WO2023094435A1 - New tale protein scaffolds with improved on-target/off-target activity ratios - Google Patents

New tale protein scaffolds with improved on-target/off-target activity ratios Download PDF

Info

Publication number
WO2023094435A1
WO2023094435A1 PCT/EP2022/082950 EP2022082950W WO2023094435A1 WO 2023094435 A1 WO2023094435 A1 WO 2023094435A1 EP 2022082950 W EP2022082950 W EP 2022082950W WO 2023094435 A1 WO2023094435 A1 WO 2023094435A1
Authority
WO
WIPO (PCT)
Prior art keywords
tale
seq
sequence
nuclease
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2022/082950
Other languages
English (en)
French (fr)
Inventor
Philippe Duchateau
Alexandre Juillerat
Alex BOYNE
Selena KAZANCIOGLU
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cellectis SA
Original Assignee
Cellectis SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cellectis SA filed Critical Cellectis SA
Priority to AU2022395500A priority Critical patent/AU2022395500A1/en
Priority to KR1020247020471A priority patent/KR20240110844A/ko
Priority to JP2024530470A priority patent/JP2024540639A/ja
Priority to MX2024006051A priority patent/MX2024006051A/es
Priority to IL312721A priority patent/IL312721A/en
Priority to CN202280077915.5A priority patent/CN118382695A/zh
Priority to CA3238700A priority patent/CA3238700A1/en
Priority to US18/712,640 priority patent/US20250002945A1/en
Priority to EP22821976.2A priority patent/EP4437091A1/en
Publication of WO2023094435A1 publication Critical patent/WO2023094435A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/09Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries

