signaling domain is derived from CD80.
- the CD80 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 12, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 12.
- the co-stimulatory signaling domain is derived from CD86.
- the CD86 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 13, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO:
- the co-stimulatory signaling domain is derived from CD27.
- the CD27 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 14, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO:
- the co-stimulatory signaling domain is derived from ICOS.
- the ICOS co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 15, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO:
- the co-stimulatory signaling domain is derived from NKG2D.
- the NKG2D co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 16, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 16.
- the co-stimulatory signaling domain is derived from DAP 10.
- the DAP 10 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 17, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 17.
- the co-stimulatory signaling domain is derived from DAP 12.
- the DAP 12 co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 18, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 18.
- the co-stimulatory signaling domain is derived from IL18R1 or IL18RAP.
- the IL18R1 or IL18RAP co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 198 or 199, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 198 or 199.
- the co-stimulatory signaling domain is derived from 2B4 (CD244).
- the 2B4 (CD244) co-stimulatory signaling domain comprises the amino acid sequence set forth in SEQ ID NO: 19, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 19.
- the CAR of the present disclosure comprises one co- stimulatory signaling domains. In some embodiments, the CAR of the present disclosure comprises two or more co-stimulatory signaling domains. In certain embodiments, the CAR of the present disclosure comprises two, three, four, five, six or more co-stimulatory signaling domains.
- the signaling domain(s) and co-stimulatory signaling domain(s) can be placed in any order.
- the signaling domain is upstream of the co-stimulatory signaling domains.
- the signaling domain is downstream from the co-stimulatory signaling domains. In the cases where two or more co-stimulatory domains are included, the order of the co-stimulatory signaling domains could be switched.
- Non-limiting exemplary CAR regions and sequences are provided in Table 1, including amino acid and nucleic acid sequences for various CAR constructs shown in
- the antigen-binding domain of the second polypeptide binds to an antigen.
- the antigen-binding domain of the second polypeptide may bind to more than one antigen or more than one epitope in an antigen.
- the antigenbinding domain of the second polypeptide may bind to two, three, four, five, six, seven, eight or more antigens.
- the antigen-binding domain of the second polypeptide may bind to two, three, four, five, six, seven, eight or more epitopes in the same antigen.
- antigen-binding domain may depend upon the type and number of antigens that define the surface of a target cell.
- the antigen-binding domain may be chosen to recognize an antigen that acts as a cell surface marker on target cells associated with a particular disease state.
- the CARs of the present disclosure can be genetically modified to target a tumor antigen of interest by way of engineering a desired antigen-binding domain that specifically binds to an antigen (e.g., on a tumor cell).
- Non-limiting examples of cell surface markers that may act as targets for the antigen-binding domain in the CAR of the disclosure include those associated with tumor cells or autoimmune diseases.
- the antigen-binding domain binds to at least one tumor antigen or autoimmune antigen.
- the antigen-binding domain binds to at least one tumor antigen. In some embodiments, the antigen-binding domain binds to two or more tumor antigens. In some embodiments, the two or more tumor antigens are associated with the same tumor. In some embodiments, the two or more tumor antigens are associated with different tumors.
- the antigen-binding domain binds to at least one autoimmune antigen. In some embodiments, the antigen-binding domain binds to two or more autoimmune antigens. In some embodiments, the two or more autoimmune antigens are associated with the same autoimmune disease. In some embodiments, the two or more autoimmune antigens are associated with different autoimmune diseases.
- the tumor antigen is associated with glioblastoma, ovarian cancer, cervical cancer, head and neck cancer, liver cancer, prostate cancer, pancreatic cancer, renal cell carcinoma, bladder cancer, or hematologic malignancy.
- tumor antigen associated with glioblastoma include HER2, EGFRvIII, EGFR, CD 133, PDGFRA, FGFR1, FGFR3, MET, CD70, ROBO land IL13Ra2.
- tumor antigens associated with ovarian cancer include FOLR1, FSHR, MUC16, MUC1, Mesothelin, CA125, EpCAM, EGFR, PDGFRa, Nectin-4, and B7H4.
- Non-limiting examples of the tumor antigens associated with cervical cancer or head and neck cancer include GD2, MUC1, Mesothelin, HER2, and EGFR.
- Non-limiting examples of tumor antigen associated with liver cancer include Claudin 18.2, GPC-3, EpCAM, cMET, and AFP.
- Non-limiting examples of tumor antigens associated with hematological malignancies include CD22, CD79, BCMA, GPRC5D, SLAM F7, CD33, CLL1, CD123, and CD70.
- Non-limiting examples of tumor antigens associated with bladder cancer include Nectin-4 and SLITRK6.
- antigens that may be targeted by the antigen-binding domain include, but are not limited to, alpha-fetoprotein, A3, antigen specific for A33 antibody, Ba 733, BrE3-antigen, carbonic anhydrase EX, CD1, CDla, CD3, CD5, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD33, CD38, CD45, CD74, CD79a, CD80, CD 123, CD 138, colon-specific antigen-p (CSAp), CEA (CEACAM5), CEACAM6, CSAp, EGFR, EGP-I, EGP-2, Ep-CAM, EphAl, EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8, EphAl 0, EphBl, EphB2, EphB3, EphB4, EphB6, Fit-I, Flt-3, folate receptor, HLA-DR, human chorionic go
- the antigen targeted by the antigen-binding domain is CD 19.
- the antigen-binding domain comprises an anti-CD19 scFv.
- the anti-CD19 scFv comprises a heavy chain variable region (VH) comprising the amino acid sequence set forth in SEQ ID NO: 2, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 2.
- VH heavy chain variable region
- the anti-CD19 scFv comprises a light chain variable region (VL) comprising the amino acid sequence set forth in SEQ ID NO: 4, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 4.
- VL light chain variable region
- the anti-CD19 scFv comprises the amino acid sequence set forth in SEQ ID NO: 7, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 7.
- the antigen is associated with an autoimmune disease or disorder.
- Such antigens may be derived from cell receptors and cells which produce “self ’-directed antibodies.
- the antigen is associated with an autoimmune disease or disorder such as Rheumatoid arthritis (RA), multiple sclerosis (MS), Sjogren’s syndrome, Systemic lupus erythematosus, sarcoidosis, Type 1 diabetes mellitus, insulin dependent diabetes mellitus (IDDM), autoimmune thyroiditis, reactive arthritis, ankylosing spondylitis, scleroderma, polymyositis, dermatomyositis, psoriasis, vasculitis, Wegener’s granulomatosis, Myasthenia gravis, Hashimoto’s thyroiditis, Graves’ disease, chronic inflammatory demyelinating polyneuropathy, Guillain-Barre syndrome, Crohn’s disease or ulcerative colitis.
- RA Rheumatoid arthritis
- autoimmune antigens that may be targeted by the CAR disclosed herein include but are not limited to platelet antigens, myelin protein antigen, Sm antigens in snRNPs, islet cell antigen, Rheumatoid factor, and anticitrullinated protein.
- Citrullinated proteins and peptides such as CCP-1, CCP-2 (cyclical citrullinated peptides), fibrinogen, fibrin, vimentin, 1161ongatio, collagen I and II peptides, alpha-enolase, translation initiation factor 4G1, perinuclear factor, keratin, Sa (cytoskeletal protein vimentin), components of articular cartilage such as collagen II, IX, and XI, circulating serum proteins such as RFs (IgG, IgM), fibrinogen, plasminogen, ferritin, nuclear components such as RA33/hnRNP A2, Sm, eukaryotic 1171ongationl l7 1171ongation factor 1 alpha 1, stress proteins such as HSP-65, -70, -90, BiP, inflammatory/immune factors such as B7-H1, IL-1 alpha, and IL-8, enzymes such as calpastatin, alpha-enolase, aldolase-A, dipeptid
- the scFv fragment used in the CAR of the present disclosure may include a linker between the VH and VL domains.
- the linker can be a peptide linker and may include any naturally occurring amino acid. Exemplary amino acids that may be included into the linker are Gly, Ser Pro, Thr, Glu, Lys, Arg, He, Leu, His and The.
- the linker should have a length that is adequate to link the VH and the VL in such a way that they form the correct conformation relative to one another so that they retain the desired activity, such as binding to an antigen.
- the linker may be about 5-50 amino acids long. In some embodiments, the linker is about 10-40 amino acids long.
- the linker is about 10-35 amino acids long. In some embodiments, the linker is about 10-30 amino acids long. In some embodiments, the linker is about 10-25 amino acids long. In some embodiments, the linker is about 10-20 amino acids long. In some embodiments, the linker is about 15-20 amino acids long.
- Exemplary linkers that may be used are Gly rich linkers, Gly and Ser containing linkers, Gly and Ala containing linkers, Ala and Ser containing linkers, and other flexible linkers.
- the linker is a Whitlow linker.
- the Whitlow linker comprises the amino acid sequence set forth in SEQ ID NO: 3, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 3.
- the linker is a (G4S)3 linker.
- the (G4S)3 linker comprises the amino acid sequence set forth in SEQ ID NO: 25, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 25.
- linker sequences may include portions of immunoglobulin hinge area, CL or CHI derived from any immunoglobulin heavy or light chain isotype.
- Exemplary linkers that may be used include any of SEQ ID NOs: 26-56 in Table 1. Additional linkers are described for example in Int. Pat. Publ. No. WO2019/060695, incorporated by reference herein in its entirety.
- an iPSC cell or a derivative cell thereof comprises an exogenous polynucleotide encoding an artificial cell death polypeptide.
- artificial cell death polypeptide refers to an engineered protein designed to prevent potential toxicity or otherwise adverse effects of a cell therapy.
- the artificial cell death polypeptide could mediate induction of apoptosis, inhibition of protein synthesis, DNA replication, growth arrest, transcriptional and post- transcriptional genetic regulation and/or antibody-mediated depletion.
- the artificial cell death polypeptide is activated by an exogenous molecule, e.g. an antibody, that when activated, triggers apoptosis and/or cell death of a therapeutic cell.
- an artificial cell death polypeptide comprises an inactivated cell surface receptor that comprises an epitope specifically recognized by an antibody, particularly a monoclonal antibody, which is also referred to herein as a monoclonal antibody-specific epitope.
- an antibody particularly a monoclonal antibody, which is also referred to herein as a monoclonal antibody-specific epitope.
- the inactivated cell surface receptor When expressed by iPSCs or derivative cells thereof, the inactivated cell surface receptor is signaling inactive or significantly impaired, but can still be specifically recognized by an antibody.
- the specific binding of the antibody to the inactivated cell surface receptor enables the elimination of the iPSCs or derivative cells thereof by ADCC and/or ADCP mechanisms, as well as, direct killing with antibody drug conjugates with toxins or radionuclides.
- the inactivated cell surface receptor comprises an epitope that is selected from epitopes specifically recognized by an antibody, including but not limited to, ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, polatuzumab vedotin, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, den
- Epidermal growth factor receptor also known as EGFR, ErbBl and HER1
- EGFR epidermal growth factor receptor
- ErbBl ErbBl
- HER1 is a cell-surface receptor for members of the epidermal growth factor family of extracellular ligands.
- truncated EGFR “tEGFR,” “short EGFR” or “sEGFR” refers to an inactive EGFR variant that lacks the EGF-binding domains and the intracellular signaling domains of the EGFR.
- An exemplary tEGFR variant contains residues 322-333 of domain 2, all of domains 3 and 4 and the transmembrane domain of the native EGFR sequence containing the cetuximab binding epitope.
- tEGFR variant on the cell surface enables cell elimination by an antibody that specifically binds to the tEGFR, such as cetuximab (Erbitux®), as needed. Due to the absence of the EGF-binding domains and intracellular signaling domains, tEGFR is inactive when expressed by iPSCs or derivative cell thereof.
- An exemplary inactivated cell surface receptor of the application comprises a tEGFR variant.
- expression of the inactivated cell surface receptor in an engineered immune cell expressing a chimeric antigen receptor (CAR) induces cell suicide of the engineered immune cell when the cell is contacted with an anti-EGFR antibody.
- CAR chimeric antigen receptor
- a subject who has previously received an engineered immune cell of the present disclosure that comprises a heterologous polynucleotide encoding an inactivated cell surface receptor comprising a tEGFR variant can be administered an anti-EGFR antibody in an amount effective to ablate in the subject the previously administered engineered immune cell.
- the anti-EGFR antibody is cetuximab, matuzumab, necitumumab or panitumumab, preferably the anti-EGFR antibody is cetuximab.
- the tEGFR variant comprises or consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 71, preferably the amino acid sequence of SEQ ID NO: 71.
- the inactivated cell surface receptor comprises one or more epitopes of CD79b, such as an epitope specifically recognized by polatuzumab vedotin.
- the CD79b epitope comprises or consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 78, preferably the amino acid sequence of SEQ ID NO: 78.
- the inactivated cell surface receptor comprises one or more epitopes of CD20, such as an epitope specifically recognized by rituximab.
