WO2023108103A1 - Raf kinase inhibitors and methods of use thereof - Google Patents
Raf kinase inhibitors and methods of use thereof Download PDFInfo
- Publication number
- WO2023108103A1 WO2023108103A1 PCT/US2022/081236 US2022081236W WO2023108103A1 WO 2023108103 A1 WO2023108103 A1 WO 2023108103A1 US 2022081236 W US2022081236 W US 2022081236W WO 2023108103 A1 WO2023108103 A1 WO 2023108103A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- optionally substituted
- group
- alkyl
- occurrence
- cyano
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/72—Nitrogen atoms
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/72—Nitrogen atoms
- C07D213/73—Unsubstituted amino or imino radicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/78—Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals
- C07D213/81—Amides; Imides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/04—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
- C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
- C07D403/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D405/00—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom
- C07D405/02—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings
- C07D405/04—Heterocyclic compounds containing both one or more hetero rings having oxygen atoms as the only ring hetero atoms, and one or more rings having nitrogen as the only ring hetero atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
- C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
- C07D471/04—Ortho-condensed systems
Definitions
- BRAF V600E signals as a monomer and is constitutively active independent of upstream control by RAS.
- the marketed BRAF V600E inhibitors include vemurafenib, dabrafenib, and encorafenib.
- BRAF-BRAF dimer homodimers
- heterodimers e.g., BRAF-CRAF dimer
- Such dimers are formed in cancers driven by BRAF fusions, atypical BRAF mutations, or RAS mutant cancers.
- Oncogenic BRAF fusions originate from genomic rearrangements placing the 3-prime portion of the BRAF gene encoding the kinase domain behind another gene at the 5- prime position. The rearrangements result in the expression of oncoproteins that express constitutive kinase activity due to loss of the N-terminal auto-inhibitory domain of BRAF resulting from the genomic rearrangements. These BRAF fusions exhibit constitutive kinase activity due to spontaneous dimerization and as such are capable of aberrant signaling in cancer cells independent of upstream effectors or regulatory mechanisms.
- some 5-prime translocated rearrangement genes contribute the N-terminal domains to be capable of further inducing dimerization, thereby enhancing activating dimerization of the BRAF fusion protein kinase domain. Since the expression of these genomic rearrangements are controlled by the promoter of the 5-prime partner, often there is overexpression of the BRAF fusion transcript due to efficient or excessive promoter activity. BRAF fusions are among the most common kinase translocations in solid tumors. Since their first description in 2005 as oncogenes in papillary thyroid carcinoma, hundreds of tumors in which the BRAF kinase domain is fused to one of more than 110 different 5-prime partner genes have been identified across at least 15 different tumor types.
- BRAF fusions are found in papillary thyroid carcinoma, astrocytomas, melanomas, and have also been identified in drug resistant EGFR mutant lung cancers.
- BRAF fusion proteins signal by dimerization in a RAS-independent manner and are resistant to many BRAF inhibitors such as vemurafenib and dabrafenib, that are not capable of inhibiting both protomers of the signaling homodimer BRAF fusions.
- Rare CRAF fusion proteins have also been demonstrated to be tumor drivers.
- Such CRAF fusion proteins signal as CRAF-CRAF homodimers.
- Other so-called atypical BRAF mutations also lead to spontaneous dimerization and signaling independent of RAS control.
- RAS mutant cancers comprise approximately 26-30% of all human cancers.
- RAS mutant cancers signal through the RAS ⁇ RAF ⁇ MEK ⁇ ERK signaling pathway.
- kinase-inactive RAF monomers comprising ARAF, BRAF, and CRAF isoforms
- a predominant RAF heterodimer that is recruited to mutant RAS is the BRAF/CRAF heterodimer.
- a combinatorial siRNA screening approach identified RAF as a dominant node in RAS mutant cancers, and that codepletion of both BRAF and CRAF, together with depletion of the autophagy gene ATG7, gave the best synthetic lethal inhibition of RAS mutant signaling, and additionally afforded the best therapeutic window for inhibiting signaling in RAS mutant cells versus normal, RAS wildtype cells. Additionally, it has been reported that inhibition of the RAF ⁇ MEK ⁇ ERK pathway in combination with autophagy-inhibiting agents effectively blocked RAS mutant cancer growth in vitro and in vivo.
- RAF inhibitors that can inhibit multiple RAF isoforms, and in particular to inhibit both BRAF and CRAF isoforms, and especially to inhibit both RAF protomers present in signaling BRAF/BRAF homodimers and BRAF/CRAF heterodimers.
- pan RAF inhibitors find utility in the treatment of BRAF V600X driven cancers, atypical BRAF mutated cancers, BRAF fusion cancers, CRAF fusion cancers, and RAS mutant cancers.
- RAF inhibitors e.g., BRAF or CRAF inhibitors and methods of use thereof, such as the treatment of cancers driven by oncogenic forms of RAS or BRAF.
- the compounds of the disclosure inhibit both BRAF and CRAF isoforms.
- the compounds of the disclosure inhibit both RAF protomers present in signaling BRAF/BRAF homodimers and BRAF/CRAF heterodimers.
- described herein is a pharmaceutical composition
- a pharmaceutical composition comprising a compound described herein (e.g., a compound of the disclosure as described herein) and a pharmaceutically acceptable carrier or excipient.
- described herein is a method of treating a cancer in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound described herein (e.g., a compound of the disclosure as described herein).
- described herein is a method of treating a disorder selected from the group consisting of histiocytosis, melanoma, multiple myeloma, thyroid cancer, ovarian cancer, colorectal cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, blood-borne cancers, hairy cell leukemia, acute myelogenous leukemia (AML), and other cancers caused by activation of the RAS ERK signaling pathway in a patient in need thereof, comprising administering to the patient a therapeutically effective amount of a compound described herein (e.g., a compound of the disclosure as described herein).
- a compound described herein e.g., a compound of the disclosure as described herein.
- deuterated mean that at least one hydrogen atom is replaced by deuterium. In any sample of a deuterated compound, some discrete molecules of the compound will likely have hydrogen, rather than deuterium, at the specified position. However, the percent of molecules of the deuterated compound which have deuterium at the specified position will be much greater than would naturally occur. The deuterium at the deuterated position is enriched.
- substituent is itself substituted with more than one group, it is understood that these multiple groups may be on the same carbon or on different carbons, so long as a stable structure result.
- “optionally substituted” refers to the replacement of one to four hydrogen atoms in a given structure with the substituents mentioned above. More preferably, one to three hydrogen atoms are replaced by the substituents as mentioned above. It is understood that the substituent can be further substituted. [00026] As used herein, the term “substituted” refers to moieties having substituents replacing a hydrogen on one or more carbons of the backbone.
- substitution or “substituted with” includes the implicit proviso that such substitution is in accordance with permitted valence of the substituted atom and the substituent, and that the substitution results in a stable compound, e.g., which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, etc.
- substituted is contemplated to include all permissible substituents of organic compounds.
- the permissible substituents include acyclic and cyclic, branched, and unbranched, carbocyclic, and heterocyclic, aromatic, and non-aromatic substituents of organic compounds.
- the permissible substituents can be one or more and the same or different for appropriate organic compounds.
- the heteroatoms such as nitrogen may have hydrogen substituents and/or any permissible substituents of organic compounds described herein which satisfy the valences of the heteroatoms.
- Substituents can include any substituents described herein, for example, Such substituents, if not otherwise specified, can include, for example, a halogen, a hydroxyl, a carbonyl (such as a carboxyl, an alkoxycarbonyl, a formyl, or an acyl), a thiocarbonyl (such as a thioester, a thioacetate, or a thioformate), an alkoxyl, a phosphoryl, a phosphate, a phosphonate, a phosphinate, an amino, an amido, an amidine, an imine, a cyano, a nitro, an azido, a sulfhydryl, an alkylthio, a sulfate, a sulfonate, a sulfamoyl, a sulfonamido, a sulfonyl, a hetero
- substituents can themselves be substituted, if appropriate.
- the substituents of a substituted alkyl may include substituted and unsubstituted forms of amino, azido, imino, amido, phosphoryl (including phosphonate and phosphinate), sulfonyl (including sulfate, sulfonamido, sulfamoyl and sulfonate), and silyl groups, as well as ethers, alkylthios, carbonyls (including ketones, aldehydes, carboxylates, and esters), -CF3, -CN, and the like.
- alkyl refers to a straight chained or branched non- aromatic hydrocarbon which is completely saturated.
- a straight chained or branched alkyl group has from 1 to about 20 carbon atoms, preferably from 1 to about 10, e.g., may be C 1 -C 10 alkyl or e.g., C 1 -C 6 alkyl unless otherwise defined.
- straight chained and branched alkyl groups include, but are not limited to, methyl, ethyl, 1-propyl (n- propyl), 2-propyl, n-butyl, sec-butyl, tertbutyl, 1-pentyl, 2-pentyl, 3-pentyl, neo-pentyl, 1- hexyl, 2-hexyl, 3-hexyl, 1-heptyl, 2-heptyl, 3-heptyl, 4-heptyl, 1-octyl, 2-octyl, 3-octyl or 4- octyl and the like.
- alkyl used throughout the specification, examples, and claims is intended to include both “unsubstituted alkyls” and “substituted alkyls”, the latter of which refers to alkyl moieties having substituents replacing a hydrogen on one or more carbons of the hydrocarbon backbone.
- the "alkyl” group may be optionally substituted.
- C x -C y when used in conjunction with a chemical moiety, such as, acyl, acyloxy, alkyl, alkenyl, alkynyl, or alkoxy is meant to include groups that contain from x to y carbons in the chain.
- Cx-Cy refers to substituted or unsubstituted saturated hydrocarbon groups, including straight-chain alkyl and branched- chain alkyl groups that contain from x to y carbons in the chain, including haloalkyl groups such as trifluoromethyl and 2,2,2-trifluoroethyl, etc.
- C 0 alkyl indicates a hydrogen where the group is in a terminal position, a bond if internal.
- Hydrocarbyl groups include, but are not limited to aryl, heteroaryl, carbocycle, heterocyclyl, alkyl, alkenyl, alkynyl, and combinations thereof.
- the "hydrocarbyl” group may be optionally substituted.
- alkoxy refers to a straight or branched, saturated aliphatic (alkyl) hydrocarbon radical bonded to an oxygen atom that is attached to a core structure.
- alkoxy groups have one to six carbon atoms, i.e., may be C1-C6 alkoxy.
- alkoxy groups include but are not limited to methoxy, ethoxy, propoxy, isopropoxy, butoxy, isobutoxy, tert-butoxy, pentoxy, 3-methyl butoxy, and the like.
- the "alkoxy” group may be optionally substituted.
- alkoxyalkyl refers to an alkyl group (as defined above) substituted with an alkoxy group and may be represented by the general formula alkyl-O-alkyl.
- alkoxyalkyl groups include but are not limited to methyl-O- ethylene-, ethyl-O-ethylene-.
- the "alkoxyalkyl” group may be optionally substituted.
- haloalkyl refers to alkyl group (as defined above) is substituted with one or more halogens.
- a monohaloalkyl radical for example, may have a chlorine, bromine, iodine, or fluorine atom.
- Dihalo and polyhaloalkyl radicals may have two or more of the same or different halogen atoms.
- haloalkyl examples include, but are not limited to, chloromethyl, dichloromethyl, trichloromethyl, dichloroethyl, dichloropropyl, fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, heptafluoropropyl, difluorochloromethyl, dichlorofluoromethyl, difluoroethyl, difluoropropyl and the like.
- the "haloalkyl” group may be optionally substituted.
- haloalkoxy refers to radicals wherein one or more of the hydrogen atoms of the alkoxy group are substituted with one or more halogens.
- haloalkoxy groups include, but not limited to, difluoromethoxy (-OCHF 2 ), trifluoromethoxy (-OCF 3 ) or trifluoroethoxy (-OCH 2 CF 3 ).
- the "haloalkoxy” group may be optionally substituted.
- aryl includes substituted or unsubstituted single- ring aromatic groups in which each atom of the ring is carbon.
- the ring is a 5- to 7- membered ring, more preferably a 6-membered ring.
- aryl also includes polycyclic ring systems having two or more cyclic rings in which two or more carbons are common to two adjoining rings (fused rings) wherein at least one of the rings is aromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls.
- fused means that the second ring is attached or formed by having two adjacent atoms in common with the first ring.
- the term “fused” is equivalent to the term “condensed”.