Definitions

  • the present invention relates to the design of improved TALE protein fusions useful as sequence-specific genomic reagents displaying higher on-target/off-target activity ratios. Its goal is to produce safer reagents to genetically modify the genomes of different types of cells, especially mammalian cells, in particular for their use in gene therapy.
  • TALE transcription-activator-like effectors
  • TALE binding is driven by a series of 33 to 35 amino-acid-long repeats that differ at essentially two positions, the so-called repeat variable dipeptide (RVD).
  • RVD repeat variable dipeptide
  • Each base of one strand in the DNA target is contacted by a single repeat, with predictable specificity resulting from the linear arrangement of RVDs.
  • the biochemical structure-function studies suggest that the amino acid present at position 13 uniquely identifies a nucleotide on the DNA target major groove [Deng D., et al. (2012) Structural basis for sequence-specific recognition of DNA by TAL effectors. Science 335:720-723; Stella S., et al. (2013) Structure of the AvrBs3-DNA complex provides new insights into the initial thymine-recognition mechanism.
  • TALE Transcription activator-like effector
  • TALE DNA-binding scaffold specificity via modular assembly in order to form different associations of TALE proteins with various enzymatic domains, such as transcriptional activators, repressors, base editors or nucleases with potential ability to act on genomic sequences [Voytas et al. (2011) TAL effectors: Customizable proteins for DNA targeting. Science 333(6051): 1843-6], In comparison to Zine- Finger protein fusions, TALE-proteins have significantly emerged as critical DNA-binding scaffolds governed by a simple cipher without significant restrictions.
  • TALE protein fusions may result in TALE Artificial transcription factors, which have been generated by the fusion of TALE with a 16 amino acid peptide (VP16) from herpes simplex virus as a transactivation domain [Zhang, F. et al. Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nature Biotechnol. 29:149-153], By contrast to zinc-fingers binding domains, which have encountered many off-target effects, TALE transcriptional activators are efficient transcription modulators with only 10.5 repeats with an effector module fused to the carboxyl terminal [Miller, J., et al. (2011) A TALE nuclease architecture for efficient genome editing. Nat Biotechnol. 29, 143-148], TALEs in the form of activators can also be used to control the gene expression in case of external stimuli like a chemical change, or optical stimulus in various organisms including plants and animals.
  • VP16 16 amino acid peptide
  • TALE repressors can be generated by the fusion of TALE with either Kruppel-associated box (KRAB), Sid4, or EAR-repression domain (SRDX) repressors [Cong L, et al. (2012) Comprehensive interrogation of natural TALE DNA-binding modules and transcriptional repressor domains. Nat Common 3(1):968],
  • TALE base editors can be generated by the fusion of TALE with deaminase, and sometimes, to other DNA repair proteins.
  • Base editor catalytic domains can introduce singlenucleotide variants at desired loci in DNA (nuclear or organellar) or RNA of both dividing and nondividing cells.
  • DNA base editors that directly induce targeted point mutations in DNA
  • RNA base editors that convert one ribonucleotide to another in RNA.
  • Currently available DNA base editors can be further categorized into cytosine base editors (CBEs), adenine base editors (ABEs), C-to-G base editors (CGBEs), dual-base editors and organellar base editors. For instance, Mok et al.
  • a bacterial cytidine deaminase toxin enables CRISPR-free mitochondrial base editing (2020) Nature. 583:631-637] recently developed a base editing approach using the bacterial cytidine deaminase toxin, DddAtox, to demonstrate efficient C-to-T base conversions in vitro.
  • DddAtox nontoxic halves fused to transcription activator-like effector (TALE) proteins, which can be custom-designed to recognize predetermined target DNA sequences, form a functional cytosine deaminase within the editing window to induce C-to-T base editing at the target site in genomic DNA.
  • TALE transcription activator-like effector
  • DddA-TALE fusion deaminase constructs have since achieved mitochondrial DNA editing in mice [Lee, H., et al. (2021) Mitochondrial DNA editing in mice with DddA-TALE fusion deaminases. Nat Commun 12: 1190],
  • TALE nucleases can be generated by the fusion of TALE with various nuclease catalytic domains.
  • the popularly used TALEN® system which provides specific nucleases as a fusion of TALE scaffolds with the catalytic domain of the Fok1 restriction enzyme has proven to be very specific through many studies, as it combines two TALE dimers that bind together at the selected locus.
  • the TALEN heterodimers (right and left) generally bind on opposite strands at about IQ- 20 pb away from each other (spacer) to allow the nuclease Fok1 to dimerize and induce double strands cleavage between the binding sites within the spacer.
  • TALE-nucleases are currently developed as therapeutic grade nuclease reagents in gene therapy, especially to produce allogeneic CAR-T cells [Poirot et al. (2015) Multiplex Genome-Edited T-cell Manufacturing Platform for “Off-the-Shelf” Adoptive T-cell Immunotherapies Cancer Res 75(18):3853-3864; Quasim W. et al. (2017) Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells.
  • the classical TALEN monomer construct is generally based on truncated version of the TALE binding domain from the AvrBs3 protein fused to the catalytic domain of Fok1 , such as initially described by Voytas et al. in WO2011072246.
  • Such TALE-nuclease fusion protein typically comprises from 5’ to 3’: (1) truncated N-terminal region from AvrBs3 comprising at least the 150 amino acids that are proximal to the binding domain; (2) an engineered central DNA-binding domain which generally comprises between 12 to 28 repeats that are assembled to target a genomic nucleotide sequence; these selected repeats are followed by a wild type half repeat of only 20 amino acids from AvrBs3 designed to bind the 3'-end of the targeted DNA sequence; (3) a linker sequence of at least 40 amino acids from the C-terminal wild type region of AvrBs3 fused to (4) the wild type Fok1 nuclease catalytic domain, that In general the fusion protein further comprises AvrBs3’s nuclear localization signal (NLS) fused to the truncated N-terminal region.
  • NLS nuclear localization signal
  • TALE proteins have proven to be robust reagents for targeting genomic DNA sequences of interest in almost every cell types [Weeks D.P,. et al. Use of designer nucleases for targeted gene and genome editing in plants (2016) Plant Biotechnology Journal.14:483-495; Mussolino C. et al. (2014) TALENs facilitate targeted genome editing in human cells with high specificity and low cytotoxicity. Nucleic Acids Res 42(10):6762-6773],
  • the TALE proteins engineered according to this standard scheme are very similar to each other in terms of structure and sequence identity. Indeed, only amino acids in positions 12 and 13 of each repeat in the central DNA binding domain need to differ to adapt the scaffold to new target sequences.
  • TALE-nucleases for human gene therapy, standard TALE constructs do not always meet the specificity and efficiency levels required for therapeutic safety.
  • TALE scaffolds sometimes need further refinements to reduce potential off- target binding and increase their catalytic activity.
  • Previous methods consisting in including additional or non-conventional RVDs may not be sufficient in all situations. In fact, specificity and catalytic activity are often in balance and it may be difficult to find a good compromise that preserves safety and efficiency.
  • TALE scaffolds that combine different sets of mutations.
  • the resulting TALE fusion proteins based on these new scaffolds show a better specificity, while retaining most of their catalytic activities, and remain adaptable to any target sequence and RVD adjustment.
  • Their invention thus offers a platform for rational design of TALE catalytic proteins of higher therapeutic grade. Summary of the invention
  • the present invention aims at improving the specificity and/or activity of TALE fusion proteins which binding domain is generally based on the assembly of AvrBs3 repeats from original Xanthomonas genomic sequences.
  • the original AvrBs3 repeats of the TALE core binding domain have been fused with a C-terminal region consisting of a polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with the following SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4:
  • X1, X2 and X3 represent H (histidine) or R (arginine), preferably R.
  • X1, X2, and X3 can be identical or different.
  • said TALE core binding domain is fused to a N-terminal region, which preferably comprises or consists of a polypeptide sequence showing at least 85%, preferably at least 90%, more preferably at least 95% identity with SEQ ID NO:1.
  • said TALE core binding domain comprises AvrBs3- like repeats, such as those comprising a D (aspartic acid) amino acid substitution at position 4 (D4) and/or at position 32 (D32) in their polypeptide sequence.
  • said AvrBs3-like repeats comprise, or consist of, at least one of the following polypeptide sequences:
  • LTLDQVVAIAS X4X5GGKQALETVQRLLPVLCQDHG SEQ ID NO:11
  • X4X5 are the di-residues interacting with a given nucleotide base pair in the targeted sequence.
  • X4and Xs can be any amino acid or null (referred to as * (star) to designate a missing residue in the RVD).
  • X4and Xs can be identical or different.
  • the present invention also encompasses methods for producing or expressing TALE fusion proteins, such as TALE-nucleases, TALE-base editors or TALE-transcriptional modulators in a cell for targeting a genomic sequence.
  • the present invention provides methods for designing a TALE protein for introducing a genetic modification into a polynucleotide sequence, said method comprising the steps of: a) selecting a polynucleotide target sequence on which the genetic modification is intended; b) assembling polynucleotide sequences encoding AvrBs3-like repeat(s) to form a polynucleotide encoding a TALE-binding domain to bind said selected polynucleotide target sequence; c) fusing to said polynucleotide encoding the TALE-binding domain at least:
  • a polynucleotide sequence encoding a C-terminal domain consisting of a polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85%, preferably 90%, more preferably 95% and even more preferably 99% identity with SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4; X1, X2, X3 in these sequences representing R (arginine) or H (histidine); and optionally, d) fusing a polynucleotide sequence encoding a catalytic domain, such as a nuclease or a deaminase to the polynucleotide sequence encoding said C-terminal domain; e) fusing to the polynucleotide sequence encoding said N-terminal domain, a polynucleotide encoding a NLS (Nuclear Localization Signal), such as one listed in Table 1.
  • NLS Nuclear Localization Signal
  • the methods of the invention aim to produce polynucleotides encoding TALE fusion proteins, as well as the polypeptides resulting from their expression.
  • the TALE proteins according to the present invention generally display improved on- target/off-target activity ratios with respect to the targeted genomic sequence compared to TALE fusion proteins of the prior art
  • the method of the invention can further include steps wherein the new polynucleotide sequences are expressed in cells to obtain, for instance, cleavage, base substitution or transcriptional activation at a targeted genomic locus and compare its efficiency with other TALE proteins to select one with higher on-target/off-target activity ratio.
  • the method of the invention can also include steps, wherein at least one of said AvrBs3- like repeats is further mutated in 1 , 2, 3 and up to 5 amino acid positions in addition to the D4 and D32 substitutions.
  • the method of the invention can also include steps, wherein the C-terminal domain of the TALE protein is mutated to introduce 1 to 5 positively charged amino acids, such as lysine (K), arginine (R) or histidine (H), in addition to said X1, X2, and X3 positions referred to previously.
  • positively charged amino acids such as lysine (K), arginine (R) or histidine (H)
  • the method of the invention can also include an additional step, wherein amino acid substitutions are introduced in the catalytic domain of the TALE protein to enhance its catalytic activity.
  • the invention is drawn to recombinant transcriptional activatorlike Effector (TALE) proteins comprising one or several AvrBs3-like repeats, comprising generally from 8 to 20 repeats, preferably from 8 to 18, more preferably from 10 to 16, and alternatively from 5 to 12 repeats in situations where smaller genomes are considered, such as for instance mitochondrial genomes.
  • TALE transcriptional activatorlike Effector
  • TALE proteins according to the present invention combine RVD repeats preferably AvrBs3-like repeats comprising the above amino acid substitutions, along with a C-terminal sequence, such as SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4, and a N-terminal sequence comprising SEQ ID NO:1.
  • the recombinant core TALE proteins of the present invention are intended to be fused to a variety of catalytic domains as already described in the prior art (see WO2012138939), in particular catalytic domains from nucleases, such as Fok1 or Tev1 , deaminases, such as cytidine deaminase toxin, and transcriptional modulators, such as the trans-activator VP16.
  • nucleases such as Fok1 or Tev1
  • deaminases such as cytidine deaminase toxin
  • transcriptional modulators such as the trans-activator VP16.
  • the TALE protein of the invention is a TALE-nuclease that comprises a polypeptide sequence showing at least 85% identity, preferably at least 90%, more preferably at least 95%, even more preferably 99% identity with SEQ ID NQ:109, said polypeptide sequence corresponding to the catalytic domain of Fok-1 into which amino acid substitutions have been introduced to enhance the cleavage activity of the TALE-nuclease and improve its specificity.
  • TALE V2 TALE-Base editors and TALE-nucleases, directed to a gene locus selected from TCRalpha, B2m, PD1 , CTLA4, CISH, LAG3, TGFBRII, TIGIT, CD38, IgH, GADPH S100A9, PIK3CD, AAVS1 and CCR5, such as those listed in Tables 4 and 5.
  • the invention encompasses vectors comprising the polynucleotide sequences as well as the polypeptide sequences or reagents obtainable by the present invention, as well as their use for cell transformation and gene modification.
  • FIG. 1 Structure of an illustrative TALE-nuclease protein fusion as per the present invention.
