WO2023083906A2 - Pharmaceutical combinations for treatment of hbv - Google Patents

Pharmaceutical combinations for treatment of hbv Download PDF

Info

Publication number
WO2023083906A2
WO2023083906A2 PCT/EP2022/081355 EP2022081355W WO2023083906A2 WO 2023083906 A2 WO2023083906 A2 WO 2023083906A2 EP 2022081355 W EP2022081355 W EP 2022081355W WO 2023083906 A2 WO2023083906 A2 WO 2023083906A2
Authority
WO
WIPO (PCT)
Prior art keywords
dose
administered
pdl1
oligonucleotide
administering
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2022/081355
Other languages
English (en)
French (fr)
Other versions
WO2023083906A3 (en
Inventor
Souphalone LUANGSAY
Henrik Mueller
Johanna Marie Pose VICENTE
Malika AIT-GOUGHOULTE
Wouter Hendrik Pieter DRIESSEN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Hoffmann La Roche Inc
Original Assignee
F Hoffmann La Roche AG
Hoffmann La Roche Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202280074145.9A priority Critical patent/CN118284695A/zh
Application filed by F Hoffmann La Roche AG, Hoffmann La Roche Inc filed Critical F Hoffmann La Roche AG
Priority to IL312635A priority patent/IL312635A/en
Priority to AU2022384619A priority patent/AU2022384619A1/en
Priority to KR1020247015280A priority patent/KR20240101580A9/ko
Priority to CA3234478A priority patent/CA3234478A1/en
Priority to EP22817176.5A priority patent/EP4430184A2/en
Priority to MX2024005399A priority patent/MX2024005399A/es
Priority to JP2024527533A priority patent/JP2024544532A/ja
Publication of WO2023083906A2 publication Critical patent/WO2023083906A2/en
Publication of WO2023083906A3 publication Critical patent/WO2023083906A3/en
Priority to US18/659,831 priority patent/US20250263705A2/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1131Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/312Phosphonates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/312Phosphonates
    • C12N2310/3125Methylphosphonates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/315Phosphorothioates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/32Chemical structure of the sugar
    • C12N2310/3212'-O-R Modification
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/32Chemical structure of the sugar
    • C12N2310/3222'-R Modification
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/32Chemical structure of the sugar
    • C12N2310/323Chemical structure of the sugar modified ring structure
    • C12N2310/3231Chemical structure of the sugar modified ring structure having an additional ring, e.g. LNA, ENA
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/33Chemical structure of the base
    • C12N2310/334Modified C
    • C12N2310/33415-Methylcytosine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/35Nature of the modification
    • C12N2310/351Conjugate
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • C12N2320/31Combination therapy

Definitions

  • the present invention is directed to pharmaceutical combinations for treating hepatitis B virus (HBV) infection comprising administering at least two, preferably two or three, different HBV therapeutics.
  • HBV hepatitis B virus
  • the present invention relates to pharmaceutical combinations comprising an RNAi oligonucleotide targeting HBV and an anti-PDL1 antisense oligonucleotide.
  • HBV infection remains a major health problem worldwide which concerns an estimated 350 million chronic carriers. Approximately 25% of carriers can be predicted to die from chronic hepatitis, cirrhosis, or liver cancer. Hepatitis B virus is the second most significant carcinogen behind tobacco, causing from 60% to 80% of all primary liver cancer.
  • HBsAg hepatitis B surface antigen
  • HBsAg consists of three related polypeptides called S, M, and L encoded by overlapping open reading frames (ORF).
  • ORF open reading frames
  • S-ORF open reading frames
  • M and L are produced from upstream translation initiation sites and add 55 and 108 amino acids, respectively, to S.
  • HBV S, M, and L glycoproteins are found in the viral envelope of intact, infectious HBV virions, named Dane particles, and all three are produced and secreted in a vast excess that forms non-infectious subviral spherical and filamentous particles (both referred to as decoy particles) found in the blood of chronic HBV patients.
  • HBsAg The abundance of HBsAg on the surface of decoy particles is believed to inhibit humoral immunity and spontaneous clearance in patients with chronic HBV infection (CHB).
  • CHB chronic HBV infection
  • the current standard of care for chronic HBV infection is treatment with oral nucleos(t)ide analogues such as entecavir or tenofovir which provide suppression of HBV replication by inhibiting HBV DNA synthesis but do not act directly on viral antigens, such as HBsAg.