- aryl groups include but are not limited to phenyl, naphthyl, phenanthryl, phenol, aniline, or indanyl and the like. Unless otherwise specified, all aryl groups described herein may be optionally substituted.
- polycyclyl refers to two or more rings (e.g., cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls) in which one or more atoms are common to two adjoining rings, e.g., the rings are "fused rings".
- each of the rings of the polycycle can be substituted or unsubstituted.
- each ring of the polycycle contains from 3 to 10 atoms in the ring, preferably from 5 to 7.
- each occurrence of the optionally substituted substituent is independently selected from the group consisting of H, OH, alkoxy, cyano, F, and amino.
- amine and “amino” refer to both unsubstituted and substituted amines and salts thereof, e.g., a moiety that can be represented by [00041] wherein R z independently represent a hydrogen or optionally substituted hydrocarbyl group, or R z groups are taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.
- amide and “amido” each refer to a group represented by wherein R x , R y , and R z each independently represents a hydrogen or optionally substituted hydrocarbyl group, or R y , and R z groups are taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.
- amidine refers to a group represented by wherein R x , R y , and R z each independently represents a hydrogen or optionally substituted hydrocarbyl group, or R y , and R z groups are taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.
- urea refers to a group represented by wherein R x , R y , and R z each independently represents a hydrogen or optionally substituted hydrocarbyl group, or R y and R z are taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.
- alkylamino and “alkylamine” refer to an amino group, as defined above, substituted with at least one alkyl group.
- aminoalkyl refers to an alkyl group substituted with an amino group.
- the term “amidoalkyl” refers to an alkyl group substituted with an amido group.
- cyanoalkyl refers to an alkyl group substituted with a cyano group.
- alkylthio refers to a thiol group substituted with an alkyl group and may be represented by the general formula alkyl-S-.
- thioalkyl refers to an alkyl group substituted with a thiol group.
- hydroxyalkyl refers to an alkyl group substituted with a hydroxy group.
- cycloalkyl alone or in combination with other term(s) refers to a cyclic hydrocarbon which is completely saturated.
- Cycloalkyl includes monocyclic, bicyclic, and tricyclic rings. Typically, a monocyclic cycloalkyl group has from 3 to about 10 carbon atoms, more typically 3 to 8 carbon atoms (e.g., C3-C10cycloalkyl or e.g., C3-C6cycloalkyl) unless otherwise defined.
- Examples of monocyclic cycloalkyls include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and the like.
- the second ring of a bicyclic cycloalkyl or, the second or third rings of a tricyclic cycloalkyl may be selected from saturated, unsaturated, and aromatic rings.
- Cycloalkyl includes bicyclic and tricyclic molecules in which one, two or three or more atoms are shared between the two rings.
- the term "fused cycloalkyl" refers to a bicyclic or tricyclic cycloalkyl in which each of the rings shares two adjacent atoms with the other ring.
- the second ring of a fused bicyclic cycloalkyl or, the second or third rings of a fused tricyclic cycloalkyl may be selected from saturated, unsaturated, and aromatic rings.
- a "cycloalkenyl” group is a cyclic hydrocarbon containing one or more double bonds. Cycloalkyls can be further substituted with alkyls, alkenyls, alkoxys, alkylthios, aminoalkyls, carbonyl-substituted alkyls, -CF3, -CN, and the like.
- a cycloalkyl may alternatively be polycyclic with more than two rings.
- polycyclic cycloalkyls include bridged, fused, and spirocyclic carbocyclyls.
- cycloalkylalkyl or “carbocyclylalkyl” refers to an alkyl group substituted with a cycloalkyl group. Carbocyclyl and/or alkyl of carbocyclylalkyls can be further substituted as defined above for cycloalkyl and alkyl, respectively.
- the terms “carbocycle,” or “carbocyclic” include bicyclic molecules in which one, two or three or more atoms are shared between the two rings.
- fused carbocycle refers to a bicyclic carbocycle in which each of the rings shares two adjacent atoms with the other ring.
- Each ring of a fused carbocycle may be selected from saturated, unsaturated, and aromatic rings.
- an aromatic ring e.g., phenyl
- a saturated or unsaturated ring e.g., cyclohexane, cyclopentane, or cyclohexene.
- Exemplary "carbocycles” include cyclopentane, cyclohexane, bicyclo[2.2.1]heptane, 1,5-cyclooctadiene, 1,2,3,4- tetrahydronaphthalene, bicyclo[4.2.0]oct-3-ene, naphthalene and adamantane.
- Exemplary fused carbocycles include decalin, 4,5- naphthalene, 1,2,3,4-tetrahydronaphthalene, bicyclo[4.2.0]octane, 4,5,6,7-tetrahydro-lH-indene and bicyclo[4.1.0]hept-3-ene.
- Carbocycles may be substituted at any one or more positions capable of bearing a hydrogen atom.
- cyano refers to -CN group.
- hydroxy or “hydroxyl” refers to -OH group.
- halo or “halogen” alone or in combination with other term(s) means chloro, fluoro, bromo, and iodo.
- heteroatom refers an atom of any element other than carbon or hydrogen. Exemplary heteroatoms are nitrogen (N), oxygen (O), sulfur (S), and silicon (Si).
- heterocyclyl refers to a non-aromatic, saturated or partially saturated, including monocyclic, polycyclic (e.g., bicyclic, tricyclic) bridged, or fused, ring system of 3 to 15 member having at least one heteroatom or heterogroup selected from O, N, S, S(O), S(O)2, NH, or C(O) with the remaining ring atoms being independently selected from the group consisting of carbon, oxygen, nitrogen, and sulfur.
- heterocyclyl examples include, but are not limited to azetidinyl, oxetanyl, imidazolidinyl, pyrrolidinyl, oxazolidinyl, thiazolidinyl, pyrazolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, tetrahydropyranyl, morpholinyl, thiomorpholinyl, 1,4-dioxanyl, dioxidothiomorpholinyl, oxapiperazinyl, oxapiperidinyl, tetrahydrofuryl, tetrahydropyranyl, tetrahydrothiophenyl, dihydropyranyl, indolinyl, indolinylmethyl, 2-azabicyclo[2.2.2]octanyl, azocinyl, chromanyl, xanthenyl and N-oxides thereof.
- heterocycloalkyl refers to 4- to 6-membered ring selected from the group consisting of, imidazolidinyl, pyrrolidinyl, oxazolidinyl, thiazolidinyl, pyrazolidinyl, tetrahydrofuranyl, piperidinyl, piperazinyl, tetrahydropyranyl, morpholinyl, thiomorpholinyl, 1,4-dioxanyl and N-oxides thereof.
- heterocycloalkyl includes azetidinyl, pyrrolidinyl, morpholinyl and piperidinyl. All heterocycloalkyl are optionally substituted by one or more aforesaid groups.
- heterocyclylalkyl refers to an alkyl group substituted with a heterocyclyl. If the heterocyclyl is a nitrogen-containing heterocyclyl, the heterocyclyl is optionally attached to the alkyl radical at the nitrogen atom. Heterocyclyl and/or alkyl of heterocyclylalkyls can be further substituted as defined above for heterocyclyl and alkyl, respectively.
- heteroaryl refers to substituted or unsubstituted aromatic single ring structures, preferably 5- to 7-membered rings, more preferably 5- to 6- membered rings, whose ring structures include at least one heteroatom, preferably one to four heteroatoms, more preferably one or two heteroatoms.
- heteroaryl also refers to substituted or unsubstituted aromatic or partly aromatic ring systems containing at least one heteroatom and having two or more cyclic rings (bicyclic, tricyclic, or polycyclic), containing 8 to 20 ring atoms, suitably 5 to 10 ring atoms, which may be linked covalently, or fused in which two or more atoms are common to two adjoining rings wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings can be cycloalkyls, cycloalkenyls, cycloalkynyls, aryls, heteroaryls, and/or heterocyclyls.
- the rings may contain an N or S atom, wherein the N or S atom is optionally oxidized, or the N atom is optionally quaternized. All heteroaryls are optionally substituted. Any suitable ring position of the heteroaryl moiety may be covalently linked to a defined chemical structure.
- heteroaryl examples include, but are not limited to: furanyl, thienyl, pyrrolyl, pyrazolyl, imidazolyl, oxazolyl, cinnolinyl, isoxazolyl, thiazolyl, isothiazolyl, 1H-tetrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, pyridyl, pyrimidinyl, pyrazinyl, pyridazinyl, benzoxazolyl, benzisoxazolyl, benzothiazolyl, benzofuranyl, benzothienyl, benzotriazinyl, phthalazinyl, thianthrene, dibenzofuranyl, dibenzothienyl, benzimidazolyl, indolyl, isoindolyl, indazolyl, quinolinyl, isoquinolinyl, quinazolin
- E 1 is not a ring selected from the group consisting of , wherein s1 is the site covalently linked to L 1 ; and s2 is the site covalently linked to H or the optionally substituted substituent.
- sulfonamide is represented by: wherein R x , R y and R z , at each occurrence, independently represents a hydrogen, optionally substituted hydrocarbyl group, or R z groups taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure which may be optionally substituted.
- sulfone refers to the group -S(O) 2 -R 6 wherein R 6 represents an optionally substituted hydrocarbyl.
- Z-H is an alcohol or amine wherein H is directly connected to an oxygen or nitrogen within the Z moiety.
- Z-B(OR)2 is a boronic acid or boronic ester wherein boronate is directly bonded to a carbon within the Z moiety.
- a “combination therapy” is a treatment that includes the administration of two or more therapeutic agents, e.g., a compound of the disclosure and a MAPK pathway inhibitor, to a patient in need thereof.
- “Disease,” “disorder,” and “condition” are used interchangeably herein.
- “Individual,” “patient,” or “subject” are used interchangeably and include any animal, including mammals, preferably mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep, horses, or primates, and most preferably humans.
- the compounds described herein can be administered to a mammal, such as a human, but can also be administered to other mammals such as an animal in need of veterinary treatment, e.g., domestic animals (e.g., dogs, cats, and the like), farm animals (e.g., cows, sheep, pigs, horses, and the like) and laboratory animals (e.g., rats, mice, guinea pigs, and the like).
- veterinary treatment e.g., domestic animals (e.g., dogs, cats, and the like), farm animals (e.g., cows, sheep, pigs, horses, and the like) and laboratory animals (e.g., rats, mice, guinea pigs, and the like).
- the MAPK pathway as used herein is the signal transduction pathway comprising RAS ⁇ RAF ⁇ MEK ⁇ ERK.
- a “MAPK pathway inhibitor” is an inhibitor of the MAP kinase signaling pathway.
- Inhibitors of this pathway include RAS inhibitors (e.g., AMG-510, MRTX 849), RAF inhibitors (e.g., dabrafenib, vemurafenib, LY3009120, encorafenib), MEK inhibitors (e.g., trametinib, binimetinib, selumetinib, cobimetinib), and ERK inhibitors (e.g., ulixertinib, SCH772984, LY3214996).
- RAS inhibitors e.g., AMG-510, MRTX 849
- RAF inhibitors e.g., dabrafenib, vemurafenib, LY3009120, encorafenib
- MEK inhibitors e.g., trametinib, binimetinib, selumetinib, cobimetinib
- ERK inhibitors
- “Pharmaceutically or pharmacologically acceptable” include molecular entities and compositions that do not produce an adverse, allergic, or other untoward reaction when administered to an animal, or a human, as appropriate. For human administration, preparations should meet sterility, pyrogenicity, and general safety and purity standards as required by FDA Office of Biologics standards.
- pharmaceutically acceptable carrier or “pharmaceutically acceptable excipient” as used herein refers to any and all solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
- compositions may also contain other active compounds providing supplemental, additional, or enhanced therapeutic functions.
- pharmaceutical composition refers to a composition comprising at least one compound as disclosed herein formulated together with one or more pharmaceutically acceptable carriers.
- pharmaceutically acceptable salt(s) refers to salts of acidic or basic groups that may be present in compounds used in the compositions. Compounds included in the present compositions that are basic in nature are capable of forming a wide variety of salts with various inorganic and organic acids.
- the acids that may be used to prepare pharmaceutically acceptable acid addition salts of such basic compounds are those that form non-toxic acid addition salts, i.e., salts containing pharmacologically acceptable anions, including, but not limited to, malate, oxalate, chloride, bromide, iodide, nitrate, sulfate, bisulfate, phosphate, acid phosphate, isonicotinate, acetate, lactate, salicylate, citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate and pamoate (i.e., 1,1'-methylene-
- Compounds included in the present compositions that are acidic in nature are capable of forming base salts with various pharmacologically acceptable cations.