  • Figure 2 Diagram comparing % indels (cleavage activity) obtained with VO, V0.1 and VO.2 TALE protein structures detailed in the examples.
  • Figure 3 Diagram comparing overall off-site cleavage as resulting from oligo capture analysis (OCA) obtained with VO and V0.1 TALE protein structures.
  • Figure 4 Diagrams comparing indels formation of V1 and V1.2 TALE proteins according to the invention with the canonical TALE structure VO.
  • Figure 5 Diagram showing the reduction of overall off-site cleavage using V1 and V1.2 TALE- protein structures according to the present invention (Oligo capture assay) as detailed in the examples.
  • Figure 6 Diagrams showing % indels obtained on-site (CS1 target sequence), and off-site (OS1 and OS2 loci) when alanine substitutions are introduced into the amino acid sequence of Fok1 (relative to wild type Fok1) at the position indicated in X axis.
  • Figure 7 Diagram showing on-site indels compared to WT Fok1 (black bars) and off-site indels fold decrease compared to WT and observed at OS1 (white bars) when using TALE-nuclease with best substituted positions introduced in the Fok1 catalytic domain.
  • Figure 8 Schematic representation of a TALE-base editor scaffold according to the present invention to inactivate the CD52 gene as described in Example 5.
  • FIG. 9 Histogram comparing % indels (cleavage activity) obtained with a TALE-nuclease targeting TGFBRII with either VO-VO, V1.2-V0, or V1.2-V1.2 heterodimeric structures at the on- target (on-site) or off-target sites (OT#).
  • V1.2 comprises the TALE structure according to the present invention as detailed in Example 6.
  • FIG. 10 diagrams showing the results of the Oligo Capture Assays (OCA) performed on the cells transfected with the TALE-nucleases V2 designed according to the present invention to target TIGIT.
  • OCA Oligo Capture Assays
  • Figure 11 diagrams showing the results of the Oligo Capture Assays (OCA) performed on the cells transfected with the TALE-nucleases V2 designed according to the present invention to target CISH (against three different target sequences 1 , 2 and 3).
  • OCA Oligo Capture Assays
  • Figure 12 diagrams showing the results of the Oligo Capture Assays (OCA) performed on the cells transfected with the TALE-nucleases V2 designed according to the present invention to target CD38 (against two different target sequences 1 and 2).
  • OCA Oligo Capture Assay
  • Figure 13 diagrams showing the results of the Oligo Capture Assays (OCA) performed on the cells transfected with the TALE-nucleases V2 designed according to the present invention to target IgH (against two different target sequences 1 and 2).
  • OCA Oligo Capture Assay
  • Figure 14 diagrams showing the results of the Oligo Capture Assays (OCA) performed on the cells transfected with the TALE-nucleases V2 designed according to the present invention to target GAPDH (against two different target sequences 1 and 2).
  • OCA Oligo Capture Assay
  • Figure 15 percentage of Indels measured on the cells transfected with the respective TALE- nucleases V2 according to the present invention that are presented in Example 7.
  • Table 2 Example of linkers that may be included in the TALE fusion proteins.
  • Table 4 Examples of TALE proteins according to the present invention useful in gene therapy or adoptive immune cells therapy
  • Table 5 Polypeptide sequences used in the examples.
  • Table 6 Polynucleotide sequences used in the examples.
  • the present invention has thus for object methods to design and produce TALE proteins that display reduced off-target DNA binding, which can be fused to various catalytic domains in view of forming highly specific and active TALE fusion proteins, in particular TALE-nucleases and TALE-base editors.
  • the invention provides methods for designing a TALE protein for introducing a genetic modification into a polynucleotide sequence, said method comprising one or several of the following steps: a) selecting a polynucleotide target sequence on which the genetic modification is intended; b) assembling polynucleotide sequences encoding AvrBs3-like repeat(s) to form a polynucleotide encoding a TALE-binding domain to bind said selected polynucleotide target sequence; c) fusing to said polynucleotide encoding the TALE-binding domain at least:
  • polynucleotide sequence encoding a C-terminal domain consisting of a polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85%, preferably 90%, more preferably 95% and even more preferably 99% identity with SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4; X1, X2, X3 in these sequences representing R (arginine) or H (histidine); and optionally,
  • the above steps can be performed in-silico and the final polynucleotide sequence synthetised or cloned according to methods well known in the art, such as explained for instance in WQ2013017950.
  • genetic modification is intended any enzymatic reaction voluntarily induced at a given locus, such as a mutation, methylation, transcriptional modulation, in view of obtaining an effect on gene expression.
  • the methods of the invention comprise one or several of the steps consisting of: a) selecting a cleavage site in a target polynucleotide sequence, such as into a genome, where cleavage is intended; b) selecting a polynucleotide sequence located between 5 and 25 bp upstream and/or downstream of said cleavage site; c) assembling polynucleotide sequences encoding AvrBs3-like repeat(s) to encode a TALE-binding domain to bind said selected polynucleotide sequence, wherein at least one AvrBs3-like repeat(s) comprises D substitutions at positions 4 (D4) and 32 (D32) in its polypeptide sequence, such as one sequence selected from SEQ ID NO:5 to 11 ; d) fusing said TALE-binding domain to at least (1) a polynucleotide sequence encoding a N-terminal domain, preferably comprising a sequence having at least
  • the present method can also comprise optional steps, wherein, for instance, the polynucleotide sequence that is fused to the TALE protein and encode the catalytic domain can be mutated to introduce amino acid substitutions into said catalytic domain.
  • This approach is exemplified in the experimental part of the present application, where amino acids have been substituted by alanine residues in the Fok1 catalytic domain (SEQ ID NO:109) with the effect of obtaining an optimal nuclease activity of a TALE-nuclease according to the invention.
  • Such individual substitutions in the Fok1 catalytic domain that have been found to decrease off-site activity are particularly those at positions 13, 52, 57, 59, 61 , 65, 84, 85, 88, 91 , 92, 95, 98, 103, 109, 110, 111 , 113, 119, 143, 148, 152, 158, 159, 160, 167, 169, 170 and 194 into SEQ ID NO: 109.
  • Preferred substitutions are at positions 84, 85, 88, 95, 98, 91 , 103, 109, 148, 152 and 158, and most preferred ones are in positions 84, 88, 91 , 103 and 152 into SEQ ID NO: 109.
  • TALE protein is meant herein a polypeptide that typically comprises a core DNA binding domain, which has at least 50%, preferably at least 60%, 70%, 80% or 90% identity with the DNA binding domain of wild-type AvrBs3 [also called TalC Uniprot - G7TLQ9], which represents the archetype of the family of transcription activator-like (TAL) effectors from phytopathogenic Xanthomonas campestris.
  • AvrBs3 also called TalC Uniprot - G7TLQ9
  • TAL transcription activator-like effectors from phytopathogenic Xanthomonas campestris.
  • Such DNA binding domain is characterized by repeated sequences of about 30 and 34 amino acids comprising variable di-residues usually found in positions 12 and 13.
  • a consensus sequence for these repeats, also called RVDs has been established for each targeted base A, C, G and T, which are respectively:
  • LTPQQWAIASHDGGKQALETVQRLLPVLCQQHG (SEQ ID NO:32) for targeting C; LTPQQWAIASNNGGKQALETVQRLLPVLCQQHG (SEQ ID NO:33) for targeting G; LTPQQWAIASNGGGKQALETVQRLLPVLCQQHG (SEQ ID NO:34) for targeting T.
  • AvrBs3-like repeats are meant artificial arrays of about 30 to 33 amino acids, which typically comprise variable di-residues in positions 12 and 13 interacting with A, C, G orT, similarly as the above consensus AvrBs3 repeats.
  • AvrBs3-like repeats are similar and can be combined with AvrBs3 repeats, but are generally not identical to the consensus or to the wildtype AvrBs3 repeats.
  • di-residues in positions 12 or 13 may be absent - so-called * (star) - to accommodate methylated bases in genomic DNA as described by [Valton et al. (2012) Overcoming Transcription Activator-like Effector (TALE) DNA Binding Domain Sensitivity to Cytosine Methylation. DNA and Chromosomes. 287(46):38427],
  • the AvrBs3-like repeats of the present invention generally display at least 60%, preferably at least 70%, 75%, 80%, 90% or 95% identity with either of the above AvrBs3 consensus repeats sequences of SEQ ID NO:31 to 34. They generally comprise D4 and D32 substitutions, such as in the following repeat sequences SEQ ID NO:5 to 11 of the present invention:
  • LTPDQWAIASX4X5GGKQALETVQRLLPVLCQDHG (SEQ ID NO:5), LTPDQWAIASX4X5GGKQALETVQALLPVLCQDHG (SEQ ID NO:6) LTPDQWAIASX4X5GGKQALETVQQLLPVLCQDHG (SEQ ID NO:7), LTPDQLVAIASX4X5GGKQALETVQRLLPVLCQDHG (SEQ ID NO:8), LTPDQMVAIASX4X5GGKQALETVQRLLPVLCQDHG (SEQ ID NO:9), LTPDQWAIASX4X5GGKQALETVQRLLPVLCQDQG (SEQ ID NO: 10), or LTLDQWAIASX4X5GGKQALETVQRLLPVLCQDHG (SEQ ID NO:11), wherein X4X5 are the di-residues interacting with a given nucleotide base pair
  • the AvrBs3-like repeats are generally represented by polypeptide sequences, in which X4 andXs are respectively Nl (to preferably target A), HD (to preferably target C), (to preferably target G) NN and NG (to preferably target T), such as in SEQ ID NO:24, 25, 26 and 27.
  • Identity throughout the present specification refers to sequence identity between two nucleic acid molecules or polypeptides. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base, then the molecules are identical at that position. A degree of similarity or identity between nucleic acid or amino acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences. Various alignment algorithms and/or programs may be used to calculate the identity between two sequences, including FASTA, or BLAST which are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default setting.
  • the present specification generally encompasses polypeptides and polynucleotides having at least 70%, 85%, 90%, 95%, 98% or 99% identity with the specific polypeptides and polynucleotides sequences described herein, exhibiting substantially the same functions or that can be considered as equivalents.
  • the invention also provides a recombinant transcriptional activatorlike Effector (TALE) protein comprising one or several AvrBs3-like repeats comprising D (aspartic acid) residues at positions 4 and 32, such as in the above polynucleotide sequences SEQ ID NO:5 to 11.
  • TALE transcriptional activatorlike Effector
  • AvrBs3-like repeats can be further mutated into 1 to 5 amino acid positions, including or in addition to the D4 and D32 positions.
  • Such recombinant transcriptional activatorlike Effector (TALE) proteins can comprise one or several of such repeats, to form polypeptides comprising generally from 8 to 20 repeats, preferably from 8 to 18, more preferably from 10 to 16, and alternatively from 5 to 12 repeats in situations where smaller genomes are considered, such as for instance mitochondrial genomes.
  • TALE transcriptional activatorlike Effector
  • variable di-residues (X4X5) present in the AvrBs3-like repeats and associated with recognition of the different nucleotides are generally HD for recognizing C, NG for recognizing T, Nl for recognizing A, NN for recognizing G or A, NS for recognizing A, C, G or T, HG for recognizing T, IG for recognizing T, NK for recognizing G, HA for recognizing C, ND for recognizing C, HI for recognizing C, HN for recognizing G, NA for recognizing G, SN for recognizing G or A and YG for recognizing T, TL for recognizing A, VT for recognizing A or G and
  • RVDs associated with recognition of the nucleotides C, T, A, G/A and G respectively are selected from the group consisting of NN or NK for recognizing G, HD for recognizing C, NG for recognizing T and Nl for recognizing A, TL for recognizing A, VT for recognizing A or G and SW for recognizing A. More generally, RVDs associated with recognition of nucleotide C are selected from the group consisting of N*, RVDs associated with recognition of the nucleotide T are selected from the group consisting of N* and H*, where * may denote a gap in the repeat sequence that corresponds to a lack of amino acid residue at the second position of the RVD.
  • X4X5can represent unusual or unconventional amino acid residues in order to modulate their specificity towards nucleotides A, T, C and G as described in Juillerat et al. [Optimized tuning of TALEN specificity using non-conventional RVDs (2015) Sci Rep 5:8150],
  • the core DNA binding domain generally comprises a half RVD made of 20 amino acids located at the C-terminus.
  • Said core DNA binding domain thus comprises between 8.5 and 30.5 RVDs, more preferably between 8.5 and 20.5 RVDs, and even more preferably, between 10,5 and 15.5 RVDs.
  • the core DNA binding domain as previously described preferably comprising RVDs bearing D4 and/or D32 substitutions, is flanked by N-terminal and C- terminal sequences, said N-terminal and C-terminal sequences having preferably one of the following features detailed below.
  • the N-terminal sequence is derived from the N-terminal domain of a naturally occurring TAL effector such as AvrBs3.
  • said additional N- terminus domain is the full-length N-terminus domain of a naturally occurring TAL effector N- terminus domain.
  • said additional N-terminus domain is a variant which allows overcoming sequence constraints associated with the so-called “RVD0” (i.e. first cryptic repeat), such as for instance the necessity to have a T required as the first base on the binding nucleic acid sequence.
  • said N-terminal sequence is derived from a naturally occurring TAL effector or a variant thereof.
  • said N-terminal sequence is a truncated N- terminus of such naturally occurring TAL effector or variant.
  • said additional domain is a truncated version of AvrBs3 TAL effector.
  • said truncated version lacks its N-terminal segment distal from the core TALEbinding domain, such as the first 152 N-terminal amino acids residues of the wild type AvrBs3, or at least the 152 amino acids residues.
  • said N-terminal sequence comprises a polypeptide sequence showing at least 85%, preferably at least 90%, more preferably at least 95% identity with SEQ ID NO:1.
  • the C-terminal sequence corresponds to a full or preferably truncated C-terminal region of a naturally occurring TAL effector such as AvrBs3.
  • said C-terminal sequence is a truncated version of AvrBs3 TAL effector, proximal to the core TALE binding domain, such as SEQ ID NO:28 (40 amino acids), SEQ ID NO:29 (50 amino acids) or SEQ ID NQ:30 (60 amino acids) or a natural variant thereof.