  • Nucleos(t)ide analogs even with prolonged therapy, only show low levels of HBsAg clearance.
  • patients with chronic hepatitis B exhibit very weak HBV T-cell responses and lack anti-HBs antibodies, which is believed to be one of the reasons that these patients are not able to clear the virus.
  • a clinically important goal is to achieve a functional cure of chronic HBV infection, defined as HBsAg seroconversion and serum HBV-DNA elimination. This is expected to result in a durable response thereby preventing development of cirrhosis and liver cancer, and prolonging survival.
  • chronic HBV infection cannot be eradicated completely due to the long term or permanent persistence of the viral genome as a covalently closed circular DNA (cccDNA) in the nuclei of infected hepatocytes.
  • cccDNA covalently closed circular DNA
  • a complete cure from chronic HBV infection would require the elimination of this cccDNA from infected hepatocytes.
  • pp 843 describes the current status in drug development aiming to achieve either a functional cure of HBV or a complete cure. This article highlights some of the more than 30 drugs that are currently being tested in HBV therapy, also mentioning that any effective treatment leading to a cure will probably require a combination of a virus targeting therapy and an immunotherapy.
  • Antisense oligonucleotides are essentially single stranded oligonucleotides capable of modulating expression of a target gene by hybridizing to a target nucleic acid.
  • Target modulation can be down-regulation via RNase H mediated degradation or by blockage of the transcription.
  • Antisense oligonucleotides can also up-regulate a target e.g. via splice switching or micro RNA repression.
  • GalNAc conjugation has proven very effective for delivering antisense oligonucleotides.
  • WO 2014/179627 and WO2015/173208 describe HBV treatment through degradation of HBV mRNA in hepatocytes using single stranded antisense oligonucleotides in combination with GalNAc conjugation.
  • WO2016/077321 describes HBV treatment through degradation of HBV mRNA in hepatocytes using double stranded siRNA in combination with GalNAc conjugation on the sense strand.
  • Various combination therapies including TLR7 agonists are briefly mentioned.
  • WO2017/157899 describes single-stranded LNA oligonucleotide conjugates for reducing PD-L1 expression.
  • WO2019/079781 describes RNAi therapeutics targeting HBsAg.
  • the present invention identifies novel pharmaceutical combinations of HBV therapeutics, which provide an advantage over monotherapy treatments.
  • the present invention identifies a novel pharmaceutical combination of an RNAi oligonucleotide targeting HBV and an anti-PDL1 antisense oligonucleotide, and advantageous dosage regimes thereof.
  • the specific combination of an RNAi oligonucleotide targeting HBV and an anti- PDL1 antisense oligonucleotide obtains a surprising, synergistic effect on HBV serum markers, beyond that which could be expected for these individual therapeutics alone. Summary of invention
  • the present invention provides pharmaceutical combinations comprising at least two HBV therapeutics.
  • a HBV therapeutic is any drug or treatment that is useful against HBV infection.
  • a HBV therapeutic may be in the form of an active ingredient, a prodrug, a composition, a conjugate or any other form that results in the realisation of the therapeutic effect of the drug when that form is administered to a patient.
  • the pharmaceutical combination comprises an RNAi oligonucleotide targeting HBV and an anti-PDL1 oligonucleotide.
  • the pharmaceutical combination comprises the RNAi oligonucleotide targeting HBV defined herein as Therapeutic T1 , and the anti-PDL1 antisense oligonucleotide defined herein as Therapeutic T2.
  • the present invention provides a composition comprising the pharmaceutical combination of the invention.
  • the RNAi oligonucleotide targeting HBV is comprised in a first composition and the anti- PDL1 antisense oligonucleotide is comprised in a second composition, optionally wherein any additional HBV therapeutic is comprised in a third composition.
  • the present invention provides a kit of parts comprising a first HBV therapeutic comprised in the pharmaceutical combination as defined herein and instructions for administration with a second HBV therapeutic comprised in the pharmaceutical combination as defined herein to treat a hepatitis B virus infection.
  • the kit comprises both or all HBV therapeutics comprised in the combination.
  • the present invention provides a use of the pharmaceutical combination, composition or kit of the invention for treating a hepatitis B virus infection.
  • the present invention provides the pharmaceutical combination, composition or kit of the invention, for use in medicine.