- Examples of such salts include alkali metal or alkaline earth metal salts, particularly calcium, magnesium, sodium, lithium, zinc, potassium, and iron salts.
- Compounds included in the present compositions that include a basic or acidic moiety may also form pharmaceutically acceptable salts with various amino acids.
- the compounds of the disclosure may contain both acidic and basic groups; for example, one amino and one carboxylic acid group. In such a case, the compound can exist as an acid addition salt, a zwitterion, or a base salt.
- the compounds of the disclosure may contain one or more chiral centers and, therefore, exist as stereoisomers.
- stereoisomers when used herein consist of all enantiomers or diastereomers. These compounds may be designated by the symbols “R” or “S,” depending on the configuration of substituents around the stereogenic carbon atom, but the skilled artisan will recognize that a structure may denote a chiral center implicitly. These compounds may also be designated by “(+)” and “(-)” based on their optical rotation properties. The presently described compounds encompasses various stereoisomers of these compounds and mixtures thereof. Mixtures of enantiomers or diastereomers may be designated by the symbol “( ⁇ )” in nomenclature, but the skilled artisan will recognize that a structure may denote a chiral center implicitly.
- the term “therapeutically effective amount” means the amount of the subject compound that will elicit the biological or medical response of a tissue, system, or animal, (e.g., mammal or human) that is being sought by the researcher, veterinarian, medical doctor or other clinician.
- the compounds described herein are administered in therapeutically effective amounts to treat a disorder.
- “Treating” includes any effect, e.g., lessening, reducing, modulating, or eliminating, that results in the improvement of the condition, disease, disorder, and the like.
- the disclosure also embraces isotopically labeled compounds which are identical to those recited herein, except that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature.
- isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, sulfur, fluorine, and chlorine, such as 2 H, 3 H, 13 C, 14 C, 15 N, 18 O, 17 O, 31 P, 32 P, 35 S, 18 F, and 36 Cl, respectively.
- a compound of the disclosure may have one or more H atom replaced with deuterium.
- Individual enantiomers and diastereomers of the disclosed compounds can be prepared synthetically from commercially available starting materials that contain asymmetric or stereogenic centers, or by preparation of racemic mixtures followed by resolution methods well known to those of ordinary skill in the art. These methods of resolution are exemplified by (1) attachment of a mixture of enantiomers to a chiral auxiliary, separation of the resulting mixture of diastereomers by recrystallization or chromatography and liberation of the optically pure product from the auxiliary, (2) salt formation employing an optically active resolving agent, (3) direct separation of the mixture of optical enantiomers on chiral liquid chromatographic columns or (4) kinetic resolution using stereoselective chemical or enzymatic reagents.
- Racemic mixtures can also be resolved into their component enantiomers by well-known methods, such as chiral-phase liquid chromatography or crystallizing the compound in a chiral solvent.
- Stereoselective syntheses a chemical or enzymatic reaction in which a single reactant forms an unequal mixture of stereoisomers during the creation of a new stereocenter or during the transformation of a pre-existing one, are well known in the art.
- Stereoselective syntheses encompass both enantio- and diastereoselective transformations and may involve the use of chiral auxiliaries. For examples, see Carreira and Kvaerno, Classics in Stereoselective Synthesis, Wiley-VCH: Weinheim, 2009.
- “compounds of the disclosure”, comprise compounds of Formula I, Formula I-A, Formula I-B, Formula I-C, Formula I-CA, Formula I-D, Formula I- DA, Formula I-E, Formula I-EA, Formula I-F, Formula I-FA, Formula I-FB, Formula I-G, Formula I-GA, Formula I-H, Formula I-HA, Formula I-J, Formula I-JA, Formula I-JB, Formula I-JC, Formula I-K, Formula I-KA, Formula I-L, Formula I-LA, Formula I-M, Formula I-MA, Formula I-N, Formula I-NA, Formula I-O, Formula I-OA, Formula I-P, Formula I-PA, Formula I-Q, Formula I-QA, Formula I-R, Formula I-RA, Formula I-S, Formula I-SA, Formula I-T, and Formula I-TA.
- the compound is represented by Formula I-A: Formula I-A or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 and X 4 are each independently CH, CR 5 , or N; X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , CH or N; X 5 and X 6 are each independently CH, CF, or N; provided that not more than one of X 1 , X 3 , and X 4 are N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the
- the compound is represented by Formula I-B: Formula I-B or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 and X 4 are each independently CH, CR 5 , or N; provided that not more than one of X 1 and X 4 are N; X 5 and X 6 are each independently CH, CF, or N; X 31 is O or N(R 4 ); L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen
- the compound is represented by Formula I-C: Formula I-C or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or CH; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy
- the optionally substituted substituent, at each occurrence, is independently H, alkyl, alkoxy, alkoxyalkyl, amide, amine, aminoalkyl, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, cyanoalkyl, and sulfone, optionally substituted heteroaryl wherein the optionally substituted substituent, at each occurrence, is independently H, alkyl, alkoxy, amide, amine, acyl, alkoxyalkyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, cyano, cyanoalkyl, and heterocyclyl, and optionally substituted cycloalkyl wherein the optionally substituted substituent, at each occurrence,
- the compound is represented by Formula I-CA: Formula I-CA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy, alkoxy, cyano, haloalkyl;
- the compound is represented by Formula I-D: Formula I-D or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 31 is O or N(R 4 ); X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a C1-
- the compound is represented by Formula I-E: Formula I-E or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 and X 4 are each independently CH, CR 5 , or N; provided that not more than one of X 1 and X 4 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, o
- the compound is represented by Formula I-EA: Formula I-EA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 2 is a direct bond; E 1 is selected from the group consisting of hydroxy
- the compound is represented by Formula I-F: Formula I-F or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 and X 4 are each independently CH, CR 5 , or N; provided that not more than one of X 1 and X 4 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo,
- Formula I-G or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , or CH; X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or CH; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide
- the compound is represented by Formula I-GA: Formula I-GA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy, alkoxy, cyano,
- the compound is represented by Formula I-H: or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 31 is O or N(R 4 ); X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a C 1 -
- the compound is represented by Formula I-HA: Formula I-HA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 31 is O or N(R 4 ); X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a C 1
- the compound is represented by Formula I-J: Formula I-J or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , CH, or N ; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy
- the compound is represented by Formula I-JA: Formula I-JA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-L 3 -E 3 or CH; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond; E 1
- the compound is represented by Formula I-JB: or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or CH ; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy,
- the compound is represented by Formula I-JC: or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy, alkoxy, cyano, haloalkoxy,
- the compound is represented by Formula I-K: Formula I-K or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; X 31 is O or N(R 4 ); L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a C1-
- the compound is represented by Formula I-KA: Formula I-KA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; X 31 is O or N(R 4 ); L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when X 5 is N, L 1 may be taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is
- the compound is represented by Formula I-L: Formula I-L or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or CH ; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen,
- the compound is represented by Formula I-LA: Formula I-LA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 3 is C-L 3 -E 3 or CH; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a
- the compound is represented by Formula I-M: Formula I-M or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; X 31 is O or N(R 4 ); L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; L 3 is a direct bond or a C1-
- the compound is represented by Formula I-MA: Formula I-MA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; X 31 is O or N(R 4 ); L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when X 5 is N, L 1 may be taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl;
- the compound is represented by Formula I-N: Formula I-N or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , or CH; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxy
- the compound is represented by Formula I-NA: or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy, alkoxy, cyano, haloalk
- the compound is represented by Formula I-O: Formula I-O or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , CH, or N; X 3 is CH, C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or N; provided that not more than one of X 2 and X 3 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms
- the compound is represented by Formula I-OA: Formula I-OA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , CH, or N; X 3 is CH, C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or N; provided that not more than one of X 2 and X 3 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C 1 -C 6 alkyl optionally substituted with (E 11 ) m , or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms
- the compound is represented by Formula I-P: Formula I-P or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , CH, or N; X 3 is CH, C-O-L 3 -E 3 , C-L 3 -E 3 , C-N(R 4 )-L 3 -E 3 , or N; provide that not more than one of X 2 and X 3 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the
- the compound is represented by Formula I-PA: Formula I-PA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy, alkoxy, cyano, halo
- the compound is represented by Formula I-Q: Formula I-Q or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 is each independently CR 5 , or N; X 2 is C-O-L 2 -E 2 , C-L 2 -E 2 , C-N(R 4 )-L 2 -E 2 , CH, or N; provided that not more than one of X 1 and X 2 are N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy,
- the compound is represented by Formula I-QA: Formula I-QA or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 1 is each independently CR 5 or N; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, amine, acyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, and cyanoalkyl; E 1 is selected from the group consisting of hydroxy,
- the compound is represented by Formula I-R: Formula I-R or a pharmaceutically acceptable salt, enantiomer, stereoisomer, or tautomer thereof, wherein: X 2 is CH, C-O-L 2 -E 2 , C-L 2 -E 2 , or C-N(R 4 )-L 2 -E 2 ; X 3 is CH, C-O-L 3 -E 3 , C-L 3 -E 3 , or C-N(R 4 )-L 3 -E 3 ; X 5 and X 6 are each independently CH, CF, or N; L 1 is selected from a direct bond and a C1-C6alkyl optionally substituted with (E 11 )m, or when taken together with R 3 and the N atom to which L 1 and R 3 are attached form an optionally substituted heterocycle having from 4 to 8 atoms in the ring structure wherein the optionally substituted substituent, at each occurrence, is independently selected from
- E 1 is selected from the group consisting of H, hydroxy, alkoxy, cyano, haloalkoxy, halogen, optionally substituted alkyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkoxy, amine, alkylamine, haloalkyl, haloalkoxy, halogen, hydroxy, and cyano, optionally substituted cycloalkyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of aryl, alkyl, alkoxy, amine, haloalkyl, haloalkoxy, halogen, hydroxy, heterocyclyl, and cyano, optionally substituted heteroaryl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amine, amide, acyl, alkoxyalkyl, haloalkyl,
- E 1 is selected from the group consisting of H, hydrocy, alkoxy, cyano, haloalkoxy, halogen, optionally substituted alkyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkoxy, amine, alkylamine, haloalkyl, haloalkoxy, halogen, hydroxy, and cyano, optionally substituted cycloalkyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of aryl, alkyl, alkoxy, amine, haloalkyl, haloalkoxy, halogen, hydroxy, heterocyclyl,and cyano, optionally substituted heteroaryl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amine, amide, acyl, alkoxyalkyl, haloalkyl
- E 1a is selected from the group consisting of H and OMe
- E 1a is selected from the group consisting of H, OMe
- E 1b is selected from the group consisting of H and OMe.
- W is CH 2 or O.
- W is CH 2 .
- E 1 is selected from the group consisting of H, Me, CF 3 , CH2CF3, OMe, OEt, OCF3, F, CN,
- E 1 is selected from the group consisting of H, Me, CF 3 , CH2CF3, OMe, OEt, OCF3, F, and CN. [000126] In some embodiments, E 1 is selected from the group consisting of , 3 . [000127] In some embodiments, E 1 is selected from the group consisting of .
- E 11 at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, C 3 -C 5 cycloalkyl, C 1 -C 6 alkoxy, oxetanyl, cyano, C 1 - C6 haloalkoxy, C1-C6 haloalkyl, hydroxy, C1-C6 hydroxyalkyl, and halogen, or wherein two occurrences of E 11 taken together with the carbon atom to which they are attached form a C 3 - C6 cycloalkyl ring.
- E 11 at each occurrence, is independently selected from the group consisting of H, Me, CF 3 , OH, OMe, OEt, oxetanyl, OCF 3 , F, and CN, or wherein two occurrences of E 11 taken together with the carbon atom to which they are attached form cyclopropyl ring.
- L 1 is selected from the group consisting of direct bond, , .
- L 1 is a direct bond.
- L 1 is a C1- C 6 alkyl optionally substituted with (E 11 ) m .
- L 1 is taken together with R 3 and the N atom to which L 1 and R 3 are attached to form a heterocycle having from 4 to 8 atoms in the ring structure. [000131] In some embodiments, selected from the group consisting of: .
- L 1 is a direct bond
- L 1 is a direct bond
- s selected from the group consisting of .
- L 1 and R 3 taken together with the N atom to which they are attached form a heterocycle having from 4 to 8 atoms in the ring structure wherein the ring structure is selected from the group consisting of .