  • said C-terminal sequence generally comprises or consists of a polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with the below SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4:
  • X1, X2 and X3 represent an amino acid substitution introduced into the wild type AvrBs3 C-terminal polypeptide sequence, which is preferably R (arginine) or H (histidine) residue, most preferably R, instead of originally K.
  • X1, X2 and X 3 can be identical or different.
  • Said N-terminal sequence or C-terminal sequence can comprise a localization sequence (or signal) which allows targeting said chimeric protein toward a given organelle within an organism, a tissue or a cell.
  • localization signals are nuclear localization signals, chloroplastic localization signals or mitochondrial localization signals.
  • said additional N-terminus domain can comprise a nuclear export signal having the opposite effect of a nuclear localization signal to help targeting organelles such as chloroplasts or mitochondria.
  • additional C- terminus or N-terminus sequences with a combination of several localization signals are also encompassed additional C- terminus or N-terminus sequences with a combination of several localization signals.
  • NLS nuclear localization signal
  • tissuespecific signal to help addressing said fusion protein of the present invention in the nuclear of tissue specific cells.
  • a NLS is generally included in the N-terminal region of the TALE-protein.
  • a preferred NLS sequence comprises the polypeptide sequence SEQ
  • SEQ ID NO: 12 derived from SV40, SEQ ID NO: 13 derived from C-Myc or SEQ ID NO: 14 derived from nucleoplasmin.
  • TALE fusion protein is meant a TALE-protein which is linked to a polypeptide domain that confers a catalytic activity to said TALE protein.
  • a TALE fusion protein can be for instance a sequence-specific reagent that processes DNA at the locus specified by the TALE binding domain.
  • the fusion with the TALE protein can be made with the catalytic domain from an existing protein, such as a DNA processing enzyme, especially one having an activity selected from the group consisting of nuclease activity, polymerase activity, deaminase activity, kinase activity, phosphatase activity, methylase activity, topoisomerase activity, integrase activity, transposase activity, ligase activity, helicase activity, reverse transcriptase and recombinase activity.
  • an existing protein such as a DNA processing enzyme, especially one having an activity selected from the group consisting of nuclease activity, polymerase activity, deaminase activity, kinase activity, phosphatase activity, methylase activity, topoisomerase activity, integrase activity, transposase activity, ligase activity, helicase activity, reverse transcriptase and recombinase activity.
  • the TALE fusion protein according to the present invention can comprise a peptide linker to fuse the catalytic domain to said previously described core scaffold, or more preferably to link the C-terminal or N-terminal of said TALE protein to said catalytic domain.
  • linker is generally flexible.
  • said peptide linker can comprise a calmodulin domain that changes TALE fusion protein conformation under calcium stimulation.
  • Other protein domains inducing conformational changes under a specific metabolite interaction can also be used.
  • Such linker can comprise, for instance, a light sensitive domain that allows a change from a folded inactive state toward an unfolded active state under light stimulation, or reverse.
  • Other examples of “switch” linkers can be reactive to small molecules such as Chemical Inducers of Dimerization (CID).
  • a linker may not be necessary to fuse the TALE core binding domain with
  • the catalytic domain as the C-terminal sequences can have enough flexibility to achieve an optimal conformation of the TALE fusion protein.
  • the present invention encompasses TALE fusion proteins comprising a variety of functional domains, such as catalytic domains obtainable from different enzymes.
  • catalytic domains can be unspecific endonucleases such as for instance Fok-1 , clo51 or I-Tev1 , or specific0 endonuclease, such as engineered meganucleases (e.g. derived from I-Cre1 , I-Onu1 , I-Bmo1 , Hmul...), exonucleases such as human Trex2, transcription repressors (e.g.
  • KRAB transcription activators
  • VP64 or VP16
  • deaminases such as for example cytosine deaminase 1 (pCDM), adenosine deaminase, such as TadA ou TadA7.10, Apolipoprotein B mRNA editing enzyme catalytic polypeptide-like (APOBEC), Activation-induced cytidine5 deaminase (AICDA), DddA (double strand DNA cytidine deaminase) that may be associated to Uracil Glycosylase Inhibitors (UGI), nickases derived from Cas9 or Cpf1 , transposase, integrase, topoisomerase and reverse transcriptase (e.g. Moloney murine leukemia virus RT enzyme), their functional mutants, variants or derivatives thereof.
  • Uracil Glycosylase Inhibitors Uracil Glycosylase Inhibitors
  • Exemplary polypeptides sequences that can be included in the TALE fusion proteins of0 the present invention are listed in Table 3 (SEQ ID NO: 109 to 137).
  • Table 3 exemplary catalytic domains of the TALE proteins of the present invention j I
  • the TALE fusion protein according to the present invention comprises a catalytic domain that is a polypeptide comprising an amino acid sequence having at least 80%, preferably at least 90%, more preferably at least 95% identity with any of SEQ ID NO: 109 to 137.
  • TALE proteins have a well-defined DNA base-pair choice, offering a basic strategy for scientific researchers and engineers to design and construct TALE fusion proteins for genome alteration.
  • a TALE repeat tandem is responsible for recognizing individual DNA base pairs. Such tandem is made up of a pair of alpha helices linked by a loop of three-residue of RVDs in the shape of a solenoid.
  • RVDs For the creation of TALE proteins with variable precision and binding affinity, the six conventional RVDs (NG, HD, Nl, NK, NH, and NN) are frequently used. HD and NG are associated with cytosine (C) and thymine (T) respectively. These associations are strong and exclusive [Streubel J, et al.
  • NN is a degenerate RVD usually showing binding affinity for both guanine (G) and adenine (A), but its specificity for guanine is reported to be stronger.
  • RVD Nl binds with A and NK binds with G. These associations are exclusive but the binding affinity between these pairs is less due to which they are considered weak. Therefore, it is recommended to use RVD NH which binds with G with medium affinity. It is also worth noting that the binding affinity of TALE is influenced by the methylation status of the target DNA sequence.
  • the TALEN code is degenerate, which means that certain RVDs can bind to multiple nucleotides with a diverse spectrum of efficiency.
  • the binding ability of the NN (for A and G) and NS (A, C, and G) repeat variable di-residue empowers the TALE proteins to encode degeneracy for the target DNA. This degeneracy may although be useful in targeting hyper variable sites.
  • TALE proteins technology is the only known genome editing tool which can be engineered in a way that can be easily used for the escape mutations in a genome. This unique feature make them a more flexible and reliable tool in the field of genome editing specifically in clinical applications to tolerate predicted mutations [Strong CL, et al. (2015) Damaging the integrated HIV proviral DNA with TALENs. PLoS One 10(5):e0125652.]
  • a typical TALE protein usually consists of 18 repeats of 34 amino acids.
  • a TALEN pair must bind to the target site on opposite sides, separated by a “spacer” of 14-20 nucleotides as an offset since Fokl requires dimerization for operation. As a whole, such a long (approximately 36 bp) DNA binding site is predicted to appear in genomes as being very rare.
  • highly specific TALE-nucleases can be produced according to the present invention allowing high degree of cleavage specificity and low cytotoxicity in diverse cell types, especially plant or mammalian cells.
  • the TALE-fusion protein of the present invention is a TALE-nuclease obtained by fusion of a TALE protein as described herein with the nuclease catalytic domain of a non-specific nuclease, such as Fok-1 (SEQ ID NO:109) or Tev-1 (SEQ ID NO:114) as described with classical TALE scaffolds for instance in Beurdeley, M. et al. [Compact designer TALENs for efficient genome engineering (2013) Nat Commun 4:1762],
  • said nuclease catalytic domain is Fok1 , i.e.
  • polypeptide showing at least 80% identity with SEQ ID NO.1 , and more preferably comprising at least one of the amino acid substitutions: 13, 52, 57, 59, 61 , 65, 84, 85, 88, 91 , 92, 95, 98, 103, 109, 110, 111 , 113, 119, 143, 148, 152, 158, 159, 160, 167, 169, 170 and 194 into SEQ ID NQ:109, as illustrated herein in the Examples.
  • Preferred substitutions are introduced at positions 84, 85, 88, 95, 98, 91 , 103, 109, 148, 152 and 158, and most preferred ones are in positions 84, 88, 91 , 103 and 152.
  • the TALE-fusion protein of the present invention is a TALE-nuclease obtained by fusion of a TALE protein as described herein with a nickase, in particular a Cas9 nickase.
  • Cas9 nickase are generally Cas9 proteins which are mutated in their RuvC or HNH domains, for instance by introducing mutations D10A in RuvC and H840A in HNH.
  • TALE-Cas9 nickase fusions are used by pairs as formerly described with classical TALE scaffolds by Guilinger, J., et al. [Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification (2014) Nat. Biotechnol. 32, 577-582],
  • the TALE-fusion protein of the present invention is a TALE- nuclease obtained by fusion of a TALE protein as described herein with a specific nuclease, preferably a customized rare-cutting endonuclease, such as a meganuclease variant.
  • said rare-cutting endonuclease can be a variant of LADLIDADG, such as l-crel or l-Onul, as previously described for instance in EP3320910 and EP3004338.
  • a TALE-nuclease has also the ability to efficiently manipulate mtDNA (mitochondrial DNA) as a treatment for treating human mitochondrial diseases triggered by mitochondrial pathogenic mutations.
  • mtDNA mitochondrial DNA
  • mitochondrial pathogenic mutations So called “Mito-TALEN” (mitochondrial-targeted TALENs) have been proven to be effectively treating human mitochondrial disorders affected by mtDNA mutations, such as Leber’s hereditary optic neuropathy, ataxia, neurogenic muscle fatigue, and retinal pigmentosa [Gammage, P.A., et al. (2016) Mitochondrial Genome Engineering: The Revolution May Not Be CRISPR-lzed.
  • TALE-nuclease as per the present invention are herein described to be used as therapeutic reagent to induce highly specific cleavage in a selection of genes in human cells, especially blood cells. More particularly, improved TALE nuclease reagents have been synthetized and tested pursuant to the present teachings in order to cleave gene targets in primary cells, especially in T-cells or NK cells, such as TCRalpha, B2m, PD1 , CTLA4, CISH, LAG3, TGFBRII, TIGIT, CD38, IgH, GADPH and CCR5.
  • TALE proteins obtained as per the present invention, as well as their target sequences (polynucleotide sequence spanning the two left and right heterodimeric binding sites) are listed in Table 4 and 5 below, as well as in Tables 5 and 6 in the example section. Table 4: Examples of TALE proteins useful in therapy
  • the TALE-proteins of the present invention can be used by pairs, each member of this pair binding DNA close to each other, side-by-side or on opposite DNA strands, in such a way they are co-localized in the genome with the effect of directing the catalytic activity induced by the catalytic domain at a specified locus.
  • a pair of TALE- proteins fused to the homodimerizing Fok1 nuclease domain also referred to as “left-” and “right- ” TALE-Nuclease monomers, form heterodimers that induce DNA double strand break cleavage.
  • the invention provides that one monomer as per the present invention can be used with another monomer that is based on a conventional TALE-Nuclease scaffold using canonical AvrBs3 sequences. Indeed, as shown in the experimental section herein, one TALE- nuclease monomer of the present invention is sufficient to have an overall effect on the heterodimeric specificity.
  • the present invention thus provides a number of new TALE fusion monomers based on the TALE-proteins listed in Table X, comprising such proteins fused with a nuclease or deaminase domain, for their use in genetic therapeutic modifications, in-vivo or in-vitro, as well as for the ex- vivo preparation of therapeutic cells.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CTLA4 gene locus, preferably into a target sequence comprising SEQ ID NO:231 , wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:138 or SEQ ID NO:139 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:174, and SEQ ID NO:175.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CISH gene locus, preferably into a target sequence comprising SEQ ID NO:232, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NQ:140 or SEQ ID NO:141 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:176, and SEQ ID NO:177.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the LAG3 gene locus, preferably into a target sequence comprising SEQ ID NO:233, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 142 or SEQ ID NO: 143 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:178, and SEQ ID NO:179.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the TGFBRII gene locus, preferably into a target sequence comprising SEQ ID NO:234, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 144 or SEQ ID NO: 145 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NQ:180, and SEQ ID NO:181.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CCR5 gene locus, preferably into a target sequence comprising SEQ ID NO:235, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 146 or SEQ ID NO: 147 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:182, and SEQ ID NO:183.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the B2m gene locus, preferably into a target sequence comprising SEQ ID NO:236 or SEQ ID NO:237 , wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:148, SEQ ID NO:149, SEQ ID NQ:150 or SEQ ID NO:151.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:184, SEQ ID NO:185, SEQ ID NO:186 and SEQ ID NO:187.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the TCRalpha gene locus, preferably into a target sequence comprising SEQ ID NO:238, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 152 or SEQ ID NO: 153 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:188, and SEQ ID NO:189
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the PD1 gene locus, preferably into a target sequence comprising SEQ ID NO:239, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:154 or SEQ ID NO:155 .