  • the present invention provides the pharmaceutical combination, composition or kit of the invention, for use in treatment of a hepatitis B virus infection.
  • the present invention provides a use of the pharmaceutical combination, composition or kit of the invention in the manufacture of a medicament.
  • the present invention provides a use of the pharmaceutical combination, composition or kit of the invention in the manufacture of a medicament for treating a hepatitis B virus infection.
  • the present invention provides a method for treating a hepatitis B virus infection comprising administering a therapeutically effective amount of the pharmaceutical combination, composition or kit of the invention to a subject infected with a hepatitis B virus infection.
  • the present invention provides a method of reducing expression of hepatitis B virus surface antigen in a cell, the method comprising delivering to the cell the pharmaceutical combination or composition of the invention.
  • the present invention further provides advantageous dosage regimes for administering the pharmaceutical combinations of the present invention.
  • Figure 1 shows the serum levels of HBsAg (panel A) and the change in HBsAg serum levels (panel B) during the course of the study herein.
  • FIG. 2 shows the serum levels of HBeAg (panel A) and the change in HBeAg serum levels (panel B) during the course of the study herein.
  • FIG. 3 shows the serum levels of HBV-DNA (panel A) and the change in HBV-DNA serum levels (panel B) during the course of the study herein.
  • Figure 4 shows the change in HBsAg, HBeAg and HBV-DNA serum levels during the course of the study herein, relative to Day 0 of the study.
  • HBV siRNA surrogate sT1
  • PDL1 LNA sT2.
  • the results for a study group that was administered a pharmaceutical combination of the invention (G10) are shown, in contrast with study groups that were administered a vehicle control (G1), an equivalent dose of the RNAi oligonucleotide targeting HBV as a monotherapy (G03) and an equivalent dose of the anti-PDL1 antisense oligonucleotide as a monotherapy (G06).
  • Figure 5 shows a particular, specific definition of Therapeutic T1 , the RNAi oligonucleotide targeting HBV to be used in preferred pharmaceutical combinations of the present invention.
  • Figure 6 shows the results of Example 2, including the change in serum HBsAg and HBV- DNA levels upon administration of an equivalent surrogate Therapeutic T 1 and Therapeutic T3 alone and in combination. A significant decrease in HBsAg and HBV-DNA is seen with the inventive combination of T1 and T3.
  • Figures 7 and 8 show the results of Example 3, including the change in serum HBsAg, HBV- DNA and HBeAg levels upon administration of an equivalent surrogate Therapeutic T 1 and T5 as defined in Example 3.
  • a significant decrease in serum markers is seen with the inventive combination of T1 and T5, in particular the combination significantly decreased serum levels of HBsAg and HBV-DNA during the T5 treatment period Day 21-33.
  • oligonucleotide as used herein is defined as it is generally understood by the skilled person as a molecule comprising two or more covalently linked nucleosides. Such covalently bound nucleosides may also be referred to as nucleic acid molecules or oligomers. Oligonucleotides are commonly made in the laboratory by solid-phase chemical synthesis followed by purification and isolation. When referring to a sequence of the oligonucleotide, reference is made to the sequence or order of nucleobase moieties, or modifications thereof, of the covalently linked nucleotides or nucleosides.
  • the oligonucleotide of the invention is man-made, and is chemically synthesized, and is typically purified or isolated.
  • the oligonucleotide of the invention may comprise one or more modified nucleosides or nucleotides, such as 2’ sugar modified nucleosides. Further, an oligonucleotide is a short nucleic acid, e.g., of less than 100 nucleotides in length. An oligonucleotide may be single-stranded or double-stranded. An oligonucleotide may or may not have duplex regions.
  • an oligonucleotide may be, but is not limited to, a small interfering RNA (siRNA), microRNA (miRNA), short hairpin RNA (shRNA), dicer substrate interfering RNA (dsiRNA), antisense oligonucleotide, short siRNA, or single-stranded siRNA.
  • a double-stranded oligonucleotide is an RNAi oligonucleotide.
  • synthetic refers to a nucleic acid or other molecule that is artificially synthesized (e.g., using a machine (e.g., a solid state nucleic acid synthesizer)) or that is otherwise not derived from a natural source (e.g., a cell or organism) that normally produces the molecule.
  • double-stranded oligonucleotide refers to an oligonucleotide that is substantially in a duplex form.