- the CD20 epitope comprises or consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 80, preferably the amino acid sequence of SEQ ID NO: 80.
- the inactivated cell surface receptor comprises one or more epitopes of Her 2 receptor or ErbB, such as an epitope specifically recognized by trastuzumab.
- the monoclonal antibody-specific epitope comprises or consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 82, preferably the amino acid sequence of SEQ ID NO: 82.
- the inactivated cell surface receptor further comprises a cytokine, such as interleukin- 15 or interleukin-2.
- Interleukin- 15 refers to a cytokine that regulates T and NK cell activation and proliferation, or a functional portion thereof.
- a “functional portion” (“biologically active portion”) of a cytokine refers to a portion of the cytokine that retains one or more functions of full length or mature cytokine.
- Such functions for IL- 15 include the promotion of NK cell survival, regulation of NK cell and T cell activation and proliferation as well as the support of NK cell development from hematopoietic stem cells.
- the sequence of a variety of IL- 15 molecules are known in the art.
- the IL-15 is a wild-type IL- 15. In certain embodiments, the IL- 15 is a human IL- 15. In certain embodiments, the IL- 15 comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 72, preferably the amino acid sequence of SEQ ID NO: 72.
- Interleukin-2 refers to a cytokine that regulates T and NK cell activation and proliferation, or a functional portion thereof.
- the IL-2 is a wild-type IL-2.
- the IL-2 is a human IL-2.
- the IL-2 comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 76, preferably the amino acid sequence of SEQ ID NO: 76.
- an inactivated cell surface receptor comprises a monoclonal antibody-specific epitope operably linked to a cytokine, preferably by an autoprotease peptide sequence.
- the autoprotease peptide include, but are not limited to, a peptide sequence selected from the group consisting of porcine teschovirus-1 2A (P2A), a foot-and-mouth disease virus (FMDV) 2A (F2A), an Equine Rhinitis A Virus (ERAV) 2A (E2A), a Thosea asigna virus 2A (T2A), a cytoplasmic polyhedrosis virus 2A (BmCPV2A), a Flacherie Virus 2A (BmIFV2A), and a combination thereof.
- P2A porcine teschovirus-1 2A
- FMDV foot-and-mouth disease virus
- E2A Equine Rhinitis A Virus
- T2A a cytoplasmic polyhedrosis virus 2A
- the autoprotease peptide is an autoprotease peptide of porcine tesehovirus-1 2A (P2A).
- the autoprotease peptide comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 73, preferably the amino acid sequence of SEQ ID NO: 73.
- an inactivated cell surface receptor comprises a truncated epithelial growth factor (tEGFR) variant operably linked to an interleukin- 15 (IL- 15) or IL-2 by an autoprotease peptide sequence.
- the inactivated cell surface receptor comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 74, preferably the amino acid sequence of SEQ ID NO: 74.
- an inactivated cell surface receptor further comprises a signal sequence.
- the signal sequence comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 77, preferably the amino acid sequence of SEQ ID NO: 77.
- an inactivated cell surface receptor further comprises a hinge domain.
- the hinge domain is derived from CD8.
- the CD8 hinge domain comprises the amino acid sequence set forth in SEQ ID NO: 21, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 21.
- an inactivated cell surface receptor further comprises a transmembrane domain.
- the transmembrane domain is derived from CD8.
- the CD8 transmembrane domain comprises the amino acid sequence set forth in SEQ ID NO: 23, or a variant thereof having at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 96, at least 97, at least 98 or at least 99%, sequence identity with SEQ ID NO: 23.
- an inactivated cell surface receptor comprises one or more epitopes specifically recognized by an antibody in its extracellular domain, a transmembrane region and a cytoplasmic domain.
- the inactivated cell surface receptor further comprises a hinge region between the epitope(s) and the transmembrane region.
- the inactivated cell surface receptor comprises more than one epitopes specifically recognized by an antibody, the epitopes can have the same or different amino acid sequences, and the epitopes can be linked together via a peptide linker, such as a flexible peptide linker have the sequence of (GGGGS)n, wherein n is an integer of 1-8 (SEQ ID NO: 25).
- the inactivated cell surface receptor further comprises a cytokine, such as an IL- 15 or IL-2.
- the cytokine is in the cytoplasmic domain of the inactivated cell surface receptor.
- the cytokine is operably linked to the epitope(s) specifically recognized by an antibody, directly or indirectly, via an autoprotease peptide sequence, such as those described herein.
- the cytokine is indirectly linked to the epitope(s) by connecting to the transmembrane region via the autoprotease peptide sequence.
- the artificial cell death polypeptide can comprise an inducible Caspase 9 sequence (iCasp9).
- Caspase 9 homodimerizes to become activated. The homodimer undergoes a conformational change and the proteolytic domain of one of a pair of dimers becomes active. Physiologically, this occurs by binding of the CARD domain of Caspase 9 to APAF-1.
- the APAF-1 domain is replaced with a modified FKBP12 which has been mutated to selectively bind a chemical inducer of dimerization (CID). Presence of the CID results in homodimerization and activation.
- CID chemical inducer of dimerization
- iCasp9 is based on a modified human caspase 9 fused to a human FK506 binding protein (FKBP) (Straathof et al (2005) Blood 105:4247-4254). It enables conditional dimerization in the presence of a small molecule CID, known as AP1903.
- AP1903 is an experimental drug and is considered biologically inert since it does not interact with wildtype FKBP12. However clinical experience with this agent is limited to a very small number of patients (Di Stasi, A. et al. (2011) N. Engl. J. Med. 365, 1673-1683; and luliucci, J. D. et al. (2001) J. Clin. Pharmacol. 41, 870-879).
- API 903 is also a relatively large and polar molecule and unlikely to cross the blood-brain barrier.
- Non-limiting exemplary artificial cell death polypeptide / inactivated cell surface receptor regions and sequences are provided in Table 2.
- the inactivated cell surface receptor comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 79, preferably the amino acid sequence of SEQ ID NO: 79.
- the inactivated cell surface receptor comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 81, preferably the amino acid sequence of SEQ ID NO: 81.
- the inactivated cell surface receptor comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 83, preferably the amino acid sequence of SEQ ID NO: 83.
- an iPSC or derivative cell thereof of the application can be further modified by introducing an exogenous polynucleotide encoding one or more proteins related to immune evasion, such as non-classical HLA class I proteins (e.g., HLA-E and HLA-G).
- HLA-E and HLA-G non-classical HLA class I proteins
- disruption of the B2M gene eliminates surface expression of all MHC class I molecules, leaving cells vulnerable to lysis by NK cells through the “missing self’ response.
- Exogenous HLA-E expression can lead to resistance to NK-mediated lysis (Gornalusse et al., Nat Biotechnol. 2017 Aug; 35(8): 765-772).
- the iPSC or derivative cell thereof comprises an exogenous polypeptide encoding at least one of a human leukocyte antigen E (HLA-E) and human leukocyte antigen G (HLA-G).
- HLA-E comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 65, preferably the amino acid sequence of SEQ ID NO: 65.
- the HLA-G comprises an amino acid sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 68, preferably SEQ ID NO: 68.
- the third exogenous polynucleotide encodes a polypeptide comprising a signal peptide operably linked to a mature B2M protein that is fused to an HLA-E via a linker.
- the third exogenous polypeptide comprises an amino acid sequence at least sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 66.
- the third exogenous polynucleotide encodes a polypeptide comprising a signal peptide operably linked to a mature B2M protein that is fused to an HLA-G via a linker.
- the third exogenous polypeptide comprises an amino acid sequence at least sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 69.
- the genomic editing at one or more selected sites may comprise insertions of one or more exogenous polynucleotides encoding other additional artificial cell death polypeptides, targeting modalities, receptors, signaling molecules, transcription factors, pharmaceutically active proteins and peptides, drug target candidates, or proteins promoting engraftment, trafficking, homing, viability, self-renewal, persistence, and/or survival of the genome-engineered iPSCs or derivative cells thereof.
- the exogenous polynucleotides for insertion are operatively linked to (1) one or more exogenous promoters comprising CMV, Efla, PGK, CAG, UBC, or other constitutive, inducible, temporal-, tissue-, or cell type-specific promoters; or (2) one or more endogenous promoters comprised in the selected sites comprising AAVS1, CCR5, ROSA26, collagen, HTRP, Hll, beta-2 microglobulin, GAPDH, TCR or RUNX1, or other locus meeting the criteria of a genome safe harbor.
- exogenous promoters comprising CMV, Efla, PGK, CAG, UBC, or other constitutive, inducible, temporal-, tissue-, or cell type-specific promoters
- endogenous promoters comprised in the selected sites comprising AAVS1, CCR5, ROSA26, collagen, HTRP, Hll, beta-2 microglobulin, GAPDH, TCR or RUNX1, or other locus
- the genome-engineered iPSCs generated using the above method comprise one or more different exogenous polynucleotides encoding proteins comprising caspase, thymidine kinase, cytosine deaminase, B-cell CD20, ErbB2 or CD79b wherein when the genome-engineered iPSCs comprise two or more suicide genes, the suicide genes are integrated in different safe harbor locus comprising AAVS1, CCR5, ROSA26, collagen, HTRP, Hll, Hll, beta-2 microglobuhn, GAPDH, TCR or RUNX1.
- exogenous polynucleotides encoding proteins may include those encoding PET reporters, homeostatic cytokines, and inhibitory checkpoint inhibitory proteins such as PD1, PD- Ll, and CTLA4 as well as proteins that target the CD47/signal regulatory protein alpha (SIRPa) axis.
- the genome- engineered iPSCs generated using the method provided herein comprise in/del at one or more endogenous genes associated with targeting modality, receptors, signaling molecules, transcription factors, drug target candidates, immune response regulation and modulation, or proteins suppressing engraftment, trafficking, homing, viability, self-renewal, persistence, and/or survival of the iPSCs or derivative cells thereof.
- one or more of the exogenous polynucleotides are integrated at one or more loci on the chromosome of an iPSC.
- Genome editing, or genomic editing, or genetic editing, as used interchangeably herein, is a type of genetic engineering in which DNA is inserted, deleted, and/or replaced in the genome of a targeted cell.
- Targeted genome editing (interchangeable with “targeted genomic editing” or “targeted genetic editing”) enables insertion, deletion, and/or substitution at pre-selected sites in the genome.
- targeted genomic editing or “targeted genetic editing”
- targeted editing can also be used to disrupt endogenous gene expression with precision.
- Targeted integration referring to a process involving insertion of one or more exogenous sequences at pre-selected sites in the genome, with or without deletion of an endogenous sequence at the insertion site.
- Targeted editing can be achieved either through a nuclease-independent approach, or through a nuclease-dependent approach.
- nuclease-independent targeted editing approach homologous recombination is guided by homologous sequences flanking an exogenous polynucleotide to be inserted, through the enzymatic machinery of the host cell.
- targeted editing could be achieved with higher frequency through specific introduction of double strand breaks (DSBs) by specific rare-cutting endonucleases.
- DSBs double strand breaks
- Such nuclease-dependent targeted editing utilizes DNA repair mechanisms including non-homologous end joining (NHEJ), which occurs in response to DSBs. Without a donor vector containing exogenous genetic material, the NHEJ often leads to random insertions or deletions (in/dels) of a small number of endogenous nucleotides.
- NHEJ non-homologous end joining
- the exogenous genetic material can be introduced into the genome during homology directed repair (HDR) by homologous recombination, resulting in a “targeted integration.”
- HDR homology directed repair
- DSBs Available endonucleases capable of introducing specific and targeted DSBs include, but not limited to, zinc-finger nucleases (ZFN), transcription activator-like effector nucleases (TALEN), RNA-guided CRISPR (Clustered Regular Interspaced Short Palindromic Repeats) systems. Additionally, DICE (dual integrase cassette exchange) system utilizing phiC31 and Bxbl integrases is also a promising tool for targeted integration.
- ZFN zinc-finger nucleases
- TALEN transcription activator-like effector nucleases
- CRISPR Clustered Regular Interspaced Short Palindromic Repeats
- ZFNs are targeted nucleases comprising a nuclease fused to a zinc finger DNA binding domain.
- a “zinc finger DNA binding domain” or “ZFBD” it is meant a polypeptide domain that binds DNA in a sequence-specific manner through one or more zinc fingers.
- a zinc finger is a domain of about 30 amino acids within the zinc finger binding domain whose structure is stabilized through coordination of a zinc ion. Examples of zinc fingers include, but not limited to, C2H2 zinc fingers, C3H zinc fingers, and C4 zinc fingers.
- a “designed” zinc finger domain is a domain not occurring in nature whose design/composition results principally from rational criteria, e.g., application of substitution rules and computerized algorithms for processing information in a database storing information of existing ZFP designs and binding data. See, for example, U.S. Pat. Nos. 6,140,081; 6,453,242; and 6,534,261; see also WO 98/53058; WO 98/53059; WO 98/53060; WO 02/016536 and WO 03/016496.