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NQ:190, and SEQ ID NO:191.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the PIK3CDex8 gene locus, preferably into a target sequence comprising SEQ ID NO:240, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:156 or SEQ ID NO:157.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:192, and SEQ ID NO:193.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the PIK3CDex17 gene locus, preferably into a target sequence comprising SEQ ID NO:241 , wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:158 or SEQ ID NO:159.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO: 194, and SEQ ID NO: 195.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the S100A9 gene locus, preferably into a target sequence comprising SEQ ID NO:242, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 160 or SEQ ID NO: 161.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:196, and SEQ ID NO:197.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the AAVS1 gene locus, preferably into a target sequence comprising SEQ ID NO:243, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 162 or SEQ ID NO: 163.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NO:198, and SEQ ID NO:199.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CD52 gene locus, preferably into a target sequence comprising SEQ ID NO:244, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO: 164 or SEQ ID NO: 165.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NQ:200, and SEQ ID NQ:201.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the TCR alpha gene locus, preferably into a target sequence comprising SEQ ID NO:245, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:166 or SEQ ID NO:167.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence selected from SEQ ID NQ:202, and SEQ ID NQ:203.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the TGFBRII gene locus, preferably into a target sequence comprising SEQ ID NO:246, 247 or 248, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • Said TALE-protein preferably comprises SEQ ID NO:168, SEQ ID NO:169, SEQ ID NQ:170, SEQ ID NO:171 , SEQ ID NO:172 or SEQ ID NO:173.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence at least 90%, preferably 95% or 99% identity with a sequence respectively selected from SEQ ID NQ:204, SEQ ID NQ:205, SEQ ID NQ:206, SEQ ID NQ:207, SEQ ID NQ:208 and SEQ ID NQ:209.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the TIGIT gene locus, preferably into a target sequence comprising or consisting of SEQ ID NO:289, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • the invention provides TALE-nuclease monomers, consisting of or comprising a polypeptide sequence having at least 90%, preferably 95% or 99% identity with SEQ ID NO:269 and/or SEQ ID NQ:270.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CISH gene locus, preferably into a target sequence comprising or consisting of SEQ ID NQ:290, 291 and/or 292, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • the invention provides with TALE-nuclease monomers, consisting of or comprising a polypeptide sequence having at least 90%, preferably 95% or 99% identity with SEQ ID NO:271 , SEQ ID NO:272, SEQ ID NO:273, SEQ ID NO:274, SEQ ID NO:275 and/or SEQ ID NO:276.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the CD38 gene locus, preferably into a target sequence comprising or consisting of SEQ ID NO:293 and/or SEQ ID NO:294, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • the invention provides with TALE-nuclease monomers, consisting of or comprising a polypeptide sequence having at least 90%, preferably 95% or 99% identity with SEQ ID NO:277, SEQ ID NO:278, SEQ ID NO:279, and/or SEQ ID NQ:280.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the IgH gene locus, preferably into a target sequence comprising or consisting of SEQ ID NO:295 and/or SEQ ID NO:296, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • the invention provides with TALE-nuclease monomers, consisting of or comprising a polypeptide sequence having at least 90%, preferably 95% or 99% identity with SEQ ID NO:281 , SEQ ID NO:282, SEQ ID NO:283, and/or SEQ ID NO:284.
  • the invention provides TALE-protein monomers to introduce a genetic modification, preferably a mutation, into the GADPH gene locus, preferably into a target sequence comprising or consisting of SEQ ID NO:297 and/or SEQ ID NO:298, wherein said TALE protein comprises (1) a TALE binding domain comprising at least 3, preferably at least 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 repeats comprising SEQ ID NO:5 to 11 and (2) a C-terminal polypeptide sequence from 40 to 80 residues comprising a sequence having at least 85% identity with SEQ ID NO:2, 3 or 4.
  • the invention provides with TALE-nuclease monomers, consisting of or comprising a polypeptide sequence having at least 90%, preferably 95% or 99% identity with SEQ ID NO:285, SEQ ID NO:286, SEQ ID NO:287, and/or SEQ ID NO:288.
  • “mutation” is meant herein any change of one or more nucleotide in a characterized polynucleotide sequence (wild type), generally into a genomic sequence into a cell, said change including the deletion or substitution of said nucleotide (or base pair), the deletion insertion, integration or translocation of a polynucleotide fragment, oligonucleotide, or exogenous sequence, such as a transgene.
  • Such mutation generally leads to a correction, loss or gain of function by the cell, which genome is modified.
  • the TALE proteins according to the invention can also be fused to desired transcriptional activator and repressor protein domains to create specific trans-activator or repressor reagents in view of controlling endogenous gene expression.
  • artificial transcription factors can be obtained by fusion of a TALE protein of the present invention with VP64 or the 16 amino acid peptide VP16 (SEQ ID NO: 120) from herpes simplex virus as described by Miller J. C., et al. [A TALE nuclease architecture for efficient genome editing (2011) Nat Biotechnol 29(2): 143-148],
  • the TALE proteins of the present invention can be fused for example with Kruppel-associated box (KRAB), Sid4, or EAR-repression domain (SRDX), which have been previously reported as being strong pleiotropic repressors [Cong L, et al. (2012) Comprehensive interrogation of natural TALE DNA-binding modules and transcriptional repressor domains. Nat Commun 3(1 ):968].
  • KRAB Kruppel-associated box
  • Sid4 Sid4
  • SRDX EAR-repression domain
  • the TALE proteins according to the invention can also be fused to desired base editors.
  • base editor refers to a catalytic domain capable of making a modification to a base (e.g ., A, T, C, G, or U) within a nucleic acid sequence that converts one base to another (e.g., A to G, A to C, A to T, C to T C to G, C to A, G to A, G to C, G to T, T to A, T to C, T to G).
  • Adenine and cytosine base editors catalytic domains are described, for instance, in Rees & Liu [Base editing: precision chemistry on the genome and transcriptome of living cells (2016) Nat. Rev. Genet.
  • Catalytic base editors can include cytidine deaminase that convert target C/G to T/A and adenine base editors that convert target A/T to G/C.
  • Preferred cytosine deaminase can be cytosine deaminase 1 (pCDM) or Activation-induced cytidine deaminase (AICDA).
  • Preferred adenosine deaminase can be TadA (SEQ ID NO:121) or its variant TadA7.10 as described by Jeong, Y.K., et al. [Adenine base editor engineering reduces editing of bystander cytosines (2021) Nat. Biotechnol.
  • Apolipoprotein B mRNA editing enzyme family can be used convert cytidines to thymidines, such as the murine rAPOBECI and the human APOBEC3G (SEQ ID NO:130) as developed by Lee et al. [Single C-to-T substitution using engineered APOBEC3G-nCas9 base editors with minimum genome- and transcriptome-wide off-target effects (2020) Science Advances. 6(29)].
  • base editor catalytic domain converts a C to T (cytidine deaminase) that catalyzes the chemical reaction “cytosine + H2O -> uracil + NH3” or “5-methyl- cytosine + H2O -> thymine + NH3.”
  • C to T cytidine deaminase
  • cytosine + H2O -> uracil + NH3 or “5-methyl- cytosine + H2O -> thymine + NH3.”
  • the TALE-base editors according to the present invention can comprise a domain that inhibits uracil glycosylase referred to as “UGI”, and/or a nuclear localization signal.
  • uracil glycosylase inhibitor or “UGI,” as used herein, refers to a protein that is capable of inhibiting a uracil-DNA glycosylase base-excision repair enzyme.
  • a UGI domain comprises a wild-type UGI or a canonical UGI as set forth in SEQ ID NO:136.
  • the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment comprising an amino acid sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, of the amino acid sequence as set forth in SEQ ID NO: 136.
  • TALE base editors according to the present invention comprising UGI are useful to improve the specificity of base editing performed at a predetermined locus.
  • the base editor catalytic domain is a double- stranded DNA deaminase (“DddA”) to precisely install nucleotide changes and/or correct pathogenic mutations, rather than destroying DNA with double-strand breaks (DSBs).
  • DddAtox is generally split into inactive fragments which can be separately delivered to a target deamination site on separate TALE-base editor constructs that will co-localize each fragment of the DddA on site, such as on either side of a target edit site, where they reform a functional DddA that is capable deaminating a target site on the double-stranded DNA molecule.
  • the programmable DNA binding proteins can be engineered to comprise one or more mitochondrial localization signals (MLS), in such a way that the DddA domains become translocated into the mitochondria, thereby providing a means by which to conduct base editing directly on the mitochondrial genome.
  • MLS mitochondrial localization signals
  • Fragments of the DddA can be formed by truncating DddAtox (i.e. , dividing or splitting the DddA protein) at specified amino acid residues, such as one selected from the group comprising: 62, 71 , 73, 84, 94, 108, 110, 122, 135, 138, 148, and 155.
  • the truncation of DddA occurs at residue 148.
  • the DddA can be separated into two fragments by dividing the DddA at one of these split sites to form N-terminal and C- terminal portion of the DddA, which may be referred to as “DddA-N half’ and “DddA-C half.”.
  • said “DddA-N half” and “DddA-C half.” comprise an amino acid sequence that respectively share at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, with the amino acid sequence SEQ ID NO.134 and SEQ ID NO:135.
  • two TALE proteins acting by pairs respectively comprising N and C- DddA halves can be used to co-localize and induce on-site nucleobase change.
  • TALE-base editors of the present invention can also be used by pairs, each member comprising different but complementary catalytic domains in view of obtaining a given base editing reaction at one precise locus.
  • the TALE proteins according to the invention can also be fused to a transposase or an integrase in order to perform site-directed integration of transgenes into the genome.
  • the TALE protein according to the invention can be fused to the PiggyBac transposase as described for instance by Owens, J.B. et al. [Transcription activator like effector (TALE)-directed piggyBac transposition in human cells (2013) N.A.R. 41(19):9197-9207],
  • the PiggyBac transposase is autonomously functional in such system so that a co-transfected transposon is able to integrate into any genomic location specified by the TALE protein.
  • This system can permanently introduce large cassettes (>100 kb) encoding numerous components such as multiple transgenes, insulators and inducible or endogenous promoters and allows to potentially target integrations to nearly any genomic region.
  • Targeted transposition could be used to intentionally disrupt endogenous coding regions or to direct insertions to user-defined genomic safe harbours to protect the cargo from unknown chromosomal position effects and to circumvent accidental mutation of target cells.
  • TALE-protein fusions can be made by fusion with catalytic domains that can modulate the expression of a gene without altering the DNA sequence, especially by remodelling chromatin.
  • TALE proteins as per the present invention can be fused to methyltransferase obtain histone methylation and/or with a p300 effector domain that enhances histone acetyltransferase.
  • TALE protein can be fused to the catalytic domain thymidine DNA glycosylase (TDG) to abolish the DNA methylation and induce gene expression. Unwanted DNA methylations are associated with many neurodegenerative diseases. TALE protein could be fused to TET domain (ten-eleven translocation methylcytosine dioxygenase 2) as an example, for targeting epigenetically silenced cancer gene (ICAM-1) and induce its expression in cancerous cells. TET1 can also be used in the treatment of many diseases like diabetes (inducing p cell replication) and cancer (inhibiting cell proliferation) [Ou K., et al. (2019) Targeted demethylation at the CDKN1C/p57 locus induces human p cell replication. J Clin Invest 129(1):209-214],
  • the present invention encompasses the polynucleotides, in particular DNA or RNA encoding the polypeptides and proteins previously described, as well as any intermediary products involved in any aspects and steps of the methods described herein.
  • These polynucleotides may be included in vectors, more particularly plasmids or virus, in view of being expressed in prokaryotic or eukaryotic cells.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a “vector” in the present invention includes, but is not limited to, a viral vector, a plasmid, a RNA vector or a linear or circular DNA or RNA molecule which may consists of a chromosomal, non-chromosomal, semi-synthetic or synthetic nucleic acids.
  • Preferred vectors are those capable of autonomous replication (episomal vector) and/or expression of nucleic acids to which they are linked (expression vectors). Large numbers of suitable vectors are known to those of skill in the art and commercially available.
  • Viral vectors include retrovirus, adenovirus, especially AAV6 vectors, parvovirus (e. g. adenoassociated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e. g., influenza virus), rhabdovirus (e. g., rabies and vesicular stomatitis virus), paramyxovirus (e. g. measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e. g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.
  • parvovirus e. g. adenoassociated viruses
  • coronavirus e. g., negative strand RNA viruses
  • negative RNA viruses such as orthomyxovirus (e. g., influenza virus), rhabdovirus
  • viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
  • retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields, et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • the TALE proteins or polynucleotide encoding thereof, especially mRNA can also be loaded into nanoparticles for their effective delivery into cells.
  • nanoparticles are described in the art to target particular tissues of cell types [Friedman A.D. et al. (2013) The Smart Targeting of Nanoparticles Curr Pharm Des. 19(35): 6315-6329]
  • Preferred nanoparticles are positively charged nanoparticles, such as silica based nanoparticles or LNP (Lipid nanomolar nanoparticles) as described in the art with other types of nucleases [Conway, A. et al. (2019) Non-viral Delivery of Zinc Finger Nuclease mRNA Enables Highly Efficient In Vivo Genome Editing of Multiple Therapeutic Gene Targets, Molecular Therapy 27(4):866-877],
  • the polynucleotides encoding the present TALE proteins of the present invention can be electroporated directly into blood cells by electroporation, by using for instance the steps described in WO2013176915 on pages 29 and 30 incorporated herein by reference.
  • the present invention also relates to methods for use of said polypeptides polynucleotides and proteins previously described for various applications ranging from targeted nucleic acid cleavage to targeted gene regulation.
  • the efficiency of the nuclease fusion proteins as referred to in the present patent application e.g.
  • the present invention more particularly relates to a method for modifying the genetic material of a cell within or adjacent to a nucleic acid target sequence by using one TALE fusion protein of the present invention.
  • NHEJ non-homologous end joining
  • compositions comprising any of the various components of the TALE proteins obtainable by the methods of the present invention (e.g., TALE-nuclease, TALE-deaminase, TALE-transcriptase, TALE-methylase, TALE- transposase).
  • pharmaceutical composition refers to a composition formulated for pharmaceutical use.
  • the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
  • the pharmaceutical composition comprises additional agents (e.g. for specific delivery, increasing half-life, or other therapeutic compounds).
  • the pharmaceutical composition are provided as reagents to correct genetic deficiencies, which can be used in vivo or ex-vivo, especially in gene therapy.
  • the TALE proteins of the present invention are used to genetically modify blood cells ex-vivo, especially immune cells such as T-cells and NK cells, preferably primary cells to produce therapeutic cells for immunotherapy.
  • the pharmaceutical composition is formulated in accordance with routine procedures as a composition adapted for intravenous or subcutaneous administration to a subject (e.g., a human).
  • pharmaceutical composition for administration by injection are solutions in sterile isotonic aqueous buffer.
  • the pharmaceutical can also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection.
  • the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • the pharmaceutical is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
  • the pharmaceutical composition can be contained within a lipid particle or vesicle, such as a liposome or microcrystal, which is also suitable for parenteral administration.
  • the particles can be of any suitable structure, such as unilamellar or plurilamellar, so long as compositions are contained therein.
  • Compounds can be entrapped in “stabilized plasmid-lipid particles” (SPLP) containing the fusogenic lipid dioleoylphosphatidylethanolamine (DOPE), low levels (5-10 mol%) of cationic lipid, and stabilized by a polyethyleneglycol (PEG) coating (Zhang Y. P. et ah, Gene Ther. 1999, 6:1438-47).
  • SPLP stabilized plasmid-lipid particles
  • lipids such as N-[l-(2,3-dioleoyloxi)propyl]-N,N,N- trimethyl-amoniummethylsulfate, or “DOTAP,” are particularly preferred for such particles and vesicles.
  • DOTAP N-[l-(2,3-dioleoyloxi)propyl]-N,N,N- trimethyl-amoniummethylsulfate
  • the preparation of such lipid particles is well known. See, e.g., U.S. Patent Nos. 4,880,635; 4,906,477; 4,911 ,928; 4,917,951 ; 4,920,016; and 4,921 ,757; each of which is incorporated herein by reference.
  • the pharmaceutical composition described herein may be administered or packaged as a unit dose, for example.
  • unit dose when used in reference to a pharmaceutical composition of the present disclosure refers to physically discrete units suitable as unitary dosage for the subject, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect in association with the required diluent; i.e., carrier, or vehicle.
  • the pharmaceutical composition can be provided as a pharmaceutical kit comprising foir example: (a) a container containing a compound of the invention in lyophilized form; and (b) a second container containing a pharmaceutically acceptable diluent (e.g., sterile water) for injection.
  • a pharmaceutically acceptable diluent e.g., sterile water
  • the pharmaceutically acceptable diluent can be used for reconstitution or dilution of the lyophilized compound of the invention.
  • Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
  • Plasmids encoding the TALE-nuclease heterodimers are transformed into XL1 Blue competent bacteria according to standard molecular biology procedures. At least two colonies were picked as miniprep cultures from the agarose plate and DNA extracted via QIAprep 96 plus Miniprep kit according to the manufacturer’s protocol (Qiagen). Sequence validated plasmids were linearized using standard molecular biology techniques and purified using the Nucleospin Gel and PCR Clean-up kit (Macherey-Nagel).
  • mRNA was produced using the HiScribe T7 ARCA mRNA Kit according to the manufacturer’s protocol (NEB) and purified with Mag-Bind Total Pure NGS magnetic beads (Omega) on the KingFisher Flex System (Thermo Fisher Scientific) as per the manufacturer’s instructions.
  • Targeted PCR of the endogenous locus was performed using Phusion High Fidelity PCR Master Mix with HF Buffer (NEB) for amplification of a ⁇ 300bp region surrounding the TALE- nuclease cut on- PCR products were purified using the Mag-Bind Total Pure NGS magnetic beads (Omega) on the KingFisher Flex System (Thermo Fisher Scientific) as per the manufacturer’s instructions. Amplicons were further analyzed by deep-sequencing (Illumina).
  • Oligo capture assay was adapted from (Tsai et al., GUIDE-seq paper) and carried out on the Fluent Automation Workstation liquid handler robot (Tecan).
  • TALE-nucleases were co-electroporated with unspecific oligonucleotides amplifiable by PCR, cells were transferred in a 96w or 48w culture plate containing warm fresh warm culture medium incubated at 30°C/ 5% CO2 overnight. Cell were passaged in complete medium and kept at 37°C/ 5% CO2 for 2 days. Cells were pelleted by centrifugation and genomic DNA was extracted using the Mag-Bind Blood & Tissue DNA HDQ 96 Kit (Omega) on the KingFisher Flex System (Thermo Fisher Scientific) as per the manufacturer’s instructions.
  • TALE-nuclease activity was also improved in presence of both RR mutated TALE-nuclease heterodimers.
  • V1 arginine (R) mutations were further introduced in positions K37 and K38 into the C-terminal sequence, leading to V1.2 (SEQ ID NO:218 and SEQ ID NO:219).
  • a library of monomers of VO structure (SEQ ID NO:210) was created by substituting, one by one, each amino acid of the wild type Fokl catalytic domain (SEQ ID NO: 109) by an alanine.
  • TALE-nuclease activity resulting from the heterodimer formed by each of the substituted V0 monomers resulting and of the other untouched monomer of SEQ ID NQ:210 was assessed by indels formation on the “on-site” target (SEQ ID NO:228) and the 2 “off-sites” targets, OS1 and OS2 (SEQ ID NO:229 and SEQ ID NQ:230).
  • substitutions have been found to decrease indels formation, while maintaining the full nuclease activity, such as the substitutions introduced at positions 84, 85, 88, 95, 98, 91 , 103, 109, 148, 152 and 158, and even led to an increase of nuclease activity (more than 100% activity) at positions 84, 88 and 91.
  • Example 5 TALE-base editor to introduce a non-sense mutation into the CD52 gene
  • Polynucleotides sequences have been designed to target and convert 1 or more nucleobase C into T into the CD52 target sequences SEQ ID NO:249 to 252, also referred to in Table 6, in view of expressing the heterodimer structures that are illustrated in figure 8 aiming at disrupting a splice site or introducing a mutation into those target sequences and inactivate the surface presentation of CD52 in primary T-cells.
  • One polynucleotide sequence encodes a first monomer comprising a TALE protein fused to a NLS at its N-terminus and to the N-split DddA deaminase + UGI at its C-terminus (respectively SEQ ID NQ:220, SEQ ID NO:222, SEQ ID NO:224 and SEQ ID NO:226);
  • the other polynucleotide sequence encodes a second monomer comprising a TALE protein fused to a NLS at its N-terminus and to the C-split DddA deaminase + UGI at its C- terminus (respectively SEQ ID NO:221 , SEQ ID NO:223, SEQ ID NO:225 and SEQ ID NO:227).
  • polynucleotide sequences of the above TALE proteins were assembled using standard molecular biology technics using enzymatic restriction digestion, ligation and bacterial transformation. Integrity of all the polynucleotide sequences was assessed by Sanger sequencing.
  • polynucleotide sequences encoding the above monomers have been cloned into plasmids for production in adequate bacteria such as XL1-Blue.
  • Plasmids encoding the TALE-nuclease heterodimers are transformed into XL1 Blue competent bacteria according to standard molecular biology procedures. At least two colonies were picked as miniprep cultures from the agarose plate and DNA extracted via QIAprep 96 plus Miniprep kit according to the manufacturer’s protocol (Qiagen). Sequence validated plasmids were linearized using standard molecular biology techniques and purified using the Nucleospin Gel and PCR Clean-up kit (Macherey-Nagel).
  • mRNA was produced using the HiScribe T7 ARCA mRNA Kit according to the manufacturer’s protocol (NEB) and purified with Mag-Bind Total Pure NGS magnetic beads (Omega) on the KingFisher Flex System (Thermo Fisher Scientific) as per the manufacturer’s instructions.
  • human T lymphocytes were transfected by electroporation using an AgilePulse MAX system (Harvard Apparatus): cells were pelleted and resuspended in cytoporation medium T at >28x10 6 cells/ml. 5x10 6 cells were mixed with 10 pg total of indicated TALE-nuclease mRNA (5 ug each of the left and right monomers) into a 0.4 cm cuvette. In parallel, mock transfections (no mRNA) were performed. The electroporation consisted of two 0.1 ms pulses at 800 V followed by four 0.2ms pulses at 130V. Following electroporation, cells were split in half and diluted into 1.2mL fresh warm culture medium in separate plates and incubated at 30°C/ 5% CO2 overnight. Cell were passaged in complete medium and kept at 37°C/ 5% CO2 for 2 days.
  • Targeted PCR of the endogenous locus was performed using Phusion High Fidelity PCR Master Mix with HF Buffer (NEB) for amplification of a ⁇ 300bp region spanning the CD52 target sequence (SEQ ID NO:249, 250, 251 and 252) as per the manufacturer’s instructions. Amplicons were further analyzed by deep-sequencing (Illumina) for detection of mutational events (nucleobase conversion).
  • Example 6 Improved specificity of TALE-nuclease targeting TGFBRII gene sequence
  • a “classical” version (V0) of TALEN monomers targeting TGFBRII gene sequence was compared with an improved TALEN monomer version V1 .2 as per the present invention comprising the tandem DD-RR mutations and tested for its specificity by oligo capture assay.
  • mRNAs encoding the “classical” TALE-nucleases (V0) and DD-RR (V1.2) monomers targeting TGFBRII gene sequence SEQ ID NO:234 were by using the mMessage mMachine T7 Ultra kit (Life Technologies) and purified with RNeasy columns (Qiagen) and eluted in water or cytoporation medium T (Harvard Apparatus) as described in Poirot et al. [Cancer Res (2015) 75 (18): 3853-3864],
  • the heterodimeric pairs V0-V0, V0-V1.2 and V1.2-V1.2 were respectively coelectroporated with unspecific oligonucleotides amplifiable by PCR in order to perform oligo capture assay analysis at predicted off-site genomic locations. These predicted off-site locations had been previously identified with respect to the V0-V0 TALEN monomers.
  • Cryopreserved human PBMCs were cultured in X-vivo-15 media (Lonza Group), containing IL-2 (Miltenyi Biotech,), and human serum AB (Seralab).
  • Dynabeads Human T- Activator CD3/CD28 for T Cell Expansion and Activation were used, according to the provider’s protocol, to activate T-cells.
  • T lymphocytes were electroporated using an AgilePulse MAX system (Harvard Apparatus) with the different TALE-nuclease versions targeting the same TGFBRII target sequence (SEQ ID NO: 234).
  • the TALE-nuclease used were either containing no mutation (VO-VO) corresponding to SEQ ID NO:267 and SEQ ID NO:268, or were comprising one half TALE-nuclease containing the DD-RR mutations (V1.2-V0) corresponding to SEQ ID NO:181 and SEQ ID NO:268, or finally both half TALE-nuclease containing the DD-RR mutations (V1.2-V1.2) corresponding to SEQ ID NO:181 and SEQ ID NQ:180.
  • T-cells were pelleted and resuspended in cytoporation medium T and 10 6 cells were electroporated with 0.5pg of each indicated half TALE-nuclease.
  • the electroporation consisted of two 0.1 ms pulses at 800 V followed by four 0.2ms pulses at 130V. Following electroporation, cells were incubated at 30°C/ 5% CO2 for 18 hours. Cell were passaged in complete medium and kept at 37°C/ 5% CO2 for 1 day and expended for 18 days. Genomic DNA (gDNA) was extracted using Qiagen DNeasy blood & tissue kit according to manufacturer’s protocol. 200ng of gDNA were used for High fidelity PCR amplification of the on- and off- site loci using primers listed in Table 6. Amplicons were further analyzed by deep-sequencing (Illumina) to identify potential insertions at the predetermined off-site loci.
  • Illumina deep-sequencing
  • Example 7 TALE-nucleases designed under V1.2 targeting TIGIT, CISH, CD38, IgH and GADPH gene sequences
  • TALE-nucleases have been designed and tested for their specificity as described in Example 1 in order to target genomic sequences th respective TIGIT, CISH, CD38, IgH, and GADPH human genes.
  • the polynucleotide sequences targeted in these genes are presented in Table 6.
  • the polypeptide sequences of the left and right TALE-nuclease heterodimers are provided in Table 5.
  • Results of the oligo capture assays for each TALEN V2/target sequence couples are displayed in Figures 10 to 14, showing high specificity of the TALE scaffolds of the present invention and constantly high activit (% activity higher than 50%, mostly above 70% shown in figure 15).
  • Table 5 Polypeptide sequences used in the Examples