  • complementary base-pairing of duplex region(s) of a double-stranded oligonucleotide is formed between antiparallel sequences of nucleotides of covalently separate nucleic acid strands.
  • complementary base-pairing of duplex region(s) of a double-stranded oligonucleotide is formed between antiparallel sequences of nucleotides of nucleic acid strands that are covalently linked.
  • complementary base-pairing of duplex region(s) of a double-stranded oligonucleotide is formed from a single nucleic acid strand that is folded (e.g., via a hairpin) to provide complementary antiparallel sequences of nucleotides that base pair together.
  • a double-stranded oligonucleotide comprises two covalently separate nucleic acid strands that are fully duplexed with one another.
  • a double-stranded oligonucleotide comprises two covalently separate nucleic acid strands that are partially duplexed, e.g., having overhangs at one or both ends.
  • a doublestranded oligonucleotide comprises antiparallel sequences of nucleotides that are partially complementary, and thus, may have one or more mismatches, which may include internal mismatches or end mismatches.
  • strand refers to a single contiguous sequence of nucleotides linked together through internucleotide linkages (e.g., phosphodiester linkages, phosphorothioate linkages). In some embodiments, a strand has two free ends, e.g., a 5'- end and a 3'-end.
  • duplex in reference to nucleic acids (e.g., oligonucleotides), refers to a structure formed through complementary base-pairing of two antiparallel sequences of nucleotides.
  • an overhang refers to terminal non-base pairing nucleotide(s) resulting from one strand or region extending beyond the terminus of a complementary strand with which the one strand or region forms a duplex.
  • an overhang comprises one or more unpaired nucleotides extending from a duplex region at the 5' terminus or 3' terminus of a double-stranded oligonucleotide.
  • the overhang is a 3' or 5' overhang on the antisense strand or sense strand of a double-stranded oligonucleotide.
  • loop refers to a unpaired region of a nucleic acid (e.g., oligonucleotide) that is flanked by two antiparallel regions of the nucleic acid that are sufficiently complementary to one another, such that under appropriate hybridization conditions (e.g., in a phosphate buffer, in a cells), the two antiparallel regions, which flank the unpaired region, hybridize to form a duplex (referred to as a “stem”).
  • a nucleic acid e.g., oligonucleotide
  • RNAi oligonucleotide refers to either (a) a double stranded oligonucleotide having a sense strand (passenger) and antisense strand (guide), in which the antisense strand or part of the antisense strand is used by the Argonaute 2 (Ago2) endonuclease in the cleavage of a target mRNA or (b) a single stranded oligonucleotide having a single antisense strand, where that antisense strand (or part of that antisense strand) is used by the Ago2 endonuclease in the cleavage of a target mRNA.
  • Ago2 Argonaute 2
  • RNAi agent refers to an agent, e.g. an RNAi oligonucleotide, that contains RNA nucleosides herein and which mediates the targeted cleavage of an RNA transcript via an RNA-induced silencing complex (RISC) pathway.
  • RISC RNA-induced silencing complex
  • iRNA directs the sequence-specific degradation of mRNA through a process known as RNA interference (RNAi).
  • RNAi RNA interference
  • the iRNA modulates, e.g. inhibits, the expression of the target nucleic acid in a cell, e.g. a cell within a subject, such as a mammalian subject.
  • RNAi agents include single stranded RNAi agents and double stranded siRNAs, as well as short hairpin RNAs (shRNAs).
  • the oligonucleotide of the invention or contiguous nucleotide sequence thereof may be in the form of an RNAi agent, or form part of an RNAi agent, such as a siRNA or shRNA.
  • the oligonucleotide of the invention or contiguous nucleotide sequence thereof is an RNAi agent, such as a siRNA.
  • siRNA refers to small interfering ribonucleic acid RNAi agents and is a class of double-stranded RNA molecules, also known in the art as short interfering RNA or silencing RNA.
  • siRNAs typically comprise a sense strand (also referred to as a passenger strand) and an antisense strand (also referred to as the guide strand), wherein each strand are of 17 - 30 nucleotides in length, typically 19 - 25 nucleosides in length, wherein the antisense strand is complementary, such as fully complementary, to the target nucleic acid (suitably a mature mRNA sequence), and the sense strand is complementary to the antisense strand so that the sense strand and antisense strand form a duplex or duplex region.