- the ring structure is selected from the group consisting of wherein the carbon substituent site is bonded to E 1 . [000139] In some embodiments, the ring structure is selected from the group consisting of: . [000140] In some embodiments, the ring structure is selected from the group consisting of: .
- E 2 is selected from the group consisting of hydroxy, C1-C6 alkoxy, C1-C6 alkoxylalkyl, cyano, sulfonyl, H, C1-C6 alkyl, amine, C1-C6 haloalkoxy, C1-C6 haloalkyl, sulfone, and an optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of C 1 -C 6 alkyl, C 1 -C 6 alkoxy, amide, amine, C 1 -C 6 acyl, C 1 -C 6 haloalkyl, C 1 -C 6 haloalkoxy, halogen, hydroxy, C1-C6 hydroxyalkyl, oxo, cyano, and C1-C6 cyanoalkyl.
- E 2 is selected from the group consisting of H, Me, .
- E 2 is selected from the group consisting of: H, Me, NMe 2 , OH, OMe, CN, and SO 2 Me.
- L 2 is selected from the group consisting of direct bond, : . ng of wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C 1 - C6 alkyl, C3-C5 cycloalkyl, and C1-C6 acyl.
- L 2 -E 2 is selected from the group consisting of .
- L 2 -E 2 is H, alkyl or cycloalkyl.
- E 3 is selected from the group consisting of hydroxy, C1-C6 alkoxy, C1-C6 alkoxylalkyl, cyano, sulfonyl, C1-C6 haloalkoxy, H, C1-C6 alkyl, C1-C6 acyl, amine, C 1 -C 6 aminoalkyl, amide, C 1 -C 6 haloalkyl, optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of C 1 -C 6 alkyl, C 1 -C 6 alkoxy, C 1 -C 6 alkoxyalkyl, amide, amine, C 1 - C6 aminoalkyl, C1-C6 acyl, C1-C6 haloalkyl, C1-
- E 31 at each occurrence is independently selected from the group consisting of H, C1-C6alkyl, C3-C5cycloalkyl, C1-C6alkoxy, oxetanyl, C1- C6alkoxylalkyl, cyano, C1-C6cyanoalkyl, C1-C6haloalkoxy, C1-C6haloalkyl, hydroxy, C1- C 6 hydroxyalkyl, and halogen, or wherein two occurrences of E 31 taken together with the carbon atom to which they are attached form a C3-C6 cycloalkyl ring.
- E 31 is, at each occurrence, independently selected from the group consisting of H, Me, CF 3 , OH, OMe, OEt, oxetanyl, OCF3, CH2OH, F, and CN, or wherein two occurrences of E 31 taken together with the carbon atom to which they are attached form cyclopropyl ring.
- L 3 is selected from the group consisting of direct bond, .
- L 3 is selected from the group consisting of direct bond, .
- L 3 (E 3 )(E 31 )p is selected from the group consisting of n , ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C1- C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl.
- L 3 (E 3 )(E 31 )p is selected from the group consisting of [000164] In some embodiments, L 3 (E 3 )(E 31 )p is selected from the group consisting of: .
- L 3 (E 3 )(E 31 ) p is selected from the group consisting of ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C1- C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl.
- L 3 (E 3 )(E 31 )p is selected from the group consisting of ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C1- C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl.
- E 7 is selected from the group consisting of: optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, cycloalkyl, alkoxy, alkoxyalkyl, amine, acyl, carbamoyl, formyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, cyanoalkyl, and sulfone, and optionally substituted heteroaryl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, urea, amine, acyl, carbamoyl, formyl, alkoxyalkyl, haloalkyl, haloalkoxy, halogen, hydroxy, and cyano.
- E 7 is selected from the group consisting of: H, optionally substituted heterocyclyl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, cycloalkyl, alkoxy, alkoxyalkyl, amine, acyl, carbamoyl, formyl, haloalkyl, haloalkoxy, halogen, hydroxy, hydroxyalkyl, oxo, cyano, cyanoalkyl, and sulfone, and optionally substituted heteroaryl wherein the optionally substituted substituent, at each occurrence, is independently selected from the group consisting of alkyl, alkoxy, amide, carbamoyl, urea, amine, acyl, carbamoyl, formyl, alkoxyalkyl, haloalkyl, haloalkoxy, halogen, hydroxy, and cyano.
- E 7 is selected from the group consisting of: , , ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl; and wherein s1 indicates the site of attachment to X 1 -X 4 ring and wherein indicates site of optional substituent when s1 is present or indicates site of attachment to ring when s1 is not present.
- E 7 is selected from the group consisting of: ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C1-C6 alkyl, C3-C5 cycloalkyl, and C1-C6 acyl; wherein one of the attachment sites are bonded to ring and the other of the attachment sites is bonded to optional substituent(s) if more than one attachment sites are present.
- E 7 is selected from the group consisting of: ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl; R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino; and R 9 , at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, and C 3 -C 5 cycloalkyl.
- E 7 is selected from the group consisting of: ; wherein R 6 , at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, C 3 -C 5 cycloalkyl, and C 1 -C 6 acyl. [000173] In some embodiments, E 7 is selected from the group consisting of . [000174] In some embodiments, E 7 is selected from the group consisting of
- E 7 is selected from the group consisting of .
- E 7 is selected from ; wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino.
- R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino; and R 9 , at each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, and C3-C5 cycloalkyl.
- E 7 is selected from the group consisting of .
- E 7 is selected from ; wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino.
- E 7 is selected from ; wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino.
- E 7 is selected from
- E 7 is selected from the group consisting of wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino.
- E 7 is selected from the group consisting of , . [000181] In some embodiments, E 7 is selected from wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino. [000182] In some embodiments, E 7 is selected from ; wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino. [000183] In some embodiments, E 7 is selected from t each occurrence, is independently selected from the group consisting of H, C 1 -C 6 alkyl, and C3-C5 cycloalkyl. [000184] In some embodiments, E 7 is selected from the group consisting of .
- E 7 is selected from the group consisting of , ; wherein R 8 is selected from the group consisting of H, OH, alkoxy, cyano, F, and amino. .
- X 5 is N and X 6 is CH or CF. In some embodiments, X 5 is CH or CF and X 6 is N. In some embodiments, X 5 and X 6 are CH. In some embodiments, X 5 is N and X 6 is CH. In some embodiments, X 5 is N and X 6 is CF. In some embodiments, X 5 is CH and X 6 is N. In some embodiments, X 5 is CF and X 6 is N.
- X 5 and X 6 are CH or CF. In some embodiments, X 5 is CH and X 6 is CH. In some embodiments, X 5 is CH and X 6 is CF. In some embodiments, X 5 is CF and X 6 is CH. In some embodiments, X 5 is CF and X 6 is CF. [000188] In some embodiments, R 1 is selected from the group consisting of H, alkyl, haloalkyl, haloalkoxy, cyano, and halogen. In some embodiments, R 1 is selected from the group consisting of H, C1-C6 alkyl, CN, and halogen.
- R 1 is selected from the group consisting of H, Me, Et, F, Br, and Cl. In some embodiments, R 1 is selected from the group consisting of Me and F. [000189] In some embodiments, R 2 is H or F. In some embodiments, R 2 is H. In some embodiments, R 2 is F. [000190] In some embodiments, R 3 is H or Me. In some embodiments, R 3 is H. [000191] In some embodiments, R 4 is H or C1-C6 alkyl. In some embodiments, R 4 is H or Me. [000192] In some embodiments, R 5 is selected from the group consisting of H, C1-C6 alkyl, and halogen. In some embodiments, R 5 is selected from the group consisting of H, Me, Et, F, and Cl. In some embodiments, R 5 is H. [000193] In an embodiment, described herein is a compound selected from the group consisting of:
- Compounds described herein can act as RAF inhibitors, e.g., BRAF inhibitors or CRAF inhibitors, and are therefore useful in the treatment of diseases and disorders in patients in need thereof, such as cancer.
- Exemplary cancers include, but are not limited to, melanoma, multiple myeloma, thyroid cancer, ovarian cancer, colorectal cancer, colon cancer, pancreatic cancer, lung cancer, bladder cancer, gastrointestinal stromal tumors, solid tumors, blood-borne cancers, hairy cell leukemia, acute myelogenous leukemia (AML), or other cancers caused by activation of the RAS ERK signaling pathway.
- a cancer described herein is a BRAF V600X driven cancer, an atypical BRAF mutated cancer, a BRAF fusion cancer, a CRAF fusion cancer, or a RAS mutant cancer.
- the cancer has a BRAF oncogenic mutation.
- the cancer has a RAS oncogenic mutation.
- the RAS oncogenic mutation is RAS Q61R or Q61K mutation.
- the cancer has a NF1 oncogenic mutation.
- the lung cancer is non-small lung cancer (NSCL).
- the colorectal cancer is colon cancer.
- the colorectal cancer is rectal cancer.
- a compound provided herein may be administered orally, subcutaneously, topically, parenterally, by inhalation spray or rectally in dosage unit formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants, and vehicles.
- Parenteral administration may include subcutaneous injections, intravenous or intramuscular injections or infusion techniques.
- Treatment can be continued for as long or as short a period as desired.
- the compositions may be administered on a regimen of, for example, one to four or more times per day.
- a suitable treatment period can be, for example, at least about one week, at least about two weeks, at least about one month, at least about six months, at least about 1 year, or indefinitely.
- a treatment period can terminate when a desired result is achieved.
- Combination Therapy Compounds described herein, e.g., a compound of the disclosure as described herein, can be administered in combination with one or more additional therapeutic agents to treat a disorder described herein, such as a cancer described herein.
- a pharmaceutical composition comprising a compound described herein, e.g., a compound of the disclosure as described herein, one or more additional therapeutic agents, and a pharmaceutically acceptable excipient.
- a compound of the disclosure as described herein and one additional therapeutic agent is administered.
- a compound of the disclosure as described herein and two additional therapeutic agents are administered.
- a compound of the disclosure as described herein and three additional therapeutic agents are administered.
- Combination therapy can be achieved by administering two or more therapeutic agents, each of which is formulated and administered separately.
- a compound of the disclosure as described herein and an additional therapeutic agent can be formulated and administered separately.
- Combination therapy can also be achieved by administering two or more therapeutic agents in a single formulation, for example a pharmaceutical composition comprising a compound of the disclosure as described herein as one therapeutic agent and one or more additional therapeutic agents such as a MAPK pathway inhibitor or chemotherapeutic agent.
- a compound of the disclosure as described herein and an additional therapeutic agent can be administered in a single formulation.
- Other combinations are also encompassed by combination therapy. While the two or more agents in the combination therapy can be administered simultaneously, they need not be. For example, administration of a first agent (or combination of agents) can precede administration of a second agent (or combination of agents) by minutes, hours, days, or weeks.
- the two or more agents can be administered within minutes of each other or within 1, 2, 3, 6, 9, 12, 15, 18, or 24 hours of each other or within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14 days of each other or within 2, 3, 4, 5, 6, 7, 8, 9, or weeks of each other. In some cases, even longer intervals are possible. While in many cases it is desirable that the two or more agents used in a combination therapy be present in within the patient's body at the same time, this need not be so. [000198] Combination therapy can also include two or more administrations of one or more of the agents used in the combination using different sequencing of the component agents.
- agents described herein are combined with other agents including MAPK pathway inhibitors.
- the other agent is an inhibitor of RAS.
- the other agent is an inhibitor of KRAS G12C.
- the other agent is a MEK inhibitor.
- the other agent is an ERK inhibitor.
- compounds described herein are combined with an immunomodulatory agent.
- the immunomodulatory enhances the adaptive immune response. In some embodiments, the immunomodulatory enhances the activity of antigen-presenting cells. In some embodiments, the immunomodulatory agent enhances the anti-tumor activity of myeloid cells including macrophages. In some embodiments, the immunomodulatory enhances the anti-tumor activity of Natural Killer cells. In some embodiments, the immunomodulatory agent enhances the activity of effector T Cells, including cytotoxic T Cells.
- the one or more additional therapeutic agents that may be administered in combination with a compound provided herein can be a MAPK pathway inhibitor. Such MAPK pathway inhibitors include, for example, MEK inhibitors, ERK inhibitors, and Ras inhibitors.
- Exemplary MEK inhibitors include, but are not limited to, trametinib, selumetinib, cobimetinib, binimetinib, mirdametinib, and pharmaceutically acceptable salts thereof.