- a “selected” zinc finger domain is a domain not found in nature whose production results primarily from an empirical process such as phage display, interaction trap or hybrid selection. ZFNs are described in greater detail in U.S. Pat. No.
- a TALEN is a targeted nuclease comprising a nuclease fused to a TAE effector DNA binding domain.
- transcription activator-like effector DNA binding domain By “transcription activator-like effector DNA binding domain”, “TAL effector DNA binding domain”, or “TALE DNA binding domain” it is meant the polypeptide domain of TAL effector proteins that is responsible for binding of the TAL effector protein to DNA.
- TAL effector proteins are secreted by plant pathogens of the genus Xanthomonas during infection. These proteins enter the nucleus of the plant cell, bind effector-specific DNA sequences via their DNA binding domain, and activate gene transcription at these sequences via their transactivation domains.
- TAL effector DNA binding domain specificity depends on an effector-variable number of imperfect 34 amino acid repeats, which comprise polymorphisms at select repeat positions called repeat variable-diresidues (RVD).
- RVD repeat variable-diresidues
- TALENs are described in greater detail in U.S. Patent Application No. 2011/0145940, which is herein incorporated by reference.
- the most recognized example of a TALEN in the art is a fusion polypeptide of the Fokl nuclease to a TAL effector DNA binding domain.
- a targeted nuclease that finds use in the subject methods is a targeted Spoil nuclease, a polypeptide comprising a Spol 1 polypeptide having nuclease activity fused to a DNA binding domain, e.g. a zinc finger DNA binding domain, a TAL effector DNA binding domain, etc. that has specificity for a DNA sequence of interest.
- a DNA binding domain e.g. a zinc finger DNA binding domain, a TAL effector DNA binding domain, etc. that has specificity for a DNA sequence of interest.
- targeted nucleases suitable for the present application include, but not limited to Bxbl, phiC3 1, R4, PhiBTl, and Wp/SPBc/TP901-l, whether used individually or in combination.
- Other non-limiting examples of targeted nucleases include naturally occurring and recombinant nucleases; CRISPR related nucleases from families including cas, cpf, cse, csy, csn, csd, cst, csh, csa, csm, and cmr; restriction endonucleases; meganucleases; homing endonucleases, and the like.
- CRISPR/Cas9 requires two major components: (1) a Cas9 endonuclease and (2) the crRNA-tracrRNA complex. When coexpressed, the two components form a complex that is recruited to a target DNA sequence comprising PAM and a seeding region near PAM.
- the crRNA and tracrRNA can be combined to form a chimeric guide RNA (gRNA) to guide Cas9 to target selected sequences.
- gRNA chimeric guide RNA
- CRISPR/Cpfl comprises two major components: (1) a CPfl endonuclease and (2) a crRNA.
- the two components When co-expressed, the two components form a ribobnucleoprotein (RNP) complex that is recruited to a target DNA sequence comprising PAM and a seeding region near PAM.
- the crRNA can be combined to form a chimeric guide RNA (gRNA) to guide Cpfl to target selected sequences.
- gRNA chimeric guide RNA
- MAD7 is an engineered Cas 12a variant originating from the bacterium Eubacterium rectale that has a preference for 5'-TTTN-3' and 5'-CTTN-3' PAM sites and does not require a tracrRNA. See, for example, PCT Publication No. 2018/236548, the disclosure of which is incorporated herein by reference.
- DICE mediated insertion uses a pair of recombinases, for example, phiC31 and Bxbl, to provide unidirectional integration of an exogenous DNA that is tightly restricted to each enzymes’ own small attB and attP recognition sites. Because these target att sites are not naturally present in mammalian genomes, they must be first introduced into the genome, at the desired integration site. See, for example, U.S. Application Publication No. 2015/0140665, the disclosure of which is incorporated herein by reference.
- One aspect of the present application provides a construct comprising one or more exogenous polynucleotides for targeted genome integration.
- the construct further comprises a pair of homologous arm specific to a desired integration site, and the method of targeted integration comprises introducing the construct to cells to enable site specific homologous recombination by the cell host enzymatic machinery.
- the method of targeted integration in a cell comprises introducing a construct comprising one or more exogenous polynucleotides to the cell, and introducing a ZFN expression cassette comprising a DNA-binding domain specific to a desired integration site to the cell to enable a ZFN-mediated insertion.
- the method of targeted integration in a cell comprises introducing a construct comprising one or more exogenous polynucleotides to the cell, and introducing a TALEN expression cassette comprising a DNA-binding domain specific to a desired integration site to the cell to enable a TALEN-mediated insertion.
- the method of targeted integration in a cell comprises introducing a construct comprising one or more exogenous polynucleotides to the cell, introducing a Cpfl expression cassette, and a gRNA comprising a guide sequence specific to a desired integration site to the cell to enable a Cpfl -mediated insertion.
- the method of targeted integration in a cell comprises introducing a construct comprising one or more exogenous polynucleotides to the cell, introducing a Cas9 expression cassette, and a gRNA comprising a guide sequence specific to a desired integration site to the cell to enable a Cas9-mediated insertion.
- the method of targeted integration in a cell comprises introducing a construct comprising one or more att sites of a pair of DICE recombinases to a desired integration site in the cell, introducing a construct comprising one or more exogenous polynucleotides to the cell, and introducing an expression cassette for DICE recombinases, to enable DICE-mediated targeted integration.
- Sites for targeted integration include, but are not limited to, genomic safe harbors, which are intragenic or extragenic regions of the human genome that, theoretically, are able to accommodate predictable expression of newly integrated DNA without adverse effects on the host cell or organism.
- the genome safe harbor for the targeted integration is one or more loci of genes selected from the group consisting of AAVS1, CCR5, ROSA26, collagen, HTRP, Hll, GAPDH, TCR and RUNX1 genes.
- the site for targeted integration is selected for deletion or reduced expression of an endogenous gene at the insertion site.
- the term “deletion” with respect to expression of a gene refers to any genetic modification that abolishes the expression of the gene. Examples of “deletion” of expression of a gene include, e.g., a removal or deletion of a DNA sequence of the gene, an insertion of an exogenous polynucleotide sequence at a locus of the gene, and one or more substitutions within the gene, which abolishes the expression of the gene.
- MHC deficient including MHC-class I deficient, or MHC-class II deficient, or both, refers to cells that either lack, or no longer maintain, or have reduced level of surface expression of a complete MHC complex comprising a MHC class I protein heterodimer and/or a MHC class II heterodimer, such that the diminished or reduced level is less than the level naturally detectable by other cells or by synthetic methods.
- MHC class I deficiency can be achieved by functional deletion of any region of the MHC class I locus (chromosome 6p21), or deletion or reducing the expression level of one or more MHC class-I associated genes including, not being limited to, beta-2 microglobulin (B2M) gene, TAP 1 gene, TAP 2 gene and Tapasin genes.
- B2M gene encodes a common subunit essential for cell surface expression of all MHC class I heterodimers.
- B2M null cells are MHC -I deficient.
- MHC class II deficiency can be achieved by functional deletion or reduction of MHC-II associated genes including, not being limited to, RFXANK, CIITA, RFX5 and RFXAP.
- CIITA is a transcriptional coactivator, functioning through activation of the transcription factor RFX5 required for class II protein expression.
- CIITA null cells are MHC-II deficient.
- one or more of the exogenous polynucleotides are integrated at one or more loci of genes selected from the group consisting of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes to thereby delete or reduce the expression of the gene(s) with the integration.
- the exogenous polynucleotides are integrated at one or more loci on the chromosome of the cell, preferably the one or more loci are of genes selected from the group consisting of AAVS1, CCR5, ROSA26, collagen, HTRP, Hl 1, GAPDH, RUNX1, B2M, TAPI, TAP2, Tapasin, NLRC5, CIITA, RFXANK, CIITA, RFX5, RFXAP, TCR a or b constant region, NKG2A, NKG2D, CD38, CIS, CBL-B, SOCS2, PD1, CTLA4, LAG3, TIM3, or TIGIT genes, provided at least one of the one or more loci is of a MHC gene, such as a gene selected from the group consisting of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes.
- a MHC gene such as a gene selected from the group consist
- the one or more exogenous polynucleotides are integrated at a locus of an MHC class-I associated gene, such as a beta-2 microglobulin (B2M) gene, TAP 1 gene, TAP 2 gene or Tapasin gene; and at a locus of an MHC-II associated gene, such as a RFXANK, CIITA, RFX5, RFXAP, or CIITA gene; and optionally further at a locus of a safe harbor gene selected from the group consisting of AAVS1, CCR5, ROSA26, collagen, HTRP, Hll, GAPDH, TCR and RUNX1 genes. More preferably, the one or more of the exogenous polynucleotides are integrated at the loci of CIITA, AAVS1 and B2M genes.
- B2M beta-2 microglobulin
- the first exogenous polynucleotide is integrated at a locus of AAVS1 gene;
- the second exogenous polypeptide is integrated at a locus of CIITA gene;
- the third exogenous polypeptide is integrated at a locus of B2M gene; wherein integrations of the exogenous polynucleotides delete or reduce expression of CIITA and B2M genes.
- the first exogenous polynucleotide comprises the polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 62;
- the second exogenous polynucleotide comprises the polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 75;
- the third exogenous polynucleotide comprises the polynucleotide sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 67.
- the first exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 62;
- the second exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 75; and
- the third exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 67.
- the present disclosure describes genetically engineered iPSCs and cells derived therefrom that exogenously express recombinant CD 16 and recombinant NKG2D.
- such cells also express one or more CARs (e.g., one or more CARs comprising a CD22 antigen binding domain and/or a CD 19 antigen binding domain).
- CARs e.g., one or more CARs comprising a CD22 antigen binding domain and/or a CD 19 antigen binding domain.
- such cells may express a single CAR comprising one or more antigen binding domains that bind CD22 and/or CD19.
- such cells may express two or more CARs, wherein each CAR comprises an antigen binding domain that binds a tumor antigen, wherein the tumor antigens are independently selected from the group consisting of CD22 and CD 19.
- Described herein is a method for exogenously expressing or overexpressing CD 16 and NKG2D proteins and transgenes in cells, as well as such cells and therapeutic uses thereof.
- the surface receptor CD 16 (FcyRIIIA) affects human natural killer (NK) cells during maturation. NK cells bind the Fc portion of IgG via CD 16, and execute antibody - dependent cellular cytotoxicity, which is critical for the effectiveness of several antitumor monoclonal antibody therapies.
- NK cells bind the Fc portion of IgG via CD 16, and execute antibody - dependent cellular cytotoxicity, which is critical for the effectiveness of several antitumor monoclonal antibody therapies.
- NKG2D is an stimulatory/activating receptor that is mostly expressed on cells of the cytotoxic arm of the immune system including NK cells and subsets of T cells. NKG2D is crucial in diverse aspects of innate and adaptive immune functions.
- CD 16 and NKG2D are expressed from in a single polynucleotide construct as it is
- an iPSC or derivative cell thereof containing an exogenous or isolated polynucleotide construct encoding a CD 16 protein and an NKG2D protein.
- described herein is an iPSC or derivative cell thereof expressing recombinant CD 16 proteins and recombinant NKG2D proteins.
- the recombinant proteins are encoded by an exogenous or isolated polynucleotide construct.
- the polynucleotide construct encoding the CD 16 protein and the NKG2D protein also includes a polynucleotide sequence encoding an autoprotease peptide or self-cleaving peptide.
- an exogenous polynucleotide construct encoding the CD 16 protein, the NKG2D protein and the self-cleaving peptide is introduced into the iPSC or derivative cell thereof.
- the exogenous or isolated polynucleotide construct can be introduced into a gene locus of the iPSC or derivative cell thereof.
- the iPSC or derivative cell thereof expressing recombinant CD 16 proteins and recombinant NKG2D proteins also expresses chimeric antigen receptors (CARs).
- CARs chimeric antigen receptors
- the cell expressing recombinant CD 16 proteins and recombinant NKG2D proteins also expresses either recombinant HLA-E, HLA-G, or both.
- the iPSC or derivative cell thereof expressing recombinant CD 16 proteins and recombinant NKG2D proteins also expresses CARs and either recombinant HLA-E, HLA-G, or both.
- the cell expressing recombinant CD 16 proteins, recombinant NKG2D proteins and CARs also expresses recombinant IL- 15 proteins.
- the cell expresses recombinant CD 16 proteins, recombinant NKG2D proteins, CARs, recombinant IL- 15 proteins, and either recombinant HLA-E, HLA-G, or both.
- the cell expressing recombinant CD 16 proteins, recombinant NKG2D proteins and CARs also expresses recombinant fusion proteins containing IL- 15 and IL-15Ra.
- the cell expresses recombinant CD 16 proteins, recombinant NKG2D proteins, CARs, recombinant fusion proteins containing IL- 15 and IL-15Ra, and either recombinant HLA-E, HLA-G, or both.