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Toxicology (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2022/082950 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios Ceased WO2023094435A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2022395500A AU2022395500A1 (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios
KR1020247020471A KR20240110844A (ko) 2021-11-23 2022-11-23 개선된 온-타겟/오프-타겟 활성 비율을 갖는 신규 tale 단백질 스캐폴드
JP2024530470A JP2024540639A (ja) 2021-11-23 2022-11-23 オンターゲット/オフターゲット活性比が改善された新規taleタンパク質スキャフォールド
MX2024006051A MX2024006051A (es) 2021-11-23 2022-11-23 Nuevos andamios de proteinas tale con relaciones de actividad en objetivo/fuera de objetivo mejoradas.
IL312721A IL312721A (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios
CN202280077915.5A CN118382695A (zh) 2021-11-23 2022-11-23 具有改进的靶上/靶外活性比的新的tale蛋白支架
CA3238700A CA3238700A1 (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios
US18/712,640 US20250002945A1 (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios
EP22821976.2A EP4437091A1 (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163282453P 2021-11-23 2021-11-23
US63/282,453 2021-11-23
DKPA202270104 2022-03-15
DKPA202270104 2022-03-15

Publications (1)

Publication Number Publication Date
WO2023094435A1 true WO2023094435A1 (en) 2023-06-01

Family

ID=84487474

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/082950 Ceased WO2023094435A1 (en) 2021-11-23 2022-11-23 New tale protein scaffolds with improved on-target/off-target activity ratios

Country Status (9)

Country Link
US (1) US20250002945A1 (cg-RX-API-DMAC7.html)
EP (1) EP4437091A1 (cg-RX-API-DMAC7.html)
JP (1) JP2024540639A (cg-RX-API-DMAC7.html)
KR (1) KR20240110844A (cg-RX-API-DMAC7.html)
AU (1) AU2022395500A1 (cg-RX-API-DMAC7.html)
CA (1) CA3238700A1 (cg-RX-API-DMAC7.html)
IL (1) IL312721A (cg-RX-API-DMAC7.html)
MX (1) MX2024006051A (cg-RX-API-DMAC7.html)
WO (1) WO2023094435A1 (cg-RX-API-DMAC7.html)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024055018A1 (en) * 2022-09-09 2024-03-14 Iovance Biotherapeutics, Inc. Processes for generating til products using pd-1/tigit talen double knockdown
WO2025181336A1 (en) 2024-03-01 2025-09-04 Cellectis Sa Compositions and methods for hbb-editing in hspc
WO2025211767A1 (ko) * 2024-04-02 2025-10-09 재단법인 아산사회복지재단 핵산 결합 단백질 및 ssda를 포함하는 융합단백질 및 이의 용도
WO2026046724A1 (en) 2024-08-30 2026-03-05 Cellectis Sa Tale protein scaffolds involving fusions of monopartite and bipartite nls

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
WO2011072246A2 (en) 2009-12-10 2011-06-16 Regents Of The University Of Minnesota Tal effector-mediated dna modification
WO2012138939A1 (en) 2011-04-05 2012-10-11 Philippe Duchateau New tale-protein scaffolds and uses thereof
WO2013017950A1 (en) 2011-07-29 2013-02-07 Cellectis High throughput method for assembly and cloning polynucleotides comprising highly similar polynucleotidic modules
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2014033556A2 (en) * 2012-09-03 2014-03-06 Cellectis Methods for modulating tal specificity
EP3004338A1 (en) 2013-05-31 2016-04-13 Cellectis SA A laglidadg homing endonuclease cleaving the t cell receptor alpha gene and uses thereof

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880635B1 (en) 1984-08-08 1996-07-02 Liposome Company Dehydrated liposomes
US4880635A (en) 1984-08-08 1989-11-14 The Liposome Company, Inc. Dehydrated liposomes
US4921757A (en) 1985-04-26 1990-05-01 Massachusetts Institute Of Technology System for delayed and pulsed release of biologically active substances
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (cg-RX-API-DMAC7.html) 1986-01-30 1990-11-27 Cetus Corp
US4920016A (en) 1986-12-24 1990-04-24 Linear Technology, Inc. Liposomes with enhanced circulation time
US4906477A (en) 1987-02-09 1990-03-06 Kabushiki Kaisha Vitamin Kenkyusyo Antineoplastic agent-entrapping liposomes
US4911928A (en) 1987-03-13 1990-03-27 Micro-Pak, Inc. Paucilamellar lipid vesicles
US4917951A (en) 1987-07-28 1990-04-17 Micro-Pak, Inc. Lipid vesicles formed of surfactants and steroids
WO2011072246A2 (en) 2009-12-10 2011-06-16 Regents Of The University Of Minnesota Tal effector-mediated dna modification
WO2012138939A1 (en) 2011-04-05 2012-10-11 Philippe Duchateau New tale-protein scaffolds and uses thereof
EP3320910A1 (en) 2011-04-05 2018-05-16 Cellectis Method for the generation of compact tale-nucleases and uses thereof
WO2013017950A1 (en) 2011-07-29 2013-02-07 Cellectis High throughput method for assembly and cloning polynucleotides comprising highly similar polynucleotidic modules
WO2013176915A1 (en) 2012-05-25 2013-11-28 Roman Galetto Methods for engineering allogeneic and immunosuppressive resistant t cell for immunotherapy
WO2014033556A2 (en) * 2012-09-03 2014-03-06 Cellectis Methods for modulating tal specificity
EP3004338A1 (en) 2013-05-31 2016-04-13 Cellectis SA A laglidadg homing endonuclease cleaving the t cell receptor alpha gene and uses thereof

Non-Patent Citations (57)