- Exemplary ERK inhibitors include, but are not limited to, include, but are not limited to, ulixertinib, SCH772984, LY3214996, ravoxertinib, VX-11e, ASN-007, GDC-0994, MK- 8353, ASTX-029, LTT462, KO-947, and pharmaceutically acceptable salts thereof.
- Exemplary Ras inhibitors include, but are not limited to, AMG-510, MRTX849, ARS-1620, ARS-3248, LY3499446, and pharmaceutically acceptable salts thereof.
- the additional therapeutic agents can be immunomodulatory agents including but not limited to anti-PD-1 or anti-PDL-1 therapeutics including pembrolizumab, nivolumab, pidilizumab, cemiplimab, atezolizumab, durvalumab, BMS-936559, or avelumab.
- the additional therapeutic agents can be anti-TIM3 (anti-HAVcr2) therapeutics including but not limited to TSR-022 or MBG453, anti-LAG3 therapeutics including but not limited to relatlimab, LAG525, or TSR-033, anti- 4-1BB (anti-CD37, anti-TNFRSF9), CD40 agonist therapeutics including but not limited to SGN-40, CP-870,893 or RO7009789, anti-CD47 therapeutics including but not limited to Hu5F9-G4, anti-CD20 therapeutics, anti-CD38 therapeutics, STING agonists including but not limited to ADU-S100, MK-1454, ASA404, or amidobenzimidazoles.
- anti-TIM3 anti-HAVcr2
- anti-LAG3 therapeutics including but not limited to relatlimab, LAG525, or TSR-033, anti- 4-1BB (anti-CD37, anti-TNFRSF9)
- CD40 agonist therapeutics including but
- the additional therapeutic agents can be anti-CTLA4 agents including ipilimumab, tremelimumab.
- the additional therapeutic agents can be hypomethylating agents including but not limited to azacytidine or decitabine, other immunomodulatory therapeutics including but not limited to epidermal growth factor inhibitors, statins, metformin, angiotensin receptor blockers, thalidomide, lenalidomide, pomalidomide, prednisone, or dexamethasone.
- the additional therapeutic agents can be immunotherapeutic agents including targeted therapeutic agents, cancer vaccines, and CAR-T cell therapy.
- the compounds described herein may be administered in combination with other therapeutic agents known to treat cancers.
- Such other therapeutic agents include radiation therapy, anti-tubulin agents, DNA alkylating agents, DNA synthesis-inhibiting agents, DNA intercalating agents, anti-estrogen agents, anti-androgens, steroids, anti-EGFR agents, kinase inhibitors, mTOR inhibitors, PI3 kinase inhibitors, cyclin-dependent kinase inhibitors, CD4/CD6 kinase inhibitors, topoisomerase inhibitors, Histone Deacetylase (HDAC) inhibitors, DNA methylation inhibitors, anti-HER2 agents, anti-angiogenic agents, proteasome inhibitors, PARP (poly ADP ribose polymerase) inhibitors, cell cycle regulating kinase inhibitors, thalidomide, lenalidomide, antibody-drug-conjugates (ADCs).
- ADCs antibody-drug-conjugates
- the additional therapeutic agents can be chemotherapeutic agents including but not limited to an anti-tubulin agents (for example, paclitaxel, paclitaxel protein-bound particles for injectable suspension including but not limited to nab-paclitaxel, eribulin, docetaxel, ixabepilone, vincristine, auristatins, or maytansinoids), vinorelbine, DNA-alkylating agents (including but not limited to cisplatin, carboplatin, oxaliplatin, cyclophosphamide, ifosfamide, temozolomide), DNA intercalating agents or DNA topoisomerase inhibitors (including but not limited to anthracyclines such as doxorubicin, pegylated liposomal doxorubicin, daunorubicin, idarubicin, mitoxantrone, or epirubicin, camptothecins such as topot
- the additional therapeutic agents can be kinase inhibitors including but not limited to erlotinib, gefitinib, neratinib, afatinib, osimertinib, lapatanib, crizotinib, brigatinib, ceritinib, alectinib, lorlatinib, everolimus, temsirolimus, abemaciclib, LEE011, palbociclib, cabozantinib, ripretinib, sunitinib, pazopanib, sorafenib, regorafenib, sunitinib, axitinib, dasatinib, imatinib, nilotinib, idelalisib, ibrutinib, BLU-667, Loxo 292, larotrectinib, and quizartinib, [000207] In some embodiments,
- the additional therapeutic agents can be anti-angiogenic agents including but not limited to bevacizumab, aflibercept, and AMG386.
- the additional therapeutic agents can be antibody-drug- conjugates (ADCs) including but not limited to ADCs containing DM1, DM4, MMAE, MMAF, or camptothecin payloads, brentuximab vedotin and trastuzumab emtansine, radiotherapy, therapeutic vaccines including but not limited to sipuleucel-T.
- ADCs antibody-drug- conjugates
- the additional therapeutic agent can be an autophagy inhibitor, an inhibitor of vesicular trafficking, including but not limited to ULK inhibitors such as ULK1 inhibitors, ULK2 inhibitors, ULK1/ULK2 inhibitors, VPS34 inhibitors, PPT1 inhibitors, or lysosomal blocking agents.
- ULK inhibitors such as ULK1 inhibitors, ULK2 inhibitors, ULK1/ULK2 inhibitors, VPS34 inhibitors, PPT1 inhibitors, or lysosomal blocking agents.
- the additional therapeutic agent can be DCC-3116, SAR405, SB02024, hydroxychloroquinine, chloroquine, and LYS05.
- the additional therapeutic agent can be EGFR inhibitors.
- Exemplary EGFR inhibitors include, but are not limited, cetuximab, osimertinib, and afatinib, and pharmaceutically acceptable salts thereof.
- the additional therapeutic agent is selected from a luteinizing hormone-releasing hormone (LHRH) analog, including goserelin and leuprolide.
- LHRH luteinizing hormone-releasing hormone
- the additional therapeutic agent is selected from the group consisting of selected from the group consisting of everolimus, trabectedin, abraxane, TLK 286, AV-299, DN-101, pazopanib, GSK690693, RTA 744, ON 0910.Na, AZD 6244 (ARRY-142886), AMN-107, TKI-258, GSK461364, AZD 1152, enzastaurin, vandetanib, ARQ-197, MK-0457, MLN8054, PHA-739358, R-763, AT-9263, pemetrexed, erlotinib, dasatanib, nilotinib, decatanib, panitumumab, amrubicin, oregovomab, Lep-etu, nolatrexed, AZD 2171, batabulin, of atumtunab, zanolimumab, edotecar
- compositions and Kits [000213] Another aspect of this disclosure provides pharmaceutical compositions comprising compounds as disclosed herein formulated together with a pharmaceutically acceptable carrier.
- the present disclosure provides pharmaceutical compositions comprising compounds as disclosed herein formulated together with one or more pharmaceutically acceptable carriers.
- These formulations include those suitable for oral, rectal, topical, buccal, parenteral (e.g., subcutaneous, intramuscular, intradermal, or intravenous) rectal, vaginal, or aerosol administration, although the most suitable form of administration in any given case will depend on the degree and severity of the condition being treated and on the nature of the particular compound being used.
- disclosed compositions may be formulated as a unit dose, and/or may be formulated for oral or subcutaneous administration.
- Exemplary pharmaceutical compositions may be used in the form of a pharmaceutical preparation, for example, in solid, semisolid, or liquid form, which contains one or more of the compounds described herein, as an active ingredient, in admixture with an organic or inorganic carrier or excipient suitable for external, enteral, or parenteral applications.
- the active ingredient may be compounded, for example, with the usual non- toxic, pharmaceutically acceptable carriers for tablets, pellets, capsules, suppositories, solutions, emulsions, suspensions, and any other form suitable for use.
- the active object compound is included in the pharmaceutical composition in an amount sufficient to produce the desired effect upon the process or condition of the disease.
- the principal active ingredient may be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound provided herein, or a non-toxic pharmaceutically acceptable salt thereof.
- a pharmaceutical carrier e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound provided herein, or a non-toxic pharmaceutically acceptable salt thereof.
- the subject composition is mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, al
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- a tablet may be made by compression or molding, optionally with one or more accessory ingredients.
- Compressed tablets may be prepared using binder (for example, gelatin or hydroxypropylmethyl cellulose), lubricant, inert diluent, preservative, disintegrant (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-active or dispersing agent.
- Molded tablets may be made by molding in a suitable machine a mixture of the subject composition moistened with an inert liquid diluent.
- Tablets, and other solid dosage forms, such as dragees, capsules, pills, and granules, may optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the pharmaceutical-formulating art.
- Compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixtures thereof, and powders.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, cyclodextrins and mixtures thereof.
- inert diluents commonly used in the art, such as, for example, water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate
- Suspensions in addition to the subject composition, may contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- Formulations for rectal or vaginal administration may be presented as a suppository, which may be prepared by mixing a subject composition with one or more suitable non-irritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax, or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the body cavity and release the active agent.
- suitable non-irritating excipients or carriers comprising, for example, cocoa butter, polyethylene glycol, a suppository wax, or a salicylate, and which is solid at room temperature, but liquid at body temperature and, therefore, will melt in the body cavity and release the active agent.
- Dosage forms for transdermal administration of a subject composition include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
- the active component may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
- a pharmaceutically acceptable carrier such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
- Powders and sprays may contain, in addition to a subject composition, excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances.
- Sprays may additionally contain customary propellants, such as chlorofluorohydrocarbons and volatile unsubstituted hydrocarbons, such as butane and propane.
- Compositions and compounds of the present disclosure may alternatively be administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the compound. A non-aqueous (e.g., fluorocarbon propellant) suspension could be used.
- Sonic nebulizers may be used because they minimize exposing the agent to shear, which may result in degradation of the compounds contained in the subject compositions.
- an aqueous aerosol is made by formulating an aqueous solution or suspension of a subject composition together with conventional pharmaceutically acceptable carriers and stabilizers.
- the carriers and stabilizers vary with the requirements of the particular subject composition, but typically include non-ionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols.
- Aerosols generally are prepared from isotonic solutions.
- compositions of the present disclosure suitable for parenteral administration comprise a subject composition in combination with one or more pharmaceutically-acceptable sterile isotonic aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and non-aqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate and cyclodextrins.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate and cyclodextrins.
- Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- enteral pharmaceutical formulations including a disclosed compound, an enteric material, and a pharmaceutically acceptable carrier or excipient thereof.
- Enteric materials refer to polymers that are substantially insoluble in the acidic environment of the stomach, and that are predominantly soluble in intestinal fluids at specific pHs.
- the small intestine is the part of the gastrointestinal tract (gut) between the stomach and the large intestine, and includes the duodenum, jejunum, and ileum.
- the pH of the duodenum is about 5.5
- the pH of the jejunum is about 6.5
- the pH of the distal ileum is about 7.5.
- enteric materials are not soluble, for example, until a pH of about 5.0, of about 5.2, of about 5.4, of about 5.6, of about 5.8, of about 6.0, of about 6.2, of about 6.4, of about 6.6, of about 6.8, of about 7.0, of about 7.2, of about 7.4, of about 7.6, of about 7.8, of about 8.0, of about 8.2, of about 8.4, of about 8.6, of about 8.8, of about 9.0, of about 9.2, of about 9.4, of about 9.6, of about 9.8, or of about 10.0.
- Exemplary enteric materials include cellulose acetate phthalate (CAP), hydroxypropyl methylcellulose phthalate (HPMCP), polyvinyl acetate phthalate (PVAP), hydroxypropyl methylcellulose acetate succinate (HPMCAS), cellulose acetate trimellitate, hydroxypropyl methylcellulose succinate, cellulose acetate succinate, cellulose acetate hexahydrophthalate, cellulose propionate phthalate, cellulose acetate maleate, cellulose acetate butyrate, cellulose acetate propionate, copolymer of methylmethacrylic acid and methyl methacrylate, copolymer of methyl acrylate, methylmethacrylate and methacrylic acid, copolymer of methylvinyl ether and maleic anhydride (Gantrez ES series), ethyl methyacrylate-methylmethacrylate- chlorotrimethylammonium ethyl acrylate copolymer, natural resins such
- kits for use by a e.g., a consumer in need of treatment of cancer include a suitable dosage form such as those described above and instructions describing the method of using such dosage form to mediate, reduce or prevent inflammation.
- the instructions would direct the consumer or medical personnel to administer the dosage form according to administration modes known to those skilled in the art.
- kits could advantageously be packaged and sold in single or multiple kit units.