- the cell expressing recombinant CD 16 proteins and recombinant NKG2D proteins also expresses recombinant IL-15 proteins.
- the cell expressing recombinant CD 16 proteins and recombinant NKG2D proteins also expresses recombinant fusion proteins containing IL- 15 and IL-15Ra.
- the cell expressing recombinant CD 16 proteins, recombinant NKG2D proteins, and recombinant IL- 15 proteins also expresses CARs.
- the cell expressing recombinant CD 16 proteins, recombinant NKG2D proteins, and recombinant fusion proteins containing IL- 15 and IL-15Ra also expresses CARs.
- an exogenous or isolated polynucleotide construct encoding a CD 16 protein and an NKG2D protein.
- the polynucleotide sequence encoding a CD 16 protein and the polynucleotide sequence encoding an NKG2D protein are operably linked by a polynucleotide sequence encoding an autoprotease peptide or self-cleaving peptide.
- the polynucleotide construct includes from 5’ to 3’ end: a polynucleotide sequence encoding a CD 16 protein, a polynucleotide sequence encoding an autoprotease peptide or self-cleaving peptide and a polynucleotide sequence encoding a NKG2D protein.
- the polynucleotide construct includes from 5’ to 3’ end: a polynucleotide sequence encoding an NKG2D protein, a polynucleotide sequence encoding an autoprotease peptide or self-cleaving peptide and a polynucleotide sequence encoding a CD 16 protein.
- the exogenous polynucleotide construct comprises the nucleic acid sequence of SEQ ID NO: 179. In some embodiments, the exogenous polynucleotide construct encodes for the amino acid sequence of SEQ ID NO: 180.
- the CD 16 protein (which is also referred to as “low affinity immunoglobulin gamma Fc region receptor III- A” or “Fc gamma receptor Illa”) is a wildtype CD 16 protein.
- the human wildtype CD 16 protein has the amino acid sequence set forth in NCBI Ref. Seq. No. NP_000560.7 or UniProt No. P08637. In some instance, the coding sequence of human wildtype CD16 is set forth in NCBI Ref. No. NM_000569.8.
- the CD 16 protein is a CD 16 variant protein.
- the CD 16 variant protein has an amino acid sequence having at least 90%, e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to wildtype CD 16 such as that of SEQ ID NO: 181.
- the CD16 variant is a high affinity CD16 variant.
- the CD 16 variant is a non-cleavable CD 16 variant.
- the CD 16 variant is a high affinity and non-cleavable CD 16 variant.
- the CD 16 variant comprises one or more amino acid substitutions selected from the group consisting of F158V, F176V, S197P, D205A, S219A, T220A, and any combination thereof.
- the CD 16 variant has an Fl 58V substitution and one or more substitutions selected from Fl 76V, S197P, D205A, S219A, T220A, and any combination thereof.
- the CD 16 variant has an F176V substitution and one or more substitutions selected from Fl 58V, S197P, D205A, S219A, T220A, and any combination thereof.
- the CD 16 variant has an S197P, substitution and one or more substitutions selected from F158V, F176V, D205A, S219A, T220A, and any combination thereof.
- the CD 16 variant has a D205A substitution and one or more substitutions selected from Fl 58V, F176V, S197P, S219A, T220A, and any combination thereof.
- the CD 16 variant has a substitution and one or more substitutions selected from Fl 58V, F176V, S197P, D205A, S219A, T220A, and any combination thereof.
- the CD 16 variant has an S219A substitution and one or more substitutions selected from F158V, F176V, S197P, D205A, T220A, and any combination thereof. In some embodiments, the CD 16 variant has a T220A substitution and one or more substitutions selected from F158V, F176V, S197P, D205A, S219A, T220A, and any combination thereof. In some embodiments, the variant CD 16 protein has the sequence of SEQ ID NO: 182. In some embodiments, the nucleic acid sequence encoding the variant CD16 protein has the sequence of SEQ ID NO: 183. In some embodiments, the wildtype CD16 protein has the sequence of SEQ ID NO: 181.
- the NKG2D protein (which is also referred to as NKG2-D type II integral membrane protein, CD314, killer cell lectin-like receptor subfamily KI member 1 or KLRK1) is a wildtype NKG2D protein.
- the human wildtype NKG2D protein has the amino acid sequence set forth in NCBI Ref. Seq. Nos. NP_001186734.1 or NP_031386.2 or UniProt No. P26718.
- the coding sequence of human wildtype NKG2D is set forth in NCBI Ref. Nos. NM_001199805.1 or NM_007360.3.
- the NKG2D protein is a NKG2D variant protein.
- the NKG2D variant protein has an amino acid sequence having at least 90%, e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to wildtype NKG2D such as that of SEQ ID NO: 184.
- the NKG2D protein has the amino acid sequence of SEQ ID NO: 184.
- the nucleic acid sequence encoding the NKG2D protein has sequence of SEQ ID NO: 185.
- constructs containing autoprotease peptide sequences including 2A peptides that can induce ribosomal skipping during translation of an polypeptide.
- 2A peptides function to “cleave” an mRNA transcript by making the ribosome skip the synthesis of a peptide bond at the C-terminus, between the glycine (G) and proline (P) residues, thereby leading to separation between the end of the 2A sequence and the next peptide downstream.
- 2A peptides include, but are not limited to, a porcine tesehovirus-1 2A (P2A) peptide, a foot-and-mouth disease virus (FMDV) 2A (F2A) peptide, an Equine Rhinitis A Virus (ERAV) 2A (E2A) peptide, a Thosea asigna virus 2A (T2A) peptide, a cytoplasmic polyhedrosis virus 2A (BmCPV2A) peptide, and a Flacherie Virus 2A (BmIFV2A) peptide.
- P2A porcine tesehovirus-1 2A
- FMDV foot-and-mouth disease virus
- F2A foot-and-mouth disease virus
- E2A Equine Rhinitis A Virus
- T2A cytoplasmic polyhedrosis virus
- BmCPV2A cytoplasmic polyhedrosis virus
- BmIFV2A Flacherie Virus 2A
- An exemplary P2a peptide can include an amino acid sequence having at least 90%, such as 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to SEQ ID NO: 186.
- the P2A peptide has the amino acid sequence of SEQ ID NO: 186.
- the invention relates to a cell derived from differentiation of an iPSC, a derivative cell.
- the genomic edits introduced into the iPSC cell are retained in the derivative cell.
- the derivative cell is a hematopoietic cell, including, but not limited to, HSCs (hematopoietic stem and progenitor cells), hematopoietic multipotent progenitor cells, T cell progenitors, NK cell progenitors, T cells, NKT cells, NK cells, B cells, antigen presenting cells (APC), monocytes and macrophages.
- the derivative cell is an immune effector cell, such as a NK cell or a T cell.
- the application provides a natural killer (NK) cell or a T cell comprising: (i) an exogenous polynucleotide encoding a chimeric antigen receptor (CAR); (ii) a deletion or reduced expression of an MHC class I associated gene and an MHC class II associated gene, such as an MHC class-I associated gene selected from the group consisting of a B2M gene, TAP 1 gene, TAP 2 gene and Tapasin gene, and an MHC-II associated gene selected from the group consisting of a RFXANK gene, CIITA gene, RFX5 gene, RFXAP gene, and CIITA gene, preferably the B2M gene and CIITA gene; and optionally (iii) an exogenous polynucleotide encoding a chimeric IL-15RA and an interleukin 15 (IL- 15), wherein the IL-15RA and IL- 15 are operably linked.
- CAR chimeric antigen receptor
- the NK cell or T cell further comprises an exogenous polynucleotide encoding at least one of a human leukocyte antigen E (HLA-E) and a human leukocyte antigen G (HLA-G).
- HLA-E human leukocyte antigen E
- HLA-G human leukocyte antigen G
- a NK cell or a T cell comprising: (i) an exogenous polynucleotide encoding a chimeric antigen receptor (CAR) having the amino acid sequence of SEQ ID NO: 61; (ii) an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) having the amino acid sequence of SEQ ID NO: 66; and optionally (iii) an exogenous polynucleotide encoding a chimeric IL-15RA and an interleukin 15 (IL- 15), wherein the IL-15RA and IL- 15 are operably linked, having the amino acid sequence of SEQ ID NO: 202. wherein the exogenous polynucleotides are integrated at loci of AAVS1, B2M, and CIITA genes, respectively, to thereby delete or reduce expression of CIITA and B2M.
- CAR chimeric antigen receptor
- HLA-E human leukocyte antigen E
- the first exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 62; the second exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 75; and the third exogenous polynucleotide comprises the polynucleotide sequence of SEQ ID NO: 67.
- HPC hematopoietic progenitor cell
- iPSC induced pluripotent stem cell
- a CD34+ hematopoietic progenitor cell derived from an induced pluripotent stem cell (iPSC) comprising: (i) an exogenous polynucleotide encoding a chimeric antigen receptor (CAR); (ii) an exogenous polynucleotide encoding an inactivated cell surface receptor that comprises a monoclonal antibody-specific epitope and an interleukin 15 (IL- 15), wherein the inactivated cell surface receptor and IL- 15 are operably linked by an autoprotease peptide sequence; and (iii) a deletion or reduced expression of one or more of B2M, TAP 1, TAP 2, Tapasin, RFXANK, CIITA, RFX5 and RFXAP genes.
- B2M B2M, TAP 1, TAP 2, Tapasin, RFXANK
- the CD34+ HPC further comprises an exogenous polynucleotide encoding a human leukocyte antigen E (HLA-E) and/or human leukocyte antigen G (HLA-G).
- HLA-E human leukocyte antigen E
- HLA-G human leukocyte antigen G
- the CAR comprises (i) a signal peptide comprising a signal peptide; (ii) an extracellular domain comprising a binding domain that specifically binds the CD 19 antigen; (iii) a hinge region; (iv) a transmembrane domain; (v) an intracellular signaling domain; and (vi) a co-stimulatory domain, such as a co-stimulatory domain comprising a CD28 signaling domain.
- the method comprises differentiating the iPSC under conditions for cell differentiation to thereby obtain the derivative cell.
- An iPSC of the application can be differentiated by any method known in the art. Exemplary methods are described in US8846395, US8945922, US8318491, WO20 10/099539, WO2012/109208, WO2017/070333, WO2017/179720, W02016/010148, WO2018/048828 and WO2019/157597, each of which are herein incorporated by reference in its entirety.
- the differentiation protocol may use feeder cells or may be feeder-free.
- feeder cells are terms describing cells of one type that are co-cultured with cells of a second type to provide an environment in which the cells of the second type can grow, expand, or differentiate, as the feeder cells provide stimulation, growth factors and nutrients for the support of the second cell type.
- the iPSC derivative cells of the invention are NK cells which are prepared by a method of differentiating an iPSC cell into an NK cell by subjecting the cells to a differentiation protocol including the addition of recombinant human IL-12p70 for the final 24 hours of culture.
- a differentiation protocol including the addition of recombinant human IL-12p70 for the final 24 hours of culture.
- cells that are primed with IL- 12 demonstrate more rapid cell killing compared to those that are differentiated in the absence of IL- 12.
- the cells differentiated using the IL- 12 conditions demonstrate improved cancer cell growth inhibition.
- the invention in another general aspect, relates to an isolated nucleic acid encoding a chimeric antigen receptor (CAR) useful for an invention according to embodiments of the application.
- CAR chimeric antigen receptor
- the coding sequence of a CAR can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding CARs of the application can be altered without changing the amino acid sequences of the proteins.
- the isolated nucleic acid encodes a CAR targeting CD 19.
- the isolated nucleic acid encoding the CAR comprises a polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 62, preferably the polynucleotide sequence of SEQ ID NO: 62.
- the application provides a vector comprising a polynucleotide sequence encoding a CAR useful for an invention according to embodiments of the application.
- Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector.
- the vector is a recombinant expression vector such as a plasmid.
- the vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication.
- the promoter can be a constitutive, inducible, or repressible promoter.
- a number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of a CAR in the cell.
- Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the application.
- the application provides vectors for targeted integration of a CAR useful for an invention according to embodiments of the application.
- the vector comprises an exogenous polynucleotide having, in the 5’ to 3’ order, (a) a promoter; (b) a polynucleotide sequence encoding a CAR according to an embodiment of the application; and (c) a terminator/polyadenylation signal.
- the promoter is a CAG promoter.
- the CAG promoter comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 63.
- Other promoters can also be used, examples of which include, but are not limited to, EFla, UBC, CMV, SV40, PGK1, and human beta actin.
- the terminator/ polyadenylation signal is a SV40 signal.
- the SV40 signal comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 64.
- Other terminator sequences can also be used, examples of which include, but are not limited to, BGH, hGH, and PGK.
- the polynucleotide sequence encoding a CAR comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 62.
- the vector further comprises a left homology arm and a right homology arm flanking the exogenous polynucleotide.