  • siRNA strands may form a blunt ended duplex, or advantageously the sense and antisense strand 3’ ends may form a 3’ overhang of e.g. 1, 2 or 3 nucleosides. In some embodiments, both the sense strand and antisense strand have a 2nt 3’ overhang.
  • the duplex region may therefore be, for example 17-25 nucleotides in length, such as 21-23 nucleotide in length.
  • siRNAs typically comprise modified nucleosides in addition to RNA nucleosides, or in some embodiments all of the nucleotides of an siRNA strand may be modified (the sense 2’ sugar modified nucleosides such as LNA (see W02004083430, W02007085485 for example), 2’-fluoro, 2’- O-methyl or 2’-O-methoxyethyl may be incorporated into siRNAs).
  • the passenger stand of the siRNA may be discontinuous (see W02007107162 for example).
  • the incorporation of thermally destabilizing nucleotides occurring at a seed region of the antisense strand of siRNAs have been reported as useful in reducing off-target activity of siRNAs (see WO18098328 for example).
  • the dsRNA agent such as the siRNA of the invention, comprises at least one modified nucleotide.
  • substantially all of the nucleotides of the sense strand comprise a modification; substantially all of the nucleotides of the antisense strand comprise a modification; or substantially all of the nucleotides of the sense strand and substantially all of the nucleotides of the antisense strand comprise a modification.
  • all of the nucleotides of the sense strand comprise a modification; all of the nucleotides of the antisense strand comprise a modification; or all of the nucleotides of the sense strand and all of the nucleotides of the antisense strand comprise a modification.
  • the modified nucleotides may be independently selected from the group consisting of a deoxy-nucleotide, a 3'-terminal deoxy-thymine (dT) nucleotide, a 2'-O- methyl modified nucleotide, a 2'-fluoro modified nucleotide, a 2'-deoxy-modified nucleotide, a locked nucleotide, an unlocked nucleotide, a conformationally restricted nucleotide, a constrained ethyl nucleotide, an abasic nucleotide, a 2'-amino-modified nucleotide, a 2’-O- allyl-modified nucleotide, 2'-C-alkyl-modified nucleotide, 2'-hydroxyl-modified nucleotide, a 2'-methoxyethyl modified nucleotide, a 2'-O-alky
  • the dsRNA agent further comprises at least one phosphorothioate or methylphosphonate internucleotide linkage.
  • the phosphorothioate or methylphosphonate internucleotide linkage may be at the 3'-terminus one or both strand (e.g., the antisense strand; or the sense strand); or the phosphorothioate or methylphosphonate internucleoside linkage may be at the 5'-terminus of one or both strands (e.g., the antisense strand; or the sense strand); or the phosphorothioate or methylphosphonate internucleoside linkage may be at the both the 5'- and 3'-terminus of one or both strands (e.g., the antisense strand; or the sense strand).
  • the remaining internucleoside linkages are phosphodiester linkages.
  • the dsRNA agent may further comprise a ligand.
  • the ligand is conjugated to the 3' end of the sense strand.
  • siRNAs may be conjugated to a targeting ligand, and/or be formulated into lipid nanoparticles, for example.
  • Other aspects of the invention relate to pharmaceutical compositions comprising these dsRNA, such as siRNA molecules suitable for therapeutic use, and methods of inhibiting the expression of the target gene by administering the dsRNA molecules such as siRNAs of the invention, e.g., for the treatment of various disease conditions as disclosed herein.
  • the term “tetraloop” refers to a loop that increases stability of an adjacent duplex formed by hybridization of flanking sequences of nucleotides.
  • the increase in stability is detectable as an increase in melting temperature (T m ) of an adjacent stem duplex that is higher than the T m of the adjacent stem duplex expected, on average, from a set of loops of comparable length consisting of randomly selected sequences of nucleotides.
  • a tetraloop can confer a melting temperature of at least 50 °C, at least 55 °C, at least 56 °C, at least 58 °C, at least 60 °C, at least 65 °C or at least 75 °C in 10 mM NaHPC to a hairpin comprising a duplex of at least 2 base pairs in length.
  • a tetraloop may stabilize a base pair in an adjacent stem duplex by stacking interactions.
  • interactions among the nucleotides in a tetraloop include but are not limited to non- Watson-Crick base-pairing, stacking interactions, hydrogen bonding, and contact interactions (Cheong et al., Nature 1990 Aug.
  • a tetraloop comprises 4 to 5 nucleotides.