- Blister packs are well known in the packaging industry and are being widely used for the packaging of pharmaceutical unit dosage forms (tablets, capsules, and the like). Blister packs generally consist of a sheet of relatively stiff material covered with a foil of a preferably transparent plastic material. During the packaging process recesses are formed in the plastic foil. The recesses have the size and shape of the tablets or capsules to be packed. Next, the tablets or capsules are placed in the recesses and the sheet of relatively stiff material is sealed against the plastic foil at the face of the foil which is opposite from the direction in which the recesses were formed. As a result, the tablets or capsules are sealed in the recesses between the plastic foil and the sheet.
- the strength of the sheet is such that the tablets or capsules can be removed from the blister pack by manually applying pressure on the recesses whereby an opening is formed in the sheet at the place of the recess. The tablet or capsule can then be removed via said opening.
- a memory aid on the kit, e.g., in the form of numbers next to the tablets or capsules whereby the numbers correspond with the days of the regimen which the tablets or capsules so specified should be ingested.
- a memory aid is a calendar printed on the card, e.g., as follows "First Week, Monday, Tuesday, . .. etc... . Second Week, Monday, Tuesday, ... " etc.
- Other variations of memory aids will be readily apparent.
- a "daily dose” can be a single tablet or capsule or several pills or capsules to be taken on a given day. Also, a daily dose of a first compound can consist of one tablet or capsule while a daily dose of the second compound can consist of several tablets or capsules and vice versa. The memory aid should reflect this.
- ADP is adenosine diphosphate
- ATP is adenosine triphosphate
- Ar is argon gas
- Boc is t-butylcarbonate
- BSA bovine serum albumin
- Cs2CO3 is cesium carbonate
- CuI is copper (I) iodide
- CVs is column volumes
- DBU is 1,8-diazabicyclo[5.4.0]undec-7-ene
- DCE is dichloroethane
- DCM is dichloromethane
- DIEA is N,N-diisopropylethylamine
- DMA is N,N-dimethylacetamide
- DMAP is 4- (dimethylamino)pyridine
- DF is N,N-dimethylformamide
- dppf is 4- (dimethylamino)pyridine
- DF is N,N-dimethylformamide
- dppf is 4- (dimethylamino)pyridine
- Scheme 1 illustrates an exemplary preparation of intermediates 1-6.
- Treatment of bromides 1-1 (R NH2) with commercially available boronates 1-2 (2,6-dichloro-4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, 4-chloro-2-fluoro-6-(4,4,5,5- tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, 2-chloro-6-fluoro-4-(4,4,5,5-tetramethyl-1,3,2- dioxaborolan-2-yl)pyridine or 2,6-difluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2- yl)pyridine) in the presence of a palladium catalyst (Suzuki coupling) affords 1-3b.
- a palladium catalyst Sudzuki coupling
- Boronates 2-1a are commercially available or can be readily prepared from corresponding halides by known methods to those skilled in the art (see scheme 2).
- Scheme 2 [000235] Scheme 2 illustrates an exemplary preparation of intermediates 2-5.
- Compounds 2-3 can be obtained by activation of 2-1a with 2,2,2-trichloroethyl chloroformate (or isopropenyl chloroformate) under Schotten-Baumann conditions or by Pd-borylation of 2- 2 with bis(pinacolato)diboron.
- Intermediates 2-5 can be prepared by reaction of 2-1a with carboxylic acids E 1 -L 1 -COOH (commercially available or synthesized as described in US20080019978A1, Organic Letters, 2020, 22, 1091-1095 and Tetrahedron, 1986, 42, 2931- 2935) under Curtius rearrangement (in situ generation of isocyanate) conditions (DPPA and a base (Et 3 N) in a suitable solvent such as 1,4-dioxane at elevated temperature), by coupling reaction of 2-3 with amines E 1 -L 1 -N(R 3 )H or by Pd-borylation of 2-4 with bis(pinacolato)diboron.
- carboxylic acids E 1 -L 1 -COOH commercially available or synthesized as described in US20080019978A1, Organic Letters, 2020, 22, 1091-1095 and Tetrahedron, 1986, 42, 2931- 2935
- Scheme 3 illustrates an exemplary preparation of intermediates 3-4.
- Commercially available 4-bromo-2-fluoropyridine 3-1 reacts with various alcohols or amines Z-H by SNAr reaction in the presence of base to obtain 3-2.
- 3-4 can be prepared from 3-2 with boronates 2-1a under Suzuki reaction conditions.
- Scheme 4 [000237] Scheme 4 describes an exemplary preparation of intermediates 4-4a and 4-4b.
- Commercially available 4,6-dichloropyridin-2-amine 4-1 reacts with alcohols or amines Z-H by S N Ar reaction to provide 4-2a and 4-2b in the presence of a suitable base such as DIEA, K2CO3, or NaH.
- 4-2a and 4-2b can be separated by a suitable purification method for example by SFC purification, crystallization, or chromatography. After separation of a mixture 4-2a and 4-2b, each isomer reacts with boronates 2-1b under Suzuki conditions to obtain 4-3a and 4-3b respectively. Treatment of 4-3a with aldehyde or ketone to introduce R 4 by reductive alkylation conditions known to those skilled in the art gives the R 4 substituted secondary amine.
- 4-3b can be converted to 4-4b.
- Scheme 5 illustrates an exemplary preparation of intermediates 5-4.
- Commercially available 2,6-dichloropyridin-4-amine 5-1 reacts with alcohols or amines Z-H by S N Ar reaction in the presence of base such as DIEA, NaH, or K 2 CO 3 to provide 5-2.
- Suzuki reaction of 5-2 with boronates 2-1b provides 5-3.
- Intermediates 5-4 can be prepared from 5-3 in a similar manner as described in Scheme 4.
- Scheme 6 illustrates an exemplary preparation of pyridazine intermediates 6-4 and 6-6.
- 5-Bromo-3-chloropyridazine 6-1 reacts with alcohols or amines Z-H to afford 6-2 by S N Ar reaction.
- Scheme 7 illustrates an exemplary preparation of pyrimidine intermediates 7.4a, 7-4b and 7-4c.
- 2,4,6-Trichloropyrimidine 7-1 reacts with boronates or boronic acids Z- B(OR) 2 in the presence of a palladium catalyst (Suzuki reaction) to afford a mixture of intermediates 7-2a and 7-2b, which can be separated by SFC purification, crystallization, or chromatography.
- 7-2a reacts with alcohols (E 3 -L 3 -OH) or amines (E 3 -L 3 -N(R 4 )H) by SNAr reaction to obtain 7-3a.
- reaction of 7-2b with alcohols (E 3 -L 3 -OH) or amines (E 3 -L 3 -N(R 4 )H) by SNAr reaction affords a mixture of 7-3b and 7-3c which can be separated by a suitable method (for example: SFC purification, column chromatography or recrystallization).
- Scheme 8 illustrates an exemplary preparation of intermediates 8-4.
- 4,6- Dichloro-2-(methylthio)pyrimidine 8-1 reacts with alcohols or amines Z-H in the presence of base to produce 8-2.
- Treatment of 8-2 with boronates 2-1b in the presence of a palladium catalyst (Suzuki reaction) affords 8-3.
- Nitro reduction of 8-3 by palladium catalyzed hydrogenation or mild reducing conditions such as zinc or iron metal with ammonium chloride affords 8-4.
- Scheme 9 N-alkylation or N-acylation 1,4-dioxane HCl, heat H 9-5 N N 9-2
- Scheme 9 describes an exemplary preparation of Z-substituted bromo- pyridones 9-5.
- Either N-alkylation or N-acylation of 5-bromo-2-methoxypyridin-3-amine 9-1 and 5-bromo-2-fluoropyridin-3-amine 9-2 affords 9-3 and 9-4 respectively, wherein Z is attached to the pyridyl ring via nitrogen atom.
- Both 9-3 and 9-4 afford Z-substituted bromo- pyridones 9-5 under acidic conditions such as conc.
- Scheme 10 illustrates an exemplary preparation of intermediates 10-2a and 10- 2b.
- 10-1a can be prepared from 9-5 with alcohols (E 3 -L 3 -OH) by standard Mitsunobu reaction known to those skilled in the art.
- O-alkylated 10-1aand N-alkylated 10-1b can be reacted with boronates 2-1a in the presence of a palladium catalyst (Suzuki reaction) to afford 10-2a and 10-2b respectively.
- Each 11-2a and 11-2b reacts with boronates or boronic acids Z-B(OR) 2 under Pd-catalyzed coupling reaction (for example, Pd(OAc)2, (R)-(+)-2,2’-bis(diphenylphosphino)- 1,1’binaphthyl) in the presence of base like Cs 2 CO 3 or K 2 CO 3 in aprotic solvents like toluene or 1,4-dioxane to afford 11-3a and 11-3b respectively.
- Pd-catalyzed coupling reaction for example, Pd(OAc)2, (R)-(+)-2,2’-bis(diphenylphosphino)- 1,1’binaphthyl
- base like Cs 2 CO 3 or K 2 CO 3
- aprotic solvents like toluene or 1,4-dioxane
- Scheme 12 illustrates an exemplary preparation of intermediates 12-4a and 12- 4b.
- Each 12-2a and 12-2b reacts with alcohols or amines Z-H by SNAr reaction to afford 12-3a and 12-3b respectively.
- Scheme 13 illustrates an exemplary preparation of intermediates 13-3 and 13- 4.
- Compound 13-1 treats with boronates or boronic acids Z-B(OR)2 in the presence of a palladium catalyst (Suzuki reaction) afford 13-2.
- Z-substituted chlorides 13-2 react with boronates 2-1a under Suzuki conditions to afford intermediates 13-3.
- compound 13-1 reacts with boronates 2-1a in the presence of a palladium catalyst (Suzuki reaction) afford 13-4.
- Scheme 14 illustrates an exemplary preparation of intermediates 14-3.
- Bromides 14-1a (commercially available or synthesized by suitable method well known to those skilled in the art) react with boronates 2-1a under Suzuki reaction conditions to furnish 14-2a.
- Chlorides 14-2a react with boronates or boronic acid Z-B(OR) 2 under Suzuki conditions to afford 14-3.
- intermediates 14-3 can be prepared from boronates 14-1b (commercially available or synthesized by suitable method well known to those skilled in the art).
- Boronates 14-1b react with Chlorides Z-Cl in the presence of a palladium catalyst (Suzuki reaction) to afford 14-2b.
- Scheme 15 illustrates an exemplary preparation of intermediates 15-2. Activation of 1-5, 6-3 and 13-4 with 2,2,2-trichloroethyl chloroformate (or isopropenyl chloroformate) under Schotten-Baumann conditions give intermediates 15-1.
- Compounds 15- 2 can be prepared by coupling reaction of 1-5, 6-3 and 13-4 with isocyanates E 1 -L 1 -NCO (commercially available or synthesized by suitable method well known to those skilled in the art), or by coupling reaction of 1-5, 6-3 and 13-4 with amines E 1 -L 1 -N(R 3 )H in the presence of triphosgene, or by Curtius rearrangement of 1-5, 6-3 and 13-4 with carboxylic acid E 1 -L 1 - COOH, or by coupling reaction of 1-5, 6-3 and 13-4 with E 1 -L 1 -N(R 3 )COOCH2CCl3 which can be obtained by activation of E 1 -L 1 -N(R 3 )H with 2,2,2-trichloroethyl chloroformate under Schotten-Baumann conditions.
- isocyanates E 1 -L 1 -NCO commercially available or synthesized by suitable method well known to those skilled in the art
- compounds 15-2 can be prepared by coupling reaction of 15-1 with amines E 1 -L 1 -N(R 3 )H in the presence of base such as DIEA.
- Scheme 16 illustrates an exemplary preparation of intermediates 16-2. Activation of 8-4 with 2,2,2-trichloroethyl chloroformate under Schotten-Baumann conditions produces 16-1 which is reacted with amines E 1 -L 1 -N(R 3 )H to obtain 16-2.
- Scheme 17 illustrates an exemplary preparation of compounds of Formula I. Activation of A (1-6, 3-4, 4-4a, 4-4b, 5-4, 6-4, 6-5, 7-4a, 7-4b, 7-4c, 10-2a, 10-2b, 11-4a, 11-4b, 12-4a, 12-4b, 13-3, and 14-3) with 2,2,2-trichloroethyl chloroformate (or isopropenyl chloroformate) under Schotten-Baumann conditions affords intermediates 17-1.