- left homology arm and right homology arm refers to a pair of nucleic acid sequences that flank an exogenous polynucleotide and facilitate the integration of the exogenous polynucleotide into a specified chromosomal locus. Sequences of the left and right arm homology arms can be designed based on the integration site of interest. In some embodiment, the left or right arm homology arm is homologous to the left or right side sequence of the integration site.
- the left homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 90.
- the right homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 91.
- the vector comprises a polynucleotide sequence at least 85%, such as at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 92, preferably the polynucleotide sequence of SEQ ID NO: 92.
- the invention relates to an isolated nucleic acid encoding an inactivated cell surface receptor useful for an invention according to embodiments of the application.
- the coding sequence of an inactivated cell surface receptor can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein.
- nucleic acid sequences encoding an inactivated cell surface receptor of the application can be altered without changing the amino acid sequences of the proteins.
- an isolated nucleic acid encodes any inactivated cell surface receptor described herein, such as that comprises a monoclonal antibody-specific epitope, and a cytokine, such as an IL- 15 or IL-2, wherein the monoclonal antibody - specific epitope and the cytokine are operably linked by an autoprotease peptide sequence.
- the isolated nucleic acid encodes an inactivated cell surface receptor comprising an epitope specifically recognized by an antibody, such as ibritumomab, tiuxetan, muromonab-CD3, tositumomab, abciximab, basiliximab, brentuximab vedotin, cetuximab, infliximab, rituximab, alemtuzumab, bevacizumab, certolizumab pegol, daclizumab, eculizumab, efalizumab, gemtuzumab, natalizumab, omalizumab, palivizumab, ranibizumab, tocilizumab, trastuzumab, vedolizumab, adalimumab, belimumab, canakinumab, denosumab, golimumab, ipilimum
- the isolated nucleic acid encodes an inactivated cell surface receptor having a truncated epithelial growth factor (tEGFR) variant.
- the inactivated cell surface receptor comprises an epitope specifically recognized by cetuximab, matuzumab, necitumumab or panitumumab, preferably cetuximab.
- the isolated nucleic acid encodes an inactivated cell surface receptor having one or more epitopes of CD79b, such as an epitope specifically recognized by polatuzumab vedotin.
- the isolated nucleic acid encodes an inactivated cell surface receptor having one or more epitopes of CD20, such as an epitope specifically recognized by rituximab.
- the isolated nucleic acid encodes an inactivated cell surface receptor having one or more epitopes of Her 2 receptor, such as an epitope specifically recognized by trastuzumab
- the autoprotease peptide sequence is porcine tesehovirus- 1 2A (P2A).
- the truncated epithelial growth factor (tEGFR) variant consists of an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 71.
- the monoclonal antibody-specific epitope specifically recognized by polatuzumab vedotin consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 78.
- the monoclonal antibody-specific epitope specifically recognized by rituximab consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 80.
- the monoclonal antibody-specific epitope specifically recognized by trastuzumab consists of an amino acid sequence at least 90%, such as at least 90%, 91%, 82%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%, identical to SEQ ID NO: 82.
- the IL- 15 comprises an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 72.
- the autoprotease peptide has an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 73.
- the polynucleotide sequence encodes a polypeptide comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 74.
- the isolated nucleic acid encoding the inactivated cell surface receptor comprises a polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 75, preferably the polynucleotide sequence of SEQ ID NO: 75.
- the polynucleotide sequence encodes a polypeptide comprising an amino acid sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity to the amino acid sequence of SEQ ID NO: 79.
- the application provides a vector comprising a polynucleotide sequence encoding an inactivated cell surface receptor useful for an invention according to embodiments of the application.
- Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector.
- the vector is a recombinant expression vector such as a plasmid.
- the vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication.
- the promoter can be a constitutive, inducible, or repressible promoter.
- a number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of a inactivated cell surface receptor in the cell.
- Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the application.
- the application provides a vector for targeted integration of an inactivated cell surface receptor useful for an invention according to embodiments of the application.
- the vector comprises an exogenous polynucleotide having, in the 5’ to 3’ order, (a) a promoter; (b) a polynucleotide sequence encoding an inactivated cell surface receptor, such as an inactivated cell surface receptor comprising a truncated epithelial growth factor (tEGFR) variant and an interleukin 15 (IL- 15), wherein the tEGFR variant and IL- 15 are operably linked by an autoprotease peptide sequence, such as porcine tesehovirus-1 2A (P2A), and (c) a terminator/ polyadeny lation signal .
- tEGFR truncated epithelial growth factor
- IL- 15 interleukin 15
- the promoter is a CAG promoter.
- the CAG promoter comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 63.
- Other promoters can also be used, examples of which include, but are not limited to, EFla, UBC, CMV, SV40, PGK1, and human beta actin.
- the terminator/polyadeny lation signal is a SV40 signal.
- the SV40 signal comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 64.
- Other terminator sequences can also be used, examples of which include, but are not limited to BGH, hGH, and PGK.
- the polynucleotide sequence encoding an inactivated cell surface receptor comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 75.
- the vector further comprises a left homology arm and a right homology arm flanking the exogenous polynucleotide.
- the left homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 84.
- the right homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 85
- the vector comprises a polynucleotide sequence at least 85%, such as at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 86, preferably the polynucleotide sequence of SEQ ID NO: 86.
- the invention relates to an isolated nucleic acid encoding an HLA construct useful for an invention according to embodiments of the application.
- the coding sequence of an HLA construct can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein.
- nucleic acid sequences encoding an HLA construct of the application can be altered without changing the amino acid sequences of the proteins.
- the isolated nucleic acid encodes an HLA construct comprising a signal peptide, such as an HLA-G signal peptide, operably linked to an HLA coding sequence, such as a coding sequence of a mature B2M, and/or a mature HLA-E.
- the HLA coding sequence encodes the HLA-G and B2M, which are operably linked by a 4X GGGGS linker, and/or the B2M and HLA-E, which are operably linked by a 3X GGGGS linker.
- the isolated nucleic acid encoding the HLA construct comprises a polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 67, preferably the polynucleotide sequence of SEQ ID NO: 67.
- the isolated nucleic acid encoding the HLA construct comprises a polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 70, preferably the polynucleotide sequence of SEQ ID NO: 70.
- the application provides a vector comprising a polynucleotide sequence encoding a HLA construct useful for an invention according to embodiments of the application.
- Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector.
- the vector is a recombinant expression vector such as a plasmid.
- the vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication.
- the promoter can be a constitutive, inducible, or repressible promoter.
- a number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of a HLA construct in the cell.
- Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the application.
- the application provides vectors for targeted integration of a HLA construct useful for an invention according to embodiments of the application.
- the vector comprises an exogenous polynucleotide having, in the 5’ to 3’ order, (a) a promoter; (b) a polynucleotide sequence encoding an HLA construct; and (c) a terminator/polyadenylation signal.
- the promoter is a CAG promoter.
- the CAG promoter comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 63.
- Other promoters can also be used, examples of which include, but are not limited to, EFla, UBC, CMV, SV40, PGK1, and human beta actin.
- the terminator/ polyadenylation signal is a SV40 signal.
- the SV40 signal comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 64.
- Other terminator sequences can also be used, examples of which include, but are not limited to BGH, hGH, and PGK.
- a polynucleotide sequence encoding a HLA construct comprises a signal peptide, such as a HLA-G signal peptide, a mature B2M, and a mature HLA-E, wherein the HLA-G and B2M are operably linked by a 4X GGGGS linker (SEQ ID NO: 31) and the B2M transgene and HLA-E are operably linked by a 3X GGGGS linker (SEQ ID NO: 25).
- the HLA construct comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 67, preferably the polynucleotide sequence of SEQ ID NO: 67.
- the HLA construct comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 70, preferably the polynucleotide sequence of SEQ ID NO: 70.
- the vector further comprises a left homology arm and a right homology arm flanking the exogenous polynucleotide.
- the left homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 87.
- the right homology arm comprises the polynucleotide sequence at least 90%, such as at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 88.
- the vector comprises a polynucleotide sequence at least 85%, such as at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 100%, identical to SEQ ID NO: 89, preferably the polynucleotide sequence of SEQ ID NO: 89.
- the application provides a host cell comprising a vector of the application and/or an isolated nucleic acid encoding a construct of the application.
- Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of exogenous polynucleotides of the application.
- the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
- host cells include, for example, recombinant cells containing a vector or isolated nucleic acid of the application useful for the production of a vector or construct of interest; or an engineered iPSC or derivative cell thereof containing one or more isolated nucleic acids of the application, preferably integrated at one or more chromosomal loci.
- a host cell of an isolated nucleic acid of the application can also be an immune effector cell, such as a T cell or NK cell, comprising the one or more isolated nucleic acids of the application.
- the immune effector cell can be obtained by differentiation of an engineered iPSC of the application. Any suitable method in the art can be used for the differentiation in view of the present disclosure.
- the immune effector cell can also be obtained transfecting an immune effector cell with one or more isolated nucleic acids of the application.
- the application provides a composition comprising an isolated polynucleotide of the application, a host cell and/or an iPSC or derivative cell thereof of the application.
- the composition further comprises one or more therapeutic agents selected from the group consisting of a peptide, a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, , a vector comprising one or more polynucleic acids of interest, an antibody, a chemotherapeutic agent or a radioactive moiety, or an immunomodulatory drug (iMiD).
- a therapeutic agents selected from the group consisting of a peptide, a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, , a vector comprising one or more polynucleic acids of interest, an antibody, a chemotherapeutic agent or a radioactive
- the composition is a pharmaceutical composition comprising an isolated polynucleotide of the application, a host cell and/or an iPSC or derivative cell thereof of the application and a pharmaceutically acceptable carrier.
- pharmaceutical composition means a product comprising an isolated polynucleotide of the application, an isolated polypeptide of the application, a host cell of the application, and/or an iPSC or derivative cell thereof of the application together with a pharmaceutically acceptable carrier.
- Polynucleotides, polypeptides, host cells, and/or iPSCs or derivative cells thereof of the application and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
- the term “carrier” refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application.
- the term “pharmaceutically acceptable carrier” refers to a non-toxic material that does not interfere with the effectiveness of a composition described herein or the biological activity of a composition described herein. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in a polynucleotide, polypeptide, host cell, and/or iPSC or derivative cell thereof can be used.
- compositions of the application are known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 2 ls t edition (2005), and any later editions).
- additional ingredients include: buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents.
- One or more pharmaceutically acceptable carrier may be used in formulating the pharmaceutical compositions of the application.
- Primary cancer cells can be readily distinguished from non-cancerous cells by well-established techniques, particularly histological examination.
- the definition of a cancer cell includes not only a primary cancer cell, but any cell derived from a cancer cell ancestor. This includes metastasized cancer cells, and in vitro cultures and cell lines derived from cancer cells.
- a “clinically detectable” tumor is one that is detectable on the basis of tumor mass; e.g., by procedures such as computed tomography (CT) scan, magnetic resonance imaging (MRI), X-ray, ultrasound or palpation on physical examination, and/or which is detectable because of the expression of one or more cancerspecific antigens in a sample obtainable from a patient.
- CT computed tomography
- MRI magnetic resonance imaging
- X-ray X-ray
- Cancer conditions may be characterized by the abnormal proliferation of malignant cancer cells and may include leukemias, such as AML, CML, ALL and CLL, lymphomas, such as Hodgkin lymphoma, non-Hodgkin lymphoma and multiple myeloma, and solid cancers such as sarcomas, skin cancer, melanoma, bladder cancer, brain cancer, breast cancer, uterus cancer, ovary cancer, prostate cancer, lung cancer, colorectal cancer, cervical cancer, liver cancer, head and neck cancer, esophageal cancer, pancreatic cancer, renal cancer, adrenal cancer, stomach cancer, testicular cancer, cancer of the gall bladder and biliary tracts, thyroid cancer, thymus cancer, cancer of bone, and cerebral cancer, as well as cancer of unknown primary (CUP).
- leukemias such as AML, CML, ALL and CLL
- lymphomas such as Hodgkin lymphoma, non-Hodgkin lymphoma and multiple myeloma
- Cancer cells within an individual may be immunologically distinct from normal somatic cells in the individual (e.g., the cancerous tumor may be immunogenic).
- the cancer cells may be capable of eliciting a systemic immune response in the individual against one or more antigens expressed by the cancer cells.
- the tumor antigens that elicit the immune response may be specific to cancer cells or may be shared by one or more normal cells in the individual.
- the cancer cells of an individual suitable for treatment as described herein may express the antigen and/or may be of correct HLA type to bind the antigen receptor expressed by the T cells.
- An individual suitable for treatment as described above may be a mammal.
- the individual is a human.
- nonhuman mammals especially mammals that are conventionally used as models for demonstrating therapeutic efficacy in humans (e.g. murine, primate, porcine, canine, or rabbit animals) may be employed.