  • a tetraloop comprises or consists of three, four, five, or six nucleotides, which may or may not be modified (e.g., which may or may not be conjugated to a targeting moiety).
  • a tetraloop consists of four nucleotides. Any nucleotide may be used in the tetraloop and standard IUPAC-IUB symbols for such nucleotides may be used as described in Cornish-Bowden (1985) Nucl. Acids Res.
  • tetraloops include the LINCG family of tetraloops (e.g., UllCG), the GNRA family of tetraloops (e.g., GAAA), and the CUIIG tetraloop (Woese et al., Proc Natl Acad Sci USA.
  • DNA tetraloops include the d(GNNA) family of tetraloops (e.g., d(GTTA)), the d(GNRA) family of tetra I oops, the d(GNAB) family of tetraloops, the d(CNNG) family of tetraloops, and the d(TNCG) family of tetraloops (e.g., d(TTCG)).
  • d(GNNA) family of tetraloops e.g., d(GTTA)
  • d(GNRA) d(GNRA) family of tetra I oops
  • the d(GNAB) family of tetraloops the d(CNNG) family of tetraloops
  • d(TNCG) family of tetraloops e.g., d(TTCG)
  • the tetraloop is contained within a nicked tetraloop structure.
  • a “nicked tetraloop structure” is a structure of an RNAi oligonucleotide characterized by the presence of separate sense (passenger) and antisense (guide) strands, in which the sense strand has a region of complementarity with the antisense strand, and in which at least one of the strands, generally the sense strand, has a tetraloop configured to stabilize an adjacent stem region formed within the at least one strand.
  • Antisense oligonucleotides as used herein is defined as oligonucleotides capable of modulating expression of a target gene by hybridizing to a target nucleic acid, in particular to a contiguous sequence on a target nucleic acid.
  • the antisense oligonucleotides are not essentially double stranded and are therefore not siRNAs or shRNAs.
  • the antisense oligonucleotides of the present invention are single stranded.
  • single stranded oligonucleotides of the present invention can form hairpins or intermolecular duplex structures (duplex between two molecules of the same oligonucleotide), as long as the degree of intra or inter self complementarity is less than 50% across of the full length of the oligonucleotide.
  • the single stranded antisense oligonucleotide of the invention does not contain RNA nucleosides, since this will decrease nuclease resistance.
  • the antisense oligonucleotide of the invention comprises one or more modified nucleosides or nucleotides, such as 2’ sugar modified nucleosides. Furthermore, it is advantageous that the nucleosides which are not modified are DNA nucleosides. Contiguous Nucleotide Sequence
  • contiguous nucleotide sequence refers to the region of the oligonucleotide which is complementary to the target nucleic acid.
  • the term is used interchangeably herein with the term “contiguous nucleobase sequence” and the term “oligonucleotide motif sequence”. In some embodiments all the nucleotides of the oligonucleotide constitute the contiguous nucleotide sequence.
  • the oligonucleotide comprises the contiguous nucleotide sequence, such as an F-G-F’ gapmer region, and may optionally comprise further nucleotide(s), for example a nucleotide linker region which may be used to attach a functional group to the contiguous nucleotide sequence.
  • the nucleotide linker region may or may not be complementary to the target nucleic acid. It is understood that the contiguous nucleotide sequence of the oligonucleotide cannot be longer than the oligonucleotide as such and that the oligonucleotide cannot be shorter than the contiguous nucleotide sequence.
  • Nucleotides are the building blocks of oligonucleotides and polynucleotides, and for the purposes of the present invention include both naturally occurring and non-naturally occurring nucleotides.
  • nucleotides such as DNA and RNA nucleotides comprise a ribose sugar moiety, a nucleobase moiety and one or more phosphate groups (which is absent in nucleosides).
  • Nucleosides and nucleotides may also interchangeably be referred to as “units” or “monomers”.
  • deoxyribonucleotide refers to a nucleotide having a hydrogen in place of a hydroxyl at the 2' position of its pentose sugar as compared with a ribonucleotide.
  • a modified deoxyribonucleotide is a deoxyribonucleotide having one or more modifications or substitutions of atoms other than at the 2' position, including modifications or substitutions in or of the sugar, phosphate group or base.
  • ribonucleotide refers to a nucleotide having a ribose as its pentose sugar, which contains a hydroxyl group at its 2' position.