- A 1-6, 3-4, 4-4a, 4-4b, 5-4, 6-4, 6-5, 7-4a, 7-4b, 7-4c, 10-2a, 10-2b, 11-4a, 11-4b, 12-4a, 12-4b, 13-3, and 14-3
- 2,2,2-trichloroethyl chloroformate or isopropenyl chloroformate
- Compounds of Formula I can be prepared by coupling reaction of 17-1 with amines E 1 -L 1 -N(R 3 )H in the presence of base such as DIEA or by coupling reaction of compounds A with isocyanates E 1 - L 1 -NCO (commercially available or synthesized by suitable method well known to those skilled in the art), or by coupling reaction of compounds A with amines E 1 -L 1 -N(R 3 )H in the presence of triphosgene, or by Curtius rearrangement of compounds A with carboxylic acid E 1 -L 1 -COOH, or by coupling reaction of compounds A with E 1 -L 1 -N(R 3 )COOCH 2 CCl 3 which can be obtained by activation of E 1 -L 1 -N(R 3 )H with 2,2,2-trichloroethyl chloroformate under Schotten-Baumann conditions or by Suzuki reaction of 15-2 with Z-B(OR) 2 .
- base such as D
- boronates 2-5 can be converted to compound of Formula I under Suzuki conditions with compounds B (3-2, 6-2, 6-5, 7-3a, 7-3c, 11-3a, 11-3b, 12-3a, 12-3b, 13-2, and 14-2b).
- compound of Formula I can be prepared by oxidation of 16-2 with mCPBA, followed by S N Ar reaction with alcohols E 3 -L 3 -OH or amines E 3 -L 3 -N(R 4 )H.
- compounds of Formula I which contains an unsaturated functionality such as a double bond can be hydrogenated in the presence of Pd catalyst.
- a nitrogen protecting group such as Boc
- the protecting group can be removed under acidic conditions (trifluoroacetic acid or HCl in 1,4-dioxane).
- Formula I which contains an oxygen protecting group such as TBDMS
- the protecting group can be deprotected using TBAF.
- the reaction mixture was quenched with sat’d NaHCO 3 (aq, 50 mL) and then the solution was extracted with DCM (3 x 50 mL). The combined organics were dried over anhydrous Na2SO4, filtered, and concentrated to dryness to afford a black oil.
- the black oil was purified by silica gel column chromatography (0 to10% MeOH/DCM) to obtain N-(4-bromopyridin-2-yl)-2- (dimethylamino)acetamide (2.16 g, 36%) as a brown solid.
- the reaction mixture was degassed by bubbling argon for two minutes and treated with Pd(dppf)Cl2.DCM adduct (0.76 g, 0.93 mmol).
- the resulting reaction mixture was heated at 60 oC for 3 h.
- the reaction was filtered through a pad of celite and washed using EtOAc.
- the organic layer was separated and concentrated under reduced pressure to afford a brown oil.
- the brown oil was then suspended in MeOH and the solid was filtered to obtain 2,6-difluoro- 4-(2-methyl-5-nitrophenyl)pyridine (4.1 g, 89%) as a tan solid.
- reaction mixture was purged with nitrogen gas for 20 min then, Pd(dppf)Cl2.DCM adduct (0.10 g, 0.38 mmol) was added.
- the reaction mixture was heated at 90 oC for another 2 h and the mixture was cooled to rt.
- the solution was filtered through a pad of celite and washed with EtOAc (750 mL). The filtrate was washed with water (250 mL).
- the combined organics were dried over anhydrous Na 2 SO 4 , filtered, and concentrated under reduced pressure to obtain the crude.
- the reaction mixture was heated to 100 oC for 20 h.
- the reaction was cooled to rt and the solution was diluted with DCM (75 mL).
- the solution was filtered through a pad of celite and then the solution was washed with sat’d NaHCO3 solution (150 mL).
- the solution was extracted with DCM (2 x 40 mL) and the combined organics were dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure to yield 5-chloro-1-methyl-3-morpholinopyridin-2(1H)-one (1.49 g, 127%) as a tan solid.
- Example C3 4-bromo-1-(tetrahydro-2H-pyran-2-yl)-1H-pyrazolo[3,4- b]pyridine solution of 4-bromo-1H-pyrazolo[3,4-b]pyridine (1.61 g, 8.1 mmol) in EtOAc (30 mL) was treated with 3,4-dihydro-2H-pyran (2 mL, 22 mmol). 4- Methylbenzenesulfonic acid (0.075 g, 0.39 mmol) was added and then the reaction was allowed to stir at rt overnight. The reaction turned orange and a precipitate was present.
- reaction mixture was filtered through a pad of celite and washed with EtOH. The filtrate was then concentrated under reduced pressure and the reside was purified by reverse-phase column chromatography (0 to 100% (0.4% TFA:H 2 O)/CH 3 CN) to afford 4-methyl-3-(2- morpholinopyridin-4-yl)aniline (0.10 g, 55%) as an off-white solid.
- Example I1 1-(5-(2-chloropyridin-4-yl)-2-fluoro-4-methylphenyl)-3-(2-(1- methylcyclopropyl)ethyl)urea
- a solution of 2,2,2-trichloroethyl (5-(2-chloropyridin-4-yl)-2-fluoro-4- methylphenyl)carbamate (H38, 0.30 g, 0.73 mmol) and DIEA (0.57 mL, 3.3 mmol) in DMSO (7 mL) was treated with 2-(1-methylcyclopropyl)ethan-1-amine hydrochloride (0.16 g, 1.2 mmol).
- the reaction was stirred at 80 oC 2.5 h and RT overnight.
- the reaction was diluted with DCM (30 mL), filtered through a pad of celite, and washed with DCM (20 mL).
- the filtrate was treated with sat’d NaHCO 3 (50 mL) and the organic layer was extracted with DCM (2x).
- the combined organics were dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure.
- the combined organics were washed with water (35 mL) and the organics were dried over anhydrous MgSO4, filtered, and concentrated under reduced pressure to obtain the crude.
- the crude was purified by reverse phase column chromatography (0 to 100% H 2 O/CH 3 CN in 0.4% TFA). The fractions were collected and concentrated. The residue was dissolved in CH3CN and treated with aqueous solution of K 2 CO 3 .
- Biochemical assay for A-Raf.1 Activity of A-Raf kinase (SEQ. ID NO. 1) was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942).
- Assays were conducted in 384-well plates (100 ⁇ L final volume) using 5.55 nM A-Raf (Sigma), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl 2 , 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- Assays were conducted in 384-well plates (25 ⁇ L final volume) using 20 nM A-Raf (Eurofins), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.7 mM NADH, 100 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl 2 , 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- ID NO: 2 was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942).
- Assays were conducted in 384-well plates (100 ⁇ L final volume) using 0.13 nM B-Raf (Sigma), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl 2 , 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- ID NO: 2 was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938- 1942).
- Assays were conducted in 384-well plates (25 ⁇ L final volume) using 2 nM B-Raf (Sigma), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.7 mM NADH, 50 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl2, 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- Inhibition of B-Raf was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored hourly for 4 h at 30 oC on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2 to 3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e., reaction with no test compound and reaction with a known inhibitor) and IC50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software).
- ID NO: 3 was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942).
- Assays were conducted in 384-well plates (100 ⁇ L final volume) using 0.43 nM C-Raf (Sigma), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl2, 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002 % Triton X-100).
- ID NO: 3 was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938- 1942).
- Assays were conducted in 384-well plates (25 ⁇ L final volume) using 3.84 nM C-Raf (Eurofins), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.7 mM NADH, 50 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl 2 , 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- Inhibition of C-Raf was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored hourly for 4 h at 30 oC on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 2 to 3 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e., reaction with no test compound and reaction with a known inhibitor) and IC 50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software).
- Sequence 2 C-Raf residues 306-end; Y340D, Y341D with N-terminal GST-tag (SEQ ID NO: 3) QPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSDDWEIEASEVMLSTRIGSGSFGTVY KGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAI VTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIF LHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDV YSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADC VKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF Biochemical assay for B-Raf
- kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942).
- Assays were conducted in 384-well plates (100 ⁇ L final volume) using 0.03 nM B-Raf (SignalChem), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.28 mM NADH, 30.1 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl 2 , 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- B- Raf Inhibition of B- Raf (V600E) was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored continuously for 6 h at 30 oC on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 3 to 4 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e., reaction with no test compound and reaction with a known inhibitor) and IC 50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software). Biochemical assay for B-Raf (V600E).2 Activity of B-Raf (V600E) (SEQ.
- kinase was determined spectroscopically using a coupled pyruvate kinase/lactate dehydrogenase assay that continuously monitors the ATP hydrolysis-dependent oxidation of NADH (e.g., Schindler et al., Science, 2000, 289, 1938-1942).
- Assays were conducted in 384-well plates (25 ⁇ L final volume) using 0.5 nM B- Raf (deCode), 1.5 units pyruvate kinase, 2.1 units lactate dehydrogenase, 1 mM phosphoenol pyruvate, 0.7 mM NADH, 100 nM MEK (SignalChem), and 1 mM ATP in assay buffer (100 mM Tris, pH 7.5, 15 mM MgCl2, 0.5 mM DTT, 0.1% octyl-glucoside, 0.002% (w/v) BSA, and 0.002% Triton X-100).
- B-Raf (V600E) Inhibition of B-Raf (V600E) was measured by adding serial diluted test compound (final assay concentration of 1% DMSO). A decrease in absorption at 340 nm was monitored hourly for 4 h at 30 oC on a multi-mode microplate reader (BioTek). The reaction rate was calculated using the 3 to 4 h time frame. The reaction rate at each concentration of compound was converted to percent inhibition using controls (i.e., reaction with no test compound and reaction with a known inhibitor) and IC 50 values were calculated by fitting a four-parameter sigmoidal curve to the data using Prism (GraphPad software). B-Raf (V600E) residues 416-766 with a N-terminal GST-tag (SEQ.
- A375 Cell Proliferation Assay (1) [000315] A375 cells (catalog (#CRL-1619) are obtained from the American Type Culture Collect (ATTC, Manassas, VA).
- test compound was dispensed into a 96-well black clear bottom plate in triplicate. Two thousand five hundred cells are added per well in 200 ⁇ L complete growth medium in the 96-well plate. Plates are incubated for 67-72 hours at 37 oC, 5% CO 2 , and 95% humidity.
- A375 Cell Proliferation Assay (2) [000316] A375 cells (catalog (#CRL-1619) are obtained from the American Type Culture Collect (ATTC, Manassas, VA). Briefly, cells were grown in DMEM High Glucose supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are sub-cultured or harvested for assay use. Using the Beckman Coulter Echo 650, a serial dilution of test compound is dispensed into a 384-well black clear bottom plate in triplicate.
- H2405 Cell Proliferation Assay (1) H2405 cells (catalog #CRL-5944) are obtained from the American Type Culture Collect (ATTC, Manassas, VA). Briefly, cells were grown in RPMI 1640 supplemented with 5% characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use.
- test compound A serial dilution of test compound is dispensed into a 96-well black clear bottom plate in triplicate. Three thousand cells are added per well in 200 ⁇ L complete growth medium in the 96-well plate. Plates are incubated for 67- 72 hours at 37 oC, 5% CO2, and 95% humidity. At the end of the incubation, 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, St. Louis, MO) in PBS is added to each well of the plate and plates are incubated for an additional 5- 6 hours at 37 oC, 5% CO 2 , and 95% humidity.
- a 440 ⁇ M solution of resazurin Sigma, St. Louis, MO
- H2405 Cell Proliferation Assay (2) H2405 cells (catalog #CRL-5994) are obtained from the American Type Culture Collect (ATTC, Manassas, VA). Briefly, cells were grown in RPMI 1640 supplemented with 5% characterized fetal bovine serum (Invitrogen, Carlsbad, CA) and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO 2 , and 95% humidity.
- Cells are expanded until reaching 70-95% confluency at which point they are sub-cultured or harvested for assay use.
- a serial dilution of test compound is dispensed into a 384-well black clear bottom plate in triplicate. Seven hundred fifty cells are added per well in 50 ⁇ L complete growth medium in the 384-well plate. Plates are incubated for 67-72 h at 37 oC, 5% CO 2 , and 95% humidity.
- 10 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, St. Louis, MO) in PBS is added to each well of the plate and plates are incubated for an additional 5-6 h at 37 oC, 5% CO2, and 95% humidity.
- WM3928 cells (#WM3928-01-0001) are obtained from Rockland Immunochemicals Inc (Gilbertsville, PA). Briefly, cells were grown in MCDB 153 medium (Sigma, #M7403, St.
- Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use.
- a serial dilution of test compound is dispensed into a 96-well black clear bottom plate in triplicate. Three thousand cells are added per well in 200 ⁇ L complete growth medium in the 96-well plate. Plates are incubated for 67- 72 hours at 37 oC, 5% CO2, and 95% humidity.
- 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, #199303, St. Louis, MO) in PBS is added to each well of the plate and plates are incubated for an additional 6-7 hours at 37 oC, 5% CO2, and 95% humidity.
- WM3928 Cell Proliferation Assay (2) [000318] WM3928 cells (#WM3928-01-0001) are obtained from Rockland Immunochemicals Inc (Gilbertsville, PA). Briefly, cells were grown in MCDB 153 medium (Sigma, #M7403, St.
- Cells are expanded until reaching 70-95% confluency at which point they are sub-cultured or harvested for assay use.
- Beckman Coulter Echo 650 a serial dilution of test compound is dispensed into a 384-well black clear bottom plate in triplicate. Seven hundred fifty cells are added per well in 50 ⁇ L complete growth medium in the 384-well plate. Plates are incubated for 67-72 hours at 37 oC, 5% CO 2 , and 95% humidity. At the end of the incubation, 10 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, #199303, St.
- WM3629 Cell Proliferation Assay (1) [000319] WM3629 cells (#WM3629-01-0001) are obtained from Rockland Immunochemicals Inc (Gilbertsville, PA). Briefly, cells were grown in MCDB 153 medium (Sigma, #M7403, St.
- Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use.
- a serial dilution of test compound is dispensed into a 96-well black clear bottom plate in triplicate.
- Four thousand five hundred cells are added per well in 200 ⁇ L complete growth medium in the 96-well plate. Plates are incubated for 67-72 hours at 37 oC, 5% CO 2 , and 95% humidity.
- 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, #199303, St.
- WM3629 Cell Proliferation Assay (2) [000320] WM3629 cells (#WM3629-01-0001) are obtained from Rockland Immunochemicals Inc (Gilbertsville, PA). Briefly, cells were grown in MCDB 153 medium (Sigma, #M7403, St.
- MiaPaca-2 Cell Proliferation Assay (1) [000321] Miapaca-2 cells (catalog #CRL-1420) are obtained from the American Type Culture Collect (ATTC, Manassas, VA).
- cells were grown in DMEM supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 2.5% New Zealand sourced horse serum and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use. A serial dilution of test compound is dispensed into a 96-well black clear bottom plate in triplicate. Three thousand cells are added per well in 200 ⁇ L complete growth medium in the 96-well plate. Plates are incubated for 67-72 hours at 37 oC, 5% CO 2 , and 95% humidity.
- MiaPaca-2 Cell Proliferation Assay (2) [000322] Miapaca-2 cells (catalog #CRL-1420) are obtained from the American Type Culture Collect (ATTC, Manassas, VA). Briefly, cells were grown in DMEM supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 2.5% New Zealand sourced horse serum and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO2, and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are sub-cultured or harvested for assay use. A serial dilution of test compound is dispensed into a 384-well black clear bottom plate in triplicate.
- MiaPaca-2 Combination Cell proliferation Assay (1) [000323] Miapaca-2 cells (catalog #CRL-1420) are obtained from the American Type Culture Collect (ATCC, Manassas, VA). Briefly, cells were grown in DMEM supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 2.5% New Zealand sourced horse serum and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO 2 , and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use.
- test compound was dispensed into multiple 96-well black clear bottom plates in triplicate.
- a serial dilution of complete growth medium containing cobimetinib was prepared at twice the final concentration and 100 ⁇ L was dispensed across the test compound titration in triplicate.
- Three thousand cells are added per well in 100 ⁇ L complete growth medium in each 96-well plate. Plates are incubated for 67-72 hours at 37 oC, 5% CO2, and 95% humidity. At the end of the incubation, 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, St.
- MiaPaca-2 Combination Cell proliferation Assay (2)
- Miapaca-2 cells (catalog #CRL-1420) are obtained from the American Type Culture Collect (ATCC, Manassas, VA). Briefly, cells were grown in DMEM supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, CA), 2.5% New Zealand sourced horse serum and 1% Penicillin/Streptomycin/L-Glutamine at 37 oC, 5% CO 2 , and 95% humidity. Cells are expanded until reaching 70-95% confluency at which point they are subcultured or harvested for assay use.
- Table M “+” refers to an IC50 less than or equal to 100 nM; “++” refers to an IC50 greater than 100 nM and less than or equal to 500 nM; “+++” refers to an IC50 greater than 500 nM and less than or equal to 1000 nM; and “++++” refers to an IC 50 greater than 1000 nM and less than or equal to 10000 nM.
- Table N Inhibition of cell proliferation in A375 (2), H2405 (2), WM3928 (2), WM3629 (2), MiaPaca-2 (2), and combination with cobimetinib in MiaPaca-2 (2) by exemplary compounds (“Ex. No.”).
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2024534260A JP2024546107A (ja) | 2021-12-09 | 2022-12-09 | Rafキナーゼ阻害剤及びその使用方法 |
| EP22847085.2A EP4444430A1 (en) | 2021-12-09 | 2022-12-09 | Raf kinase inhibitors and methods of use thereof |
| AU2022405115A AU2022405115A1 (en) | 2021-12-09 | 2022-12-09 | Raf kinase inhibitors and methods of use thereof |
| CN202280091224.0A CN119585242A (zh) | 2021-12-09 | 2022-12-09 | Raf激酶抑制剂及其使用方法 |
| CA3240192A CA3240192A1 (en) | 2021-12-09 | 2022-12-09 | Raf kinase inhibitors and methods of use thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163287866P | 2021-12-09 | 2021-12-09 | |
| US63/287,866 | 2021-12-09 | ||
| US202263393440P | 2022-07-29 | 2022-07-29 | |
| US63/393,440 | 2022-07-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023108103A1 true WO2023108103A1 (en) | 2023-06-15 |
Family
ID=85018968
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/081236 Ceased WO2023108103A1 (en) | 2021-12-09 | 2022-12-09 | Raf kinase inhibitors and methods of use thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20230357179A1 (enExample) |
| EP (1) | EP4444430A1 (enExample) |
| JP (1) | JP2024546107A (enExample) |
| CN (1) | CN119585242A (enExample) |
| AU (1) | AU2022405115A1 (enExample) |
| CA (1) | CA3240192A1 (enExample) |
| TW (1) | TW202342442A (enExample) |
| WO (1) | WO2023108103A1 (enExample) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024258919A1 (en) * | 2023-06-13 | 2024-12-19 | Deciphera Pharmaceuticals, Llc | Dual raf and tubulin inhibitors and methods of use thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3746059B1 (en) | 2018-01-31 | 2026-03-04 | Deciphera Pharmaceuticals, LLC | Combination therapy for the treatment of gastrointestinal stromal tumors |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080019978A1 (en) | 2005-05-17 | 2008-01-24 | Schering Corporation | Nitrogen-containing heterocyclic compounds and methods of use thereof |
| WO2013134252A1 (en) | 2012-03-07 | 2013-09-12 | Eli Lilly And Company | 2-amino, 6 - phenyl substituted pyrido [2, 3 - d] pyrimidine derivatives useful as raf kinase inhibitors |
| WO2016038582A1 (en) * | 2014-09-12 | 2016-03-17 | Novartis Ag | Compounds and compositions as raf kinase inhibitors |
| WO2020198058A1 (en) * | 2019-03-22 | 2020-10-01 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
| WO2021081375A1 (en) * | 2019-10-24 | 2021-04-29 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
| WO2022060996A1 (en) * | 2020-09-18 | 2022-03-24 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1505064A1 (en) * | 2003-08-05 | 2005-02-09 | Bayer HealthCare AG | 2-Aminopyrimidine derivatives |
| US8906944B2 (en) * | 2009-09-03 | 2014-12-09 | Allergan, Inc. | Compounds as tyrosine kinase modulators |
-
2022
- 2022-12-09 US US18/078,269 patent/US20230357179A1/en active Pending
- 2022-12-09 JP JP2024534260A patent/JP2024546107A/ja active Pending
- 2022-12-09 WO PCT/US2022/081236 patent/WO2023108103A1/en not_active Ceased
- 2022-12-09 CN CN202280091224.0A patent/CN119585242A/zh active Pending
- 2022-12-09 EP EP22847085.2A patent/EP4444430A1/en active Pending
- 2022-12-09 AU AU2022405115A patent/AU2022405115A1/en active Pending
- 2022-12-09 CA CA3240192A patent/CA3240192A1/en active Pending
- 2022-12-09 TW TW111147359A patent/TW202342442A/zh unknown
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080019978A1 (en) | 2005-05-17 | 2008-01-24 | Schering Corporation | Nitrogen-containing heterocyclic compounds and methods of use thereof |
| WO2013134252A1 (en) | 2012-03-07 | 2013-09-12 | Eli Lilly And Company | 2-amino, 6 - phenyl substituted pyrido [2, 3 - d] pyrimidine derivatives useful as raf kinase inhibitors |
| WO2016038582A1 (en) * | 2014-09-12 | 2016-03-17 | Novartis Ag | Compounds and compositions as raf kinase inhibitors |
| WO2020198058A1 (en) * | 2019-03-22 | 2020-10-01 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
| WO2021081375A1 (en) * | 2019-10-24 | 2021-04-29 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
| WO2022060996A1 (en) * | 2020-09-18 | 2022-03-24 | Kinnate Biopharma Inc. | Inhibitors of raf kinases |
Non-Patent Citations (2)
| Title |
|---|
| ORGANIC LETTERS, vol. 22, 2020, pages 1091 - 1095 |
| TETRAHEDRON, vol. 42, 1986, pages 2931 - 2935 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024258919A1 (en) * | 2023-06-13 | 2024-12-19 | Deciphera Pharmaceuticals, Llc | Dual raf and tubulin inhibitors and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022405115A1 (en) | 2024-07-11 |
| US20230357179A1 (en) | 2023-11-09 |
| EP4444430A1 (en) | 2024-10-16 |
| CA3240192A1 (en) | 2023-06-15 |
| TW202342442A (zh) | 2023-11-01 |
| CN119585242A (zh) | 2025-03-07 |
| JP2024546107A (ja) | 2024-12-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3983081A1 (en) | Aminopyrimidine amide autophagy inhibitors and methods of use thereof | |
| AU2022405116A1 (en) | Raf kinase inhibitors and methods of use thereof | |
| EP4444430A1 (en) | Raf kinase inhibitors and methods of use thereof | |
| AU2023333913A1 (en) | Ulk inhibitors and methods of use thereof | |
| US20250206729A1 (en) | Dual raf and tubulin inhibitors and methods of use thereof | |
| EP4444427A1 (en) | Heterocyclic compounds as kit kinase inhibitors | |
| WO2024258919A1 (en) | Dual raf and tubulin inhibitors and methods of use thereof | |
| WO2024258917A1 (en) | Dual raf and tubulin inhibitors and methods of use thereof | |
| EP4727922A1 (en) | Dual raf and tubulin inhibitors and methods of use thereof | |
| WO2024249493A2 (en) | Gcn2 and perk kinase modulators and methods of use thereof | |
| WO2025166161A1 (en) | Ulk inhibitors and methods of use thereof | |
| TW202545939A (zh) | Ulk抑制劑及其使用方法 | |
| WO2025166180A1 (en) | Ulk inhibitors and methods of use thereof | |
| CN117321037A (zh) | Gcn2和perk激酶抑制剂及其使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22847085 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3240192 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2024534260 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024011562 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022405115 Country of ref document: AU Ref document number: AU2022405115 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202491448 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022847085 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022847085 Country of ref document: EP Effective date: 20240709 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280091224.0 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024011562 Country of ref document: BR Free format text: APRESENTE NOVAS FOLHAS DAS REIVINDICACOES CONTENDO A EXPRESSAO ?CARACTERIZADO POR? SOMENTE UMA VEZ POR REIVINDICACAO, CONFORME ART. 17 INCISO III DA INSTRUCAO NORMATIVA/INPI/NO 31/2013, UMA VEZ QUE A EXISTENTE DA PETICAO NO 870240048487 DE 07/06/2024 POSSUI A EXPRESSAO CITADA MAIS DE UMA VEZ NA MESMA REIVINDICACAO NO 89. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| ENP | Entry into the national phase |
Ref document number: 112024011562 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240607 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202280091224.0 Country of ref document: CN |