- the individual may have minimal residual disease (MRD) after an initial cancer treatment. In some embodiments, the individual may have no minimal residual disease after one or more cancer treatments or repeated dosing.
- MRD minimal residual disease
- An individual with cancer may display at least one identifiable sign, symptom, or laboratory finding that is sufficient to make a diagnosis of cancer in accordance with clinical standards known in the art. Examples of such clinical standards can be found in textbooks of medicine such as Harrison’s Principles of Internal Medicine, 15th Ed., Fauci AS et al., eds., McGraw-Hill, New York, 2001.
- a diagnosis of a cancer in an individual may include identification of a particular cell type (e.g. a cancer cell) in a sample of a body fluid or tissue obtained from the individual.
- An anti-tumor effect is a biological effect which can be manifested by a reduction in the rate of tumor growth, decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, or amelioration of various physiological symptoms associated with the cancerous condition.
- An "anti-tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies, also T cells which may be obtained according to the methods of the present invention, as described herein in prevention of the occurrence of tumors in the first place.
- Treatment may be any treatment and/or therapy, whether of a human or an animal (e.g. in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the condition, cure or remission (whether partial or total) of the condition, preventing, delaying, abating or arresting one or more symptoms and/or signs of the condition or prolonging survival of a subject or patient beyond that expected in the absence of treatment.
- some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the condition, cure or remission (whether partial or total) of the condition, preventing, delaying, abating or arresting one or more symptoms and/or signs of the condition or prolonging survival of a subject or patient beyond that expected in the absence of treatment.
- Treatment may also be prophylactic (e.g., prophylaxis).
- an individual susceptible to or at risk of the occurrence or re-occurrence of cancer may be treated as described herein. Such treatment may prevent or delay the occurrence or reoccurrence of cancer in the individual.
- treatment may include inhibiting cancer growth, including complete cancer remission, and/or inhibiting cancer metastasis.
- Cancer growth generally refers to any one of a number of indices that indicate change within the cancer to a more developed form.
- indices for measuring an inhibition of cancer growth include a decrease in cancer cell survival, a decrease in tumor volume or morphology (for example, as determined using computed tomographic (CT), sonography, or other imaging method), a delayed tumor growth, a destruction of tumor vasculature, improved performance in delayed hypersensitivity skin test, an increase in the activity of T cells, and a decrease in levels of tumor-specific antigens.
- CT computed tomographic
- T cells modified as described herein may improve the capacity of the individual to resist cancer growth, in particular growth of a cancer already present the subject and/or decrease the propensity for cancer growth in the individual.
- This application provides a method of treating a disease or a condition in a subject in need thereof. The methods comprise administering to the subject in need thereof a therapeutically effective amount of cells of the application and/or a composition of the application.
- the disease or condition is cancer.
- the cancer can, for example, be a solid or a liquid cancer.
- the cancer can, for example, be selected from the group consisting of a lung cancer, a gastric cancer, a colon cancer, a liver cancer, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, an endometrial cancer, a prostate cancer, a thyroid cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin’s lymphoma (NHL), Hodgkin’s lymphoma/disease (HD), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
- the cancer is a non-Hodg
- the composition comprises a therapeutically effective amount of an isolated polynucleotide, an isolated polypeptide, a host cell, and/or an iPSC or derivative cell thereof.
- therapeutically effective amount refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject.
- a therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
- a therapeutically effective amount means an amount of the cells and/or the pharmaceutical composition that modulates an immune response in a subject in need thereof.
- a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce hospitalization length of a subject having the disease, disorder or
- the therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of administration, the target site, the physiological state of the subject (including, e.g., age, body weight, health), whether the subject is a human or an animal, other medications administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
- compositions described herein are formulated to be suitable for the intended route of administration to a subject.
- the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
- the cells of the application and/or the pharmaceutical compositions of the application can be administered in any convenient manner known to those skilled in the art.
- the cells of the application can be administered to the subject by aerosol inhalation, injection, ingestion, transfusion, implantation, and/or transplantation.
- the compositions comprising the cells of the application can be administered transarterially, subcutaneously, intradermaly, intratumorally, intranodally, intramedullary, intramuscularly, inrapleurally, by intravenous (i.v.) injection, or intraperitoneally.
- the cells of the application can be administered with or without lymphodepletion of the subject.
- compositions comprising cells of the application can be provided in sterile liquid preparations, typically isotonic aqueous solutions with cell suspensions, or optionally as emulsions, dispersions, or the like, which are typically buffered to a selected pH.
- the compositions can comprise carriers, for example, water, saline, phosphate buffered saline, and the like, suitable for the integrity and viability of the cells, and for administration of a cell composition.
- Sterile injectable solutions can be prepared by incorporating cells of the application in a suitable amount of the appropriate solvent with various other ingredients, as desired.
- Such compositions can include a pharmaceutically acceptable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like, that are suitable for use with a cell composition and for administration to a subject, such as a human.
- Suitable buffers for providing a cell composition are well known in the art. Any vehicle, diluent, or additive used is compatible with preserving the integrity and viability of the cells of the application.
- the cells of the application and/or the pharmaceutical compositions of the application can be administered in any physiologically acceptable vehicle.
- a cell population comprising cells of the application can comprise a purified population of cells.
- the ranges in purity in cell populations comprising genetically modified cells of the application can be from about 50% to about 55%, from about 55% to about 60%, from about 60% to about 65%, from about 65% to about 70%, from about 70% to about 75%, from about 75% to about 80%, from about 80% to about 85%, from about 85% to about 90%, from about 90% to about 95%, or from about 95% to about 100%. Dosages can be readily adjusted by those skilled in the art, for example, a decrease in purity could require an increase in dosage.
- the cells of the application are generally administered as a dose based on cells per kilogram (cells/kg) of body weight of the subject to which the cells and/or pharmaceutical compositions comprising the cells are administered.
- the cell doses are in the range of about 10 4 to about 10 10 cells/kg of body weight, for example, about 10 5 to about 10 9 , about 10 5 to about 10 8 , about 10 5 to about 10 7 , or about 10 5 to about 10 6 , depending on the mode and location of administration.
- a higher dose is used than in regional administration, where the immune cells of the application are administered in the region of a tumor and/or cancer.
- Exemplary dose ranges include, but are not limited to, 1 x 10 4 to 1 x 10 8 , 2 x 10 4 to 1 x 10 8 , 3 x 10 4 to 1 x 10 8 , 4 x 10 4 to 1 x 10 8 , 5 x 10 4 to 6 x 10 8 , 7 x 10 4 to 1 x 10 8 , 8 x
- the dose can be adjusted to account for whether a single dose is being administered or whether multiple doses are being administered. The precise determination of what would be considered an effective dose can be based on factors individual to each subject. The precise determination of what would be considered an effective dose can be based on factors individual to each subject. The precise determination of what would be considered an effective dose can be based on factors individual to each subject. The precise determination of what would be considered an effective dose can be based on factors individual to each subject.
- the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, which is not necessarily discernible in the subject, but can be discernible in the subject.
- the terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition.
- “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer.
- “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition. In a particular embodiment, “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
- the cells of the application and/or the pharmaceutical compositions of the application can be administered in combination with one or more additional therapeutic agents.
- the one or more therapeutic agents are selected from the group consisting of a peptide, a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, , a vector comprising one or more polynucleic acids of interest, an antibody, a chemotherapeutic agent or a radioactive moiety, or an immunomodulatory drug (IMiD).
- a peptide a cytokine, a checkpoint inhibitor, a mitogen, a growth factor, a small RNA, a dsRNA (double stranded RNA), siRNA, oligonucleotide, mononuclear blood cells, , a vector comprising one or more polynucleic acids of interest, an antibody, a chemotherapeutic agent or a radioactive moiety, or an immunomodulatory drug (IMiD).
- VHH binding domains were constructed with VHH binding domains on the extracellular side of the protein construct, singly or in multiples.
- the VHH antibody binding fragments were isolated through phage display of VHH libraries and selection on the soluble CD22 protein.
- VHH proteins were tested as VHH-IgGl Fc fusions for protein affinity and specific binding to CD22+ cells.
- Epitope mapping was done by binding competition and using CD22 protein variants with particular domains deleted from the full-length protein.
- Two clones demonstrated binding to the N-terminal domains, IgV and IgCl-2, of CD22 and another clone demonstrated binding to the C-terminal IgC domains 4-6.
- the clone binding to the C-terminal IgC domains was affinity matured by scanning mutagenesis of CDR3. This improved affinity from 30nM to 5nM.
- VHH fragments were cloned into lentiviral vectors in frame with a CAR consisting of a hinge domain (IgG4 Fc or CD8 hinge), a transmembrane domain (CD28tm), a co-stimulatory domain (41BB, CD28, DAP10) and a primary signaling domain from CD3z.
- a CAR consisting of a hinge domain (IgG4 Fc or CD8 hinge), a transmembrane domain (CD28tm), a co-stimulatory domain (41BB, CD28, DAP10) and a primary signaling domain from CD3z.
- VHH-Fc fusion proteins were assessed for affinity against monomeric CD22 (Aero Biosystems) using the ForteBio Octet Red BLI instrument. VHH-Fc proteins were captured onto an anti-human IgG Fc sensor at 50nM. Sensor tips were quenched with human IgG Fc protein at lOOnM, then CD22 antigen was added at 250nM to assess binding kinetics. Association was examined for 600 seconds and dissociation was examined for 600 seconds, allowing for calculation of Kon, Kdis and KD.
- the A01 clone (PROT739) has an affinity of 96nM
- the E04 (PROT740) clone has an affinity of 23nM
- the D04 clone (PROT265) has an affinity of 32nM (Table 4).
- VHH-Fc proteins were tested for binding to CD22 expressed on the cell surface.
- VHH-Fc proteins were serially diluted and added to Raji cells and incubated at 4C for 30 minutes.
- Cells were washed once in BD staining buffer, BSA (BD Pharmingen), then PE-labeled anti-human IgG Fc (Jackson Immnoresearch) was added to detect VHH-Fc cell binding and incubated at 4C for 30 minutes.
- Cells were washed once, then resuspended in staining buffer with 0.1% pluronic acid and run through a flow cytometer to detect the fluorescent labeling of the VHH-Fc cells. Binding curves are displayed in Figure 1, showing that the three clones all bind to CD22 positive Raji cells.
- VHH-Fc protein binding to the full length CD22 was compared to binding to these variants using the ForteBio Octet.
- VHH-Fc proteins were captured in kinetics buffer (ForteBio) on antihuman IgG Fc biosensor tips. Tips were quenched with human IgG Fc fragment (Jackson Immunoresearch), then CD22 protein was allowed to associate with the VHH- Fc for 10 minutes.
- PROT265 (D04) bound to all proteins tested, suggesting that it binds to the IgC domains 4-6.
- PROT739 (A01) bound to the full length CD22 and had weak binding to the CD22A2-3 protein with no binding to the CD22AV-1 protein, suggesting that it binds to the IgCl-2 domains.
- the D04 clone was affinity matured by scanning mutagenesis of the CDRs and phage display selections for higher affinity clones. Variants were isolated and expressed as VHH-Fc fusions for affinity assessment. Several clones showed improvement, with the best clone, D04-AM-D11 (PROT810), showing 5-fold improvement to 7nM (Table 4). This clone also showed improved binding to CD22+ Raji cells ( Figure IB)
- VHH sequences were cloned into lentiviral CAR constructs with the human IgG4 (CH3) hinge, CD28 transmembrane domain, 41BB co-stimulatory domain and CD3z signaling domain (Table 5). Lentivirus was produced for the various constructs and transduced into Jurkat cells to examine antigen-dependent activation of this T-cell line. VHH-CAR transduced cells were cultured for one week, then co-cultured with other tumor cell lines with or without CD22 surface expression. Jurkat cells were then stained for expression of activation marker CD69 and examined by flow cytometry. Activated CAR-Jurkat cells were compared to untransduced control (UTD) cells, lacking a CAR.
- UTD untransduced control
- Figure 3a shows activation of cells with the A01 (P952) and E04 (P953) VHH-CARs when exposed to CD22+ cells, Daudi and Raji, but no when exposed to Raji CD22 knock-out or K-562 cells.
- the D04 VHH-CAR (D04.P262) was tested in a separate experiment ( Figure 3b) and also showed activation with exposure to Daudi and Raji cells. Table 5.
- VHH-CARs were tested in primary T-cells for killing CD22+ tumor target cells.
- Lentivirus for each of the CARs described was transduced into primary donor T-cells and grown for 14 days. Expression of the CARs was assessed by flow cytometry.
- CD22+ Raji cells were labeled with CellTrace Violet (ThermoFisher) and co-cultured with the CAR-T cells at various E:T ratios for 48 hours. Raji cell viability was then assessed by flow cytometry (Figure 4).
- the P403 construct CD22 D04
- UTD modest Raji cell killing over background
- the affinity improved variant Pl 278 (CD22_DO4_AM_D11) had significantly better cytotoxicity, up to 80% at the 5: 1 E:T ratio.