* Cited by examiner, † Cited by third party
Title
"Handbook Of Experimental Immunology", vol. I-IV, 1986, COLD SPRING HARBOR LABORATORY PRESS
Academic Press, Inc.; "Uniprot", Database accession no. G7TLQ9
B. PERBAL: "A Practical Guide To Molecular Cloning", 1984
BEURDELEY, M. ET AL.: "Compact designer TALENs for efficient genome engineering", NAT COMMUN, vol. 4, 2013, pages 1762
CANO-RODRIGUEZ D., ROTS M.G.: "Epigenetic editing: on the verge of reprogramming gene expression at will", CURR GENET MED REP, vol. 4, no. 4, 2016, pages 170 - 179, XP055460401, DOI: 10.1007/s40142-016-0104-3
CANTONI O. ET AL.: "Cytotoxic impact of DNA single vs double strand breaks in oxidatively injured cells", ARCH TOXICOL SUPPL, vol. 18, 1996, pages 223 - 235
CHRISTIAN ET AL.: "Targeting DNA Double-Strand Breaks with TAL Effector Nucleases", GENETICS, vol. 186, 2010, pages 757 - 761
COFFIN, J. M. ET AL.: "Fundamental Virology", 1996, LIPPINCOTT-RAVEN PUBLISHERS, article "Retroviridae: The viruses and their replication"
CONG L ET AL.: "Comprehensive interrogation of natural TALE DNA-binding modules and transcriptional repressor domains", NAT COMMUN, vol. 3, no. 1, 2012, pages 968, XP002700145, DOI: 10.1038/ncomms1962
CONWAY, A. ET AL.: "Non-viral Delivery of Zinc Finger Nuclease mRNA Enables Highly Efficient In Vivo Genome Editing of Multiple Therapeutic Gene Targets", MOLECULAR THERAPY, vol. 27, no. 4, 2019, pages 866 - 877, XP009517693, DOI: 10.1016/j.ymthe.2019.03.003
DATABASE Geneseq [online] 1 August 2013 (2013-08-01), "Xanthomonas sp. derived TALE monomer peptide, SEQ ID 356.", XP002807571, retrieved from EBI accession no. GSP:BAP69457 Database accession no. BAP69457 *
DATABASE Geneseq [online] 12 February 2015 (2015-02-12), "AvrBs3 derived half TALE repeat domain 5-terminal fragment, SEQ ID 45.", XP002807573, retrieved from EBI accession no. GSP:BBR47209 Database accession no. BBR47209 *
DATABASE Geneseq [online] 16 September 2021 (2021-09-16), "G1397 DddAtox-C protein sequence, SEQ ID 352.", XP002807572, retrieved from EBI accession no. GSP:BJS48908 Database accession no. BJS48908 *
DATABASE Geneseq [online] 22 March 2018 (2018-03-22), "TALE DNA-binding domain, SEQ ID 84.", XP002807570, retrieved from EBI accession no. GSP:BEY85580 Database accession no. BEY85580 *
DATABASE Geneseq [online] 6 December 2012 (2012-12-06), "Xanthomonas sp. AvrBs3 C-terminal domain sequence, SEQ ID 206.", XP002807569, retrieved from EBI accession no. GSP:BAD77059 Database accession no. BAD77059 *
DENG D. ET AL.: "Structural basis for sequence-specific recognition of DNA by TAL effectors", SCIENCE, vol. 335, 2012, pages 720 - 723
FREDERICK M. AUSUBEL: "Current Protocols in Molecular Biology", 2000, WILEY AND SON INC
FRIEDMAN A.D. ET AL.: "The Smart Targeting of Nanoparticles", CURR PHARM DES., vol. 19, no. 35, 2013, pages 6315 - 6329, XP055657670, DOI: 10.2174/13816128113199990375
GAMMAGE, P.A.: "Mitochondrial Genome Engineering: The Revolution May Not Be CRISPR-Ized", TRENDS IN GENETICS, vol. 34, no. 2, 2018, pages 101 - 110, XP055636339, DOI: 10.1016/j.tig.2017.11.001
GUILINGER, J. ET AL.: "Fusion of catalytically inactive Cas9 to Fokl nuclease improves the specificity of genome modification", NAT. BIOTECHNOL., vol. 32, 2014, pages 577 - 582, XP055157221, DOI: 10.1038/nbt.2909
HOCKEMEYER D ET AL.: "Genetic engineering of human pluripotent cells using TALE nucleases", NAT. BIOTECHNOL., vol. 29, no. 8, 2011, pages 731 - 734, XP037152052, DOI: 10.1038/nbt.1927
JEONG, Y.K. ET AL.: "Adenine base editor engineering reduces editing of bystander cytosines", NAT. BIOTECHNOL., 2021, Retrieved from the Internet <URL:https://doi.org/10.1038/s41587-021-00943>
JOHN P GUILINGER ET AL: "Broad specificity profiling of TALENs results in engineered nucleases with improved DNA-cleavage specificity", NATURE METHODS, vol. 11, no. 4, 16 February 2014 (2014-02-16), pages 429 - 435, XP055148794, ISSN: 1548-7091, DOI: 10.1038/nmeth.2845 *
JUILLERAT A ET AL.: "Optimized tuning of TALEN specificity using non-conventional RVDs", SCI REP, vol. 5, no. 1, 2015, pages 8150, XP055566162, DOI: 10.1038/srep08150
KAY S. ET AL.: "A bacterial effector acts as a plant transcription factor and induces a cell size regulator", SCIENCE, vol. 318, 2007, pages 648 - 651, XP009125817
LAUFER B.I. ET AL.: "Strategies for precision modulation of gene expression by epigenome editing: an overview", EPIGENETICS CHROMATIN, vol. 8, no. 1, 2015, pages 34
LEE, H.: "Mitochondrial DNA editing in mice with DddA-TALE fusion deaminases", NAT COMMUN, vol. 12, 2021, pages 1190, XP055929426, DOI: 10.1038/s41467-021-21464-1
LEE: "Single C-to-T substitution using engineered APOBEC3G-nCas9 base editors with minimum genome- and transcriptome-wide off-target effects", SCIENCE ADVANCES, vol. 6, no. 29, 2020
MILLER J.C. ET AL.: "A TALE nuclease architecture for efficient genome editing", NAT BIOTECHNOL, vol. 29, no. 2, 2011, pages 143 - 148, XP055568321, DOI: 10.1038/nbt.1755
MILLER, J. C. ET AL.: "A TALE nuclease architecture for efficient genome editing", NAT. BIOTECHNOL., vol. 29, 2011, pages 143, XP055568321, DOI: 10.1038/nbt.1755
MILLER, J. ET AL.: "A TALE nuclease architecture for efficient genome editing", NAT BIOTECHNOL., vol. 29, 2011, pages 143 - 148, XP055568321, DOI: 10.1038/nbt.1755
MOK ET AL.: "A bacterial cytidine deaminase toxin enables CRISPR-free mitochondrial base editing", NATURE, vol. 583, 2020, pages 631 - 637, XP037200062, DOI: 10.1038/s41586-020-2477-4
MOSCOU J.M. ET AL.: "A Simple Cipher Governs DNA Recognition by TAL Effectors", SCIENCE, vol. 326, 2009, pages 1501, XP002599998
MUSSOLINO C. ET AL.: "TALENs facilitate targeted genome editing in human cells with high specificity and low cytotoxicity", NUCLEIC ACIDS RES, vol. 42, no. 10, 2014, pages 6762 - 6773, XP055542508, DOI: 10.1093/nar/gku305
NING SUN ET AL: "SunnyTALEN: A second-generation TALEN system for human genome editing", BIOTECHNOLOGY AND BIOENGINEERING, JOHN WILEY, HOBOKEN, USA, vol. 111, no. 4, 11 December 2013 (2013-12-11), pages 683 - 691, XP071153703, ISSN: 0006-3592, DOI: 10.1002/BIT.25154 *
OU K. ET AL.: "Targeted demethylation at the CDKN1C/p57 locus induces human β cell replication", J CLIN INVEST, vol. 129, no. 1, 2019, pages 209 - 214
OWENS, J.B. ET AL.: "Transcription activator like effector (TALE)-directed piggyBac transposition in human cells", N.A.R., vol. 41, no. 19, 2013, pages 9197 - 9207
PIATEK AALENAGHAN SCNEAL STEWART C: "Advanced editing of the nuclear and plastid genomes in plants", PLANT SCI, vol. 273, 2018, pages 42 - 49, XP085406806, DOI: 10.1016/j.plantsci.2018.02.025
POIROT ET AL., CANCER RES, vol. 75, no. 18, 2015, pages 3853 - 3864
POIROT ET AL.: "Multiplex Genome-Edited T-cell Manufacturing Platform for ''Off-the-Shelf'' Adoptive T-cell Immunotherapies", CANCER RES, vol. 75, no. 18, 2015, pages 3853 - 3864, XP055568648, DOI: 10.1158/0008-5472.CAN-14-3321
QUASIM W. ET AL.: "Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells", SCIENCE TRANSLATIONAL MEDICINE, no. 9, 2017, pages 374
R. I. FRESHNEY: "Immunochemical Methods In Cell And Molecular Biology", 1987, COLD SPRING HARBOR LABORATORY
REESLIU: "Base editing: precision chemistry on the genome and transcriptome of living cells", NAT. REV. GENET., vol. 19, no. 12, 2018, pages 770 - 788
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
STELLA S. ET AL.: "Structure of the AvrBs3-DNA complex provides new insights into the initial thymine-recognition mechanism", ACTA CRYSTALLOGR SECT D BIOL CRYSTALLOGR, vol. 69, no. 9, 2013, pages 1707 - 1716
STREUBEL J ET AL.: "TAL effector RVD specificities and efficiencies", NAT BIOTECHNO/, vol. 30, no. 7, 2012, pages 593 - 595, XP002703655, DOI: 10.1038/nbt.2304
STREUBEL J ET AL.: "TAL effector RVD specificities and efficiencies", NAT BIOTECHNOL, vol. 30, no. 7, 2012, pages 593 - 595, XP002703655, DOI: 10.1038/nbt.2304
STRONG CL ET AL.: "Damaging the integrated HIV proviral DNA with TALENs", PLOS ONE, vol. 10, no. 5, 2015, pages e0125652, XP002752948, DOI: 10.1371/journal.pone.0125652
THOMAS O. AUER ET AL: "CRISPR/Cas9 and TALEN-mediated knock-in approaches in zebrafish", METHODS, vol. 69, no. 2, 1 April 2014 (2014-04-01), NL, pages 142 - 150, XP055277728, ISSN: 1046-2023, DOI: 10.1016/j.ymeth.2014.03.027 *
TSAI S. ET AL.: "CIRCLE-seq: a highly sensitive in vitro screen for genome-wide CRISPR-Cas9 nuclease off-targets", NAT METHODS, vol. 14, no. 6, 2017, pages 607 - 614, XP055424040, DOI: 10.1038/nmeth.4278
VALTON ET AL.: "Overcoming Transcription Activator-like Effector (TALE) DNA Binding Domain Sensitivity to Cytosine Methylation", DNA AND CHROMOSOMES, vol. 287, no. 46, 2012, pages 38427
VALTON J ET AL.: "Overcoming transcription activator-like effector (TALE) DNA binding domain sensitivity to cytosine methylation", J. BIOL. CHEM., vol. 287, no. 46, 2012, pages 38427 - 38432
VOYTAS ET AL.: "TAL effectors: Customizable proteins for DNA targeting", SCIENCE, vol. 333, no. 6051, 2011, pages 1843 - 6, XP055093385, DOI: 10.1126/science.1204094
WEEKS D.P ET AL.: "Use of designer nucleases for targeted gene and genome editing in plants", PLANT BIOTECHNOLOGY JOURNAL, vol. 14, 2016, pages 483 - 495, XP055456080, DOI: 10.1111/pbi.12448
WIENERT B ET AL.: "Unbiased detection of CRISPR off-targets in vivo using DISCOVER-Seq", SCIENCE, vol. 364, no. 6437, 2019, pages 286 - 289, XP055787709, DOI: 10.1126/science.aav9023
ZHANG Y. P., GENE THER., vol. 6, 1999, pages 1438 - 47
ZHANG, F. ET AL.: "Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription", NATURE BIOTECHNOL., vol. 29, pages 149 - 153, XP055005146, DOI: 10.1038/nbt.1775

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024055018A1 (en) * 2022-09-09 2024-03-14 Iovance Biotherapeutics, Inc. Processes for generating til products using pd-1/tigit talen double knockdown
WO2025181336A1 (en) 2024-03-01 2025-09-04 Cellectis Sa Compositions and methods for hbb-editing in hspc
WO2025211767A1 (ko) * 2024-04-02 2025-10-09 재단법인 아산사회복지재단 핵산 결합 단백질 및 ssda를 포함하는 융합단백질 및 이의 용도
WO2026046724A1 (en) 2024-08-30 2026-03-05 Cellectis Sa Tale protein scaffolds involving fusions of monopartite and bipartite nls

Also Published As

Publication number Publication date
EP4437091A1 (en) 2024-10-02
JP2024540639A (ja) 2024-10-31
CA3238700A1 (en) 2022-11-23
IL312721A (en) 2024-07-01
KR20240110844A (ko) 2024-07-16
AU2022395500A1 (en) 2024-05-23
MX2024006051A (es) 2024-06-26
US20250002945A1 (en) 2025-01-02

Similar Documents

Publication Publication Date Title
US20250002945A1 (en) New tale protein scaffolds with improved on-target/off-target activity ratios
US12378546B2 (en) Coupling endonucleases with end-processing enzymes drives high efficiency gene disruption
US11834686B2 (en) Engineered target specific base editors
CA2913871C (en) A laglidadg homing endonuclease cleaving the c-c chemokine receptor type-5 (ccr5) gene and uses thereof
EP3504327B1 (en) Engineered target specific nucleases
US20190247436A1 (en) Methods and compositions for modifying genomic dna
JP2020510439A (ja) シトシンからグアニンへの塩基編集因子
CA2868055C (en) Method to overcome dna chemical modifications sensitivity of engineered tale dna binding domains
WO2011101811A2 (en) Improved meganuclease recombination system
US20250320478A1 (en) Compositions and methods for epigenetic editing
WO2026046724A1 (en) Tale protein scaffolds involving fusions of monopartite and bipartite nls
CN118382695A (zh) 具有改进的靶上/靶外活性比的新的tale蛋白支架
JP2026510339A (ja) Pcsk9発現のエピジェネティック調節のための組成物及び方法
US20160138047A1 (en) Improved polynucleotide sequences encoding tale repeats
KR20260062951A (ko) 조작된 da 뉴런 세포를 위한 방법 및 조성물
HK1223373B (en) A laglidadg homing endonuclease cleaving the c-c chemokine receptor type-5 (ccr5) gene and uses thereof
HK40011095B (en) Engineered target specific nucleases
NZ791740A (en) Engineered target specific nucleases

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22821976

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 202417039342

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 3238700

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2024530470

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 18712640

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2022395500

Country of ref document: AU

Date of ref document: 20221123

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280077915.5

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 20247020471

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020247020471

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2022821976

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 11202403332S

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 2022821976

Country of ref document: EP

Effective date: 20240624