- the P952 (CD22 CNTY VHH1 A01) and P953 (CD22 CNTY VHH1 E04) constructs showed modest cytotoxicity above background.
- VHHs were assembled in tandem on the CAR protein. As the A01 and E04 clones bound to N-terminal epitopes and the D04 clone bound to a C-terminal epitope, combinations of these VHHs were made such that the VHH-CAR could bind the two different epitopes.
- VHHs were assembled in tandem, separated by a linker having the sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 3). and paired with different CAR domains: 1) CD8 hinge/CD28 transmembrane/41BB/CD3z and 2) CD8 hinge/transmembrane/DAP10/CD3z (Table 3).
- Lentivirus was prepared from these constructs and transduced into primary T-cells. Cytotoxicity was assessed as described. Results show improved cell killing of Raji cells with tandem biparatopic VHH-CARs with the “CD22 D04 AM D11-linker- CD22_A01” format having the most robust cell killing (Figure 5).
- Bispecific CAR ectodomains were engineered with select CD22 binders in combination with FMC63 ( Figure 6).
- Selected CARs e.g., identified by P####
- P#### Selected CARs
- the selected bispecific CARs were tested in primary T-cells for killing CD19+, CD22+ or CD19+/CD22+ tumor target cells (Table 6). Table 6. Tumor target cells
- Lentivirus for each of the CARs described was transduced into primary donor T- cells and grown for 14 days. Expression of the CARs was assessed by flow cytometry. The target expressing cells were co-cultured with the CAR-T cells at various E:T ratios for 48 hours. Cell viability was assessed by flow cytometry ( Figures 9 & 10B). CD19-, CD22-, and CD19/CD22-dependent cytotoxicity was assessed at a 1.25:1 E:T ratio ( Figures 7 and 8). The data represent the cumulative cytotoxicity (e.g., percent target killing) for the cell lines tested. All of the bispecific CAR-T cells tested exhibited CD 19- targeted cytotoxicity activity equivalent to the FMC63 CAR Pl 209 ( Figure 7A).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Epidemiology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3243966A CA3243966A1 (en) | 2021-12-29 | 2022-12-27 | Genetically modified cells with anti-CD19/anti-CD22 chimeric antigenic receptors, and their uses |
| US18/722,839 US20250064934A1 (en) | 2021-12-29 | 2022-12-27 | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
| EP22856960.4A EP4456912A1 (en) | 2021-12-29 | 2022-12-27 | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
| AU2022423987A AU2022423987A1 (en) | 2021-12-29 | 2022-12-27 | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
| CN202280092476.5A CN118742319A (zh) | 2021-12-29 | 2022-12-27 | 具有抗cd19/抗cd22嵌合抗原受体的基因工程化细胞及其用途 |
| JP2024539426A JP2025501214A (ja) | 2021-12-29 | 2022-12-27 | 抗cd19/抗cd22キメラ抗原受容体を有する遺伝子操作細胞、およびその使用 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163294618P | 2021-12-29 | 2021-12-29 | |
| US63/294,618 | 2021-12-29 | ||
| US202263350156P | 2022-06-08 | 2022-06-08 | |
| US63/350,156 | 2022-06-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023129937A1 true WO2023129937A1 (en) | 2023-07-06 |
Family
ID=85222536
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/082441 Ceased WO2023129937A1 (en) | 2021-12-29 | 2022-12-27 | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20250064934A1 (https=) |
| EP (1) | EP4456912A1 (https=) |
| JP (1) | JP2025501214A (https=) |
| AU (1) | AU2022423987A1 (https=) |
| CA (1) | CA3243966A1 (https=) |
| TW (1) | TW202342734A (https=) |
| WO (1) | WO2023129937A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023240212A3 (en) * | 2022-06-08 | 2024-01-18 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd133 / anti-egfr chimeric antigen receptors, and uses thereof |
| WO2024103017A3 (en) * | 2022-11-10 | 2024-06-20 | Century Therapeutics, Inc. | Genetically engineered cells having anti-nectin4 chimeric antigen receptors, and uses thereof |
| WO2025207795A1 (en) * | 2024-03-26 | 2025-10-02 | Juno Therapeutics, Inc. | Genetically engineered cells having anti-cd33 / anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025207798A1 (en) * | 2024-03-26 | 2025-10-02 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025214438A1 (zh) * | 2024-04-10 | 2025-10-16 | 浙江纳米抗体技术中心有限公司 | 结合cd19和/或cd22的抗原结合分子及其用途 |
| CN121537531A (zh) * | 2026-01-16 | 2026-02-17 | 北京肿瘤医院(北京大学肿瘤医院) | 一种表达cd47-cd28共刺激转换受体的嵌合抗原受体及其应用 |
Citations (33)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998053058A1 (en) | 1997-05-23 | 1998-11-26 | Gendaq Limited | Nucleic acid binding proteins |
| WO1998053059A1 (en) | 1997-05-23 | 1998-11-26 | Medical Research Council | Nucleic acid binding proteins |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| WO2002016536A1 (fr) | 2000-08-23 | 2002-02-28 | Kao Corporation | Detergent bactericide antisalissures, destine aux surfaces dures |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| WO2003016496A2 (en) | 2001-08-20 | 2003-02-27 | The Scripps Research Institute | Zinc finger binding domains for cnn |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| WO2010099539A1 (en) | 2009-02-27 | 2010-09-02 | Cellular Dynamics International, Inc. | Differentiation of pluripotent cells |
| US7888121B2 (en) | 2003-08-08 | 2011-02-15 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US20110145940A1 (en) | 2009-12-10 | 2011-06-16 | Voytas Daniel F | Tal effector-mediated dna modification |
| US7972854B2 (en) | 2004-02-05 | 2011-07-05 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| WO2012109208A2 (en) | 2011-02-08 | 2012-08-16 | Cellular Dynamics International, Inc. | Hematopoietic precursor cell production by programming |
| US8318491B2 (en) | 2007-08-02 | 2012-11-27 | Korea Research Institute Of Bioscience And Biotechnology | Method of differentiating hematopoietic stem cells into natural killer cells using YC-1 or IL-21 |
| US8546140B2 (en) | 2008-06-04 | 2013-10-01 | Cellular Dynamics International, Inc. | Methods for the production of iPS cells using non-viral approach |
| US8765470B2 (en) | 2010-08-04 | 2014-07-01 | Cellular Dynamics International, Inc. | Reprogramming immortalized B-cells to induced pluripotent stem cells |
| US8846395B2 (en) | 2005-06-01 | 2014-09-30 | Wisconsin Alumni Research Foundation | Generation of mature myelomonocytic cells through expansion and differentiation of pluripotent stem cell-derived lin-CD34+CD43+CD45+progenitors |
| US8945922B2 (en) | 2008-09-08 | 2015-02-03 | Riken | Generating a mature NKT cell from a reprogrammed somatic cell with a T-cell antigen receptor α-chain region rearranged to uniform Va-Ja in a NKT-cell specific way |
| WO2016010148A1 (ja) | 2014-07-18 | 2016-01-21 | 国立大学法人京都大学 | 多能性幹細胞から免疫細胞療法用t細胞を誘導する方法 |
| WO2017070333A1 (en) | 2015-10-20 | 2017-04-27 | Cellular Dynamics International, Inc. | Multi-lineage hematopoietic precursor cell production by genetic programming |
| WO2017179720A1 (ja) | 2016-04-15 | 2017-10-19 | 国立大学法人京都大学 | Cd8陽性t細胞を誘導する方法 |
| WO2018048828A1 (en) | 2016-09-06 | 2018-03-15 | The Children's Medical Center Corporation | Immune cells derived from induced pluripotent stem cell |
| WO2018058002A1 (en) | 2016-09-23 | 2018-03-29 | Fred Hutchinson Cancer Research Center | Tcrs specific for minor histocompatibility (h) antigen ha-1 and uses thereof |
| WO2019023396A1 (en) | 2017-07-25 | 2019-01-31 | Board Of Regents, The University Of Texas System | ENHANCED CHIMERIC ANTIGENIC RECEPTORS AND USES THEREOF |
| WO2019060695A1 (en) | 2017-09-22 | 2019-03-28 | Kite Pharma, Inc. | CHIMERIC POLYPEPTIDES AND USES THEREOF |
| WO2019070856A1 (en) | 2017-10-03 | 2019-04-11 | Precision Biosciences, Inc. | MODIFIED EPIDERMAL GROWTH FACTOR RECEPTOR PEPTIDES FOR USE IN GENETICALLY MODIFIED CELLS |
| WO2019157597A1 (en) | 2018-02-14 | 2019-08-22 | Sunnybrook Research Institute | Method for generating cells of the t cell lineage |
| WO2020069184A2 (en) * | 2018-09-26 | 2020-04-02 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-cd19/cd22 immunotherapy |
| WO2021071962A1 (en) * | 2019-10-07 | 2021-04-15 | Fate Therapeutics, Inc. | Enhanced chimeric antigen receptor for immune effector cell engineering and use thereof |
| WO2021092252A1 (en) * | 2019-11-05 | 2021-05-14 | Forman Stephen J | Generation of chimeric antigen receptor modified t cells from stem cells and therapeutic uses thereof |
| WO2021108613A1 (en) * | 2019-11-26 | 2021-06-03 | Novartis Ag | Cd19 and cd22 chimeric antigen receptors and uses thereof |
| WO2021188599A1 (en) * | 2020-03-16 | 2021-09-23 | University Of Southern California | Novel antigen binding domains and synthetic antigen receptors incorporating the same |
| WO2021258016A1 (en) * | 2020-06-19 | 2021-12-23 | Fate Therapeutics, Inc. | Combining ipsc-derived effector cell types for immunotherapy use |
| WO2022133169A1 (en) * | 2020-12-18 | 2022-06-23 | Century Therapeutics, Inc. | Chimeric antigen receptor systems with adaptable receptor specificity |
-
2022
- 2022-12-27 AU AU2022423987A patent/AU2022423987A1/en active Pending
- 2022-12-27 WO PCT/US2022/082441 patent/WO2023129937A1/en not_active Ceased
- 2022-12-27 CA CA3243966A patent/CA3243966A1/en active Pending
- 2022-12-27 US US18/722,839 patent/US20250064934A1/en active Pending
- 2022-12-27 JP JP2024539426A patent/JP2025501214A/ja active Pending
- 2022-12-27 EP EP22856960.4A patent/EP4456912A1/en active Pending
- 2022-12-29 TW TW111150534A patent/TW202342734A/zh unknown
Patent Citations (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998053059A1 (en) | 1997-05-23 | 1998-11-26 | Medical Research Council | Nucleic acid binding proteins |
| WO1998053060A1 (en) | 1997-05-23 | 1998-11-26 | Gendaq Limited | Nucleic acid binding proteins |
| WO1998053058A1 (en) | 1997-05-23 | 1998-11-26 | Gendaq Limited | Nucleic acid binding proteins |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| WO2002016536A1 (fr) | 2000-08-23 | 2002-02-28 | Kao Corporation | Detergent bactericide antisalissures, destine aux surfaces dures |
| WO2003016496A2 (en) | 2001-08-20 | 2003-02-27 | The Scripps Research Institute | Zinc finger binding domains for cnn |
| US7888121B2 (en) | 2003-08-08 | 2011-02-15 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US7972854B2 (en) | 2004-02-05 | 2011-07-05 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US8846395B2 (en) | 2005-06-01 | 2014-09-30 | Wisconsin Alumni Research Foundation | Generation of mature myelomonocytic cells through expansion and differentiation of pluripotent stem cell-derived lin-CD34+CD43+CD45+progenitors |
| US8318491B2 (en) | 2007-08-02 | 2012-11-27 | Korea Research Institute Of Bioscience And Biotechnology | Method of differentiating hematopoietic stem cells into natural killer cells using YC-1 or IL-21 |
| US9328332B2 (en) | 2008-06-04 | 2016-05-03 | Cellular Dynamics International, Inc. | Methods for the production of IPS cells using non-viral approach |
| US8546140B2 (en) | 2008-06-04 | 2013-10-01 | Cellular Dynamics International, Inc. | Methods for the production of iPS cells using non-viral approach |
| US9644184B2 (en) | 2008-06-04 | 2017-05-09 | Cellular Dynamics International, Inc. | Methods for the production of IPS cells using Epstein-Barr (EBV)-based reprogramming vectors |
| US8945922B2 (en) | 2008-09-08 | 2015-02-03 | Riken | Generating a mature NKT cell from a reprogrammed somatic cell with a T-cell antigen receptor α-chain region rearranged to uniform Va-Ja in a NKT-cell specific way |
| WO2010099539A1 (en) | 2009-02-27 | 2010-09-02 | Cellular Dynamics International, Inc. | Differentiation of pluripotent cells |
| US20110145940A1 (en) | 2009-12-10 | 2011-06-16 | Voytas Daniel F | Tal effector-mediated dna modification |
| US8765470B2 (en) | 2010-08-04 | 2014-07-01 | Cellular Dynamics International, Inc. | Reprogramming immortalized B-cells to induced pluripotent stem cells |
| WO2012109208A2 (en) | 2011-02-08 | 2012-08-16 | Cellular Dynamics International, Inc. | Hematopoietic precursor cell production by programming |
| WO2016010148A1 (ja) | 2014-07-18 | 2016-01-21 | 国立大学法人京都大学 | 多能性幹細胞から免疫細胞療法用t細胞を誘導する方法 |
| WO2017070333A1 (en) | 2015-10-20 | 2017-04-27 | Cellular Dynamics International, Inc. | Multi-lineage hematopoietic precursor cell production by genetic programming |
| WO2017179720A1 (ja) | 2016-04-15 | 2017-10-19 | 国立大学法人京都大学 | Cd8陽性t細胞を誘導する方法 |
| WO2018048828A1 (en) | 2016-09-06 | 2018-03-15 | The Children's Medical Center Corporation | Immune cells derived from induced pluripotent stem cell |
| WO2018058002A1 (en) | 2016-09-23 | 2018-03-29 | Fred Hutchinson Cancer Research Center | Tcrs specific for minor histocompatibility (h) antigen ha-1 and uses thereof |
| WO2019023396A1 (en) | 2017-07-25 | 2019-01-31 | Board Of Regents, The University Of Texas System | ENHANCED CHIMERIC ANTIGENIC RECEPTORS AND USES THEREOF |
| WO2019060695A1 (en) | 2017-09-22 | 2019-03-28 | Kite Pharma, Inc. | CHIMERIC POLYPEPTIDES AND USES THEREOF |
| WO2019070856A1 (en) | 2017-10-03 | 2019-04-11 | Precision Biosciences, Inc. | MODIFIED EPIDERMAL GROWTH FACTOR RECEPTOR PEPTIDES FOR USE IN GENETICALLY MODIFIED CELLS |
| WO2019157597A1 (en) | 2018-02-14 | 2019-08-22 | Sunnybrook Research Institute | Method for generating cells of the t cell lineage |
| WO2020069184A2 (en) * | 2018-09-26 | 2020-04-02 | Lentigen Technology, Inc. | Compositions and methods for treating cancer with anti-cd19/cd22 immunotherapy |
| WO2021071962A1 (en) * | 2019-10-07 | 2021-04-15 | Fate Therapeutics, Inc. | Enhanced chimeric antigen receptor for immune effector cell engineering and use thereof |
| WO2021092252A1 (en) * | 2019-11-05 | 2021-05-14 | Forman Stephen J | Generation of chimeric antigen receptor modified t cells from stem cells and therapeutic uses thereof |
| WO2021108613A1 (en) * | 2019-11-26 | 2021-06-03 | Novartis Ag | Cd19 and cd22 chimeric antigen receptors and uses thereof |
| WO2021188599A1 (en) * | 2020-03-16 | 2021-09-23 | University Of Southern California | Novel antigen binding domains and synthetic antigen receptors incorporating the same |
| WO2021258016A1 (en) * | 2020-06-19 | 2021-12-23 | Fate Therapeutics, Inc. | Combining ipsc-derived effector cell types for immunotherapy use |
| WO2022133169A1 (en) * | 2020-12-18 | 2022-06-23 | Century Therapeutics, Inc. | Chimeric antigen receptor systems with adaptable receptor specificity |
Non-Patent Citations (34)
| Title |
|---|
| "Current Protocols", 1995, GREENE PUBLISHING ASSOCIATES, INC, article "Current Protocols in Molecular Biology," |
| ALFALEH MOHAMED A. ET AL: "Phage Display Derived Monoclonal Antibodies: From Bench to Bedside", FRONTIERS IN IMMUNOLOGY, vol. 11, 28 August 2020 (2020-08-28), Lausanne, CH, XP093048416, ISSN: 1664-3224, DOI: 10.3389/fimmu.2020.01986 * |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| ANONYMOUS: "Tungsten VHH Library for Nanobody Discovery", 27 October 2021 (2021-10-27), XP093048764, Retrieved from the Internet <URL:https://web.archive.org/web/20211027095652/https://www.criver.com/products-services/discovery-services/biologics-discovery-and-protein-engineering/antibody-discovery/tungsten-vhh-library-nanobody-discovery?region=3601> [retrieved on 20230523] * |
| BAO CHAOLEMENG ET AL: "The Application of Nanobody in CAR-T Therapy", BIOMOLECULES, vol. 11, no. 2, 1 February 2021 (2021-02-01), CH, pages 1 - 18, XP055880691, ISSN: 2218-273X, DOI: 10.3390/biom11020238 * |
| BINZ H ET AL., NAT BIOLECHNOL, vol. 23, 2005, pages 1257 - 68 |
| BYLA P ET AL., J BIOL CHEM, vol. 285, 2010, pages 12096 |
| BYRNE JANE: "Charles River Understanding and mitigating underlying mechanisms behind unwanted toxicities in CAR T cell therapies", 11 May 2021 (2021-05-11), XP093048726, Retrieved from the Internet <URL:https://www.biopharma-reporter.com/Article/2021/05/11/Charles-River-Understanding-and-mitigating-underlying-mechanisms-behind-unwanted-toxicities-in-CAR-T-cell-therapies> [retrieved on 20230523] * |
| DI STASI, A ET AL., N. ENGL. J. MED., vol. 365, 2011, pages 1673 - 1683 |
| GILL DDAMLE N, CURR OPIN BIOTECH, vol. 17, 2006, pages 653 - 8 |
| GORNALUSSE ET AL., NAT BIOTECHNOL., vol. 35, no. 8, August 2017 (2017-08-01), pages 765 - 772 |
| HARRISON'S ET AL.: "Principles of Internal Medicine", 2001, MCGRAW-HILL |
| HENIKOFFHENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HEY T ET AL., TRENDS BIOTECHNOL, vol. 23, 2005, pages 514 - 522 |
| HOLLIGER PHUDSON P, NAT BIOTECHNOL, vol. 23, 2005, pages 1126 - 36 |
| KARLINALTSCHUL, PROC. NAT'I. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
| KOIDE AKOIDE S, METHODS MOL BIOL, vol. 352, 2007, pages 95 - 109 |
| LULIUCCI, J. D. ET AL., J. CLIN. PHARMACOL., vol. 41, 2001, pages 870 - 879 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| PEARSONLIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| REMINGTON, THE SCIENCE AND PRACTICE OF PHARMACY, 2005 |
| SADEQI NEZHAD MUHAMMAD ET AL: "Induced Pluripotent Stem Cells (iPSCs) Provide a Potentially Unlimited T Cell Source for CAR-T Cell Development and Off-the-Shelf Products", ENVIRONMENTAL SCIENCE AND POLLUTION RESEARCH, SPRINGER BERLIN HEIDELBERG, BERLIN/HEIDELBERG, vol. 38, no. 6, 1 June 2021 (2021-06-01), pages 931 - 945, XP037486859, ISSN: 0724-8741, [retrieved on 20210610], DOI: 10.1007/S11095-021-03067-Z * |
| SKERRA, CURRENT OPIN. IN BIOTECH., vol. 18, 2007, pages 295 - 304 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| STRAATHOF ET AL., BLOOD, vol. 105, 2005, pages 4247 - 4254 |
| VOUSDEN KHOLT S ET AL: "Abstract 922: End-to-end discovery to support the development of safe and efficacious engineered cell therapies", CANCER RESEARCH; AACR ANNUAL MEETING 2021; 20210517 TO 20210521; PHILADELPHIA, PA, USA, AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 81, no. 13 SUPPL, 1 July 2021 (2021-07-01), pages 922, XP009544562, ISSN: 1538-7445, DOI: 10.1158/1538-7445.AM2021-922 * |
| WIKMAN M ET AL., PROTEIN ENG DES SEL, vol. 17, 2004, pages 455 - 62 |
| WORN APLUCKTHUN A, J MOL BIOL, vol. 305, 2001, pages 989 - 1010 |
| WYPYCH ET AL., JBC, vol. 283, no. 23, 2008, pages 16194 - 16205 |
| XU LET, BIOL, vol. 9, 2002, pages 933 - 42 |
| YASAMAN ASAADI ET AL: "A comprehensive comparison between camelid nanobodies and single chain variable fragments", BIOMARKER RESEARCH, BIOMED CENTRAL LTD, LONDON, UK, vol. 9, no. 1, 4 December 2021 (2021-12-04), pages 1 - 20, XP021299775, DOI: 10.1186/S40364-021-00332-6 * |
| ZHOU Z J ET AL: "Tri-Specific CD19xCD20xCD22 VHH CAR-T Cells (LCAR-AIO) Eradicate Antigen-Heterogeneous B Cell Tumors, Enhance Expansion, and Prolong Persistence in Preclinical In Vivo Models", BLOOD; 63RD ASH ANNUAL MEETING; 20211211 TO 20211214; ATLANTA GA, USA, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 138, no. Supplement 1, 23 November 2021 (2021-11-23), pages 1700, XP009544563, ISSN: 0006-4971, DOI: 10.1182/BLOOD-2021-150650 * |
| ZOLLER F ET AL., MOLECULES, vol. 16, 2011, pages 2467 - 85 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023240212A3 (en) * | 2022-06-08 | 2024-01-18 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd133 / anti-egfr chimeric antigen receptors, and uses thereof |
| WO2024103017A3 (en) * | 2022-11-10 | 2024-06-20 | Century Therapeutics, Inc. | Genetically engineered cells having anti-nectin4 chimeric antigen receptors, and uses thereof |
| WO2025207795A1 (en) * | 2024-03-26 | 2025-10-02 | Juno Therapeutics, Inc. | Genetically engineered cells having anti-cd33 / anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025207798A1 (en) * | 2024-03-26 | 2025-10-02 | Century Therapeutics, Inc. | Genetically engineered cells having anti-cd123 chimeric antigen receptors, and uses thereof |
| WO2025214438A1 (zh) * | 2024-04-10 | 2025-10-16 | 浙江纳米抗体技术中心有限公司 | 结合cd19和/或cd22的抗原结合分子及其用途 |
| CN121537531A (zh) * | 2026-01-16 | 2026-02-17 | 北京肿瘤医院(北京大学肿瘤医院) | 一种表达cd47-cd28共刺激转换受体的嵌合抗原受体及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2025501214A (ja) | 2025-01-17 |
| TW202342734A (zh) | 2023-11-01 |
| EP4456912A1 (en) | 2024-11-06 |
| CA3243966A1 (en) | 2023-07-06 |
| US20250064934A1 (en) | 2025-02-27 |
| AU2022423987A1 (en) | 2024-07-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12269888B2 (en) | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof | |
| US20250064934A1 (en) | Genetically engineered cells having anti-cd19 / anti-cd22 chimeric antigen receptors, and uses thereof | |
| CA3214473A1 (en) | Compositions and methods for generating alpha-beta t cells from induced pluripotent stem cells | |
| US20220184123A1 (en) | Genetically Engineered Cells and Uses Thereof | |
| WO2025106626A1 (en) | Genetically engineered cells expressing c-x-c chemokine receptor type 4, and uses thereof | |
| US20220195396A1 (en) | Genetically Engineered Cells and Uses Thereof | |
| US20250360210A1 (en) | Immunoeffector cells derived from induced pluripotent stem cells genetically engineered with membrane bound il12 and uses thereof | |
| US20250090582A1 (en) | Genetically engineered cells having anti-cd133 / anti-egfr chimeric antigen receptors, and uses thereof | |
| US20250345425A1 (en) | Cells engineered with an hla-e and hla-g transgene | |
| US20220331361A1 (en) | Gene transfer vectors and methods of engineering cells | |
| US20230381317A1 (en) | Methods for controlled activation and/or expansion of genetically engineered cells using polyethylene glycol (peg) receptors | |
| US11661459B2 (en) | Artificial cell death polypeptide for chimeric antigen receptor and uses thereof | |
| WO2025207798A1 (en) | Genetically engineered cells having anti-cd123 chimeric antigen receptors, and uses thereof | |
| WO2025207795A1 (en) | Genetically engineered cells having anti-cd33 / anti-cd123 chimeric antigen receptors, and uses thereof | |
| CN118742319A (zh) | 具有抗cd19/抗cd22嵌合抗原受体的基因工程化细胞及其用途 | |
| AU2023375625A1 (en) | Genetically engineered cells having anti-nectin4 chimeric antigen receptors, and uses thereof | |
| HK40117036A (zh) | 具有抗cd19/抗cd22嵌合抗原受体的基因工程化细胞及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22856960 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022423987 Country of ref document: AU Ref document number: AU2022423987 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024539426 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022856960 Country of ref document: EP Effective date: 20240729 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280092476.5 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 18722839 Country of ref document: US |