  • a modified ribonucleotide is a ribonucleotide having one or more modifications or substitutions of atoms other than at the 2' position, including modifications or substitutions in or of the ribose, phosphate group or base.
  • modified nucleoside or “nucleoside modification” as used herein refers to nucleosides modified as compared to the equivalent DNA or RNA nucleoside by the introduction of one or more modifications of the sugar moiety or the (nucleo)base moiety.
  • the modified nucleoside comprise a modified sugar moiety.
  • modified nucleoside may also be used herein interchangeably with the term “nucleoside analogue” or modified “units” or modified “monomers”.
  • Nucleosides with an unmodified DNA or RNA sugar moiety are termed DNA or RNA nucleosides herein.
  • Nucleosides with modifications in the base region of the DNA or RNA nucleoside are still generally termed DNA or RNA if they allow Watson Crick base pairing.
  • modified nucleotide refers to a nucleotide having one or more chemical modifications compared with a corresponding reference nucleotide selected from: adenine ribonucleotide, guanine ribonucleotide, cytosine ribonucleotide, uracil ribonucleotide, adenine deoxyribonucleotide, guanine deoxyribonucleotide, cytosine deoxyribonucleotide and thymidine deoxyribonucleotide.
  • a modified nucleotide is a non-naturally occurring nucleotide.
  • a modified nucleotide has one or more chemical modification in its sugar, nucleobase and/or phosphate group. In some embodiments, a modified nucleotide has one or more chemical moieties conjugated to a corresponding reference nucleotide. Typically, a modified nucleotide confers one or more desirable properties to a nucleic acid in which the modified nucleotide is present. For example, a modified nucleotide may improve thermal stability, resistance to degradation, nuclease resistance, solubility, bioavailability, bioactivity, reduced immunogenicity, etc.
  • modified internucleoside linkage is defined as generally understood by the skilled person as linkages other than phosphodiester (PO) linkages, that covalently couples two nucleosides together.
  • the oligonucleotides of the invention may therefore comprise modified internucleoside linkages.
  • the modified internucleoside linkage increases the nuclease resistance of the oligonucleotide compared to a phosphodiester linkage.
  • the internucleoside linkage includes phosphate groups creating a phosphodiester bond between adjacent nucleosides.
  • Modified internucleoside linkages are particularly useful in stabilizing oligonucleotides for in vivo use, and may serve to protect against nuclease cleavage at regions of DNA or RNA nucleosides in the oligonucleotide of the invention, for example within the gap region G of a gapmer oligonucleotide, as well as in regions of modified nucleosides, such as region F and F’.
  • the oligonucleotide comprises one or more internucleoside linkages modified from the natural phosphodiester, such as one or more modified internucleoside linkages that is for example more resistant to nuclease attack.
  • Nuclease resistance may be determined by incubating the oligonucleotide in blood serum or by using a nuclease resistance assay (e.g. snake venom phosphodiesterase (SVPD)), both are well known in the art.
  • SVPD snake venom phosphodiesterase
  • Internucleoside linkages which are capable of enhancing the nuclease resistance of an oligonucleotide are referred to as nuclease resistant internucleoside linkages.
  • At least 50% of the internucleoside linkages in the oligonucleotide, or contiguous nucleotide sequence thereof are modified, such as at least 60%, such as at least 70%, such as at least 75%, such as at least 80% or such as at least 90% of the internucleoside linkages in the oligonucleotide, or contiguous nucleotide sequence thereof, are modified. In some embodiments all of the internucleoside linkages of the oligonucleotide, or contiguous nucleotide sequence thereof, are modified.
  • nucleosides which link the oligonucleotide of the invention to a nonnucleotide functional group, such as a conjugate may be phosphodiester.
  • all of the internucleoside linkages of the oligonucleotide, or contiguous nucleotide sequence thereof, are nuclease resistant internucleoside linkages.
  • oligonucleotides of the invention it is advantageous to use phosphorothioate internucleoside linkages.
  • Phosphorothioate internucleoside linkages are particularly useful due to nuclease resistance, beneficial pharmacokinetics and ease of manufacture.
  • at least 50% of the internucleoside linkages in the oligonucleotide, or contiguous nucleotide sequence thereof are phosphorothioate, such as at least 60%, such as at least 70%, such as at least 75%, such as at least 80% or such as at least 90% of the internucleoside linkages in the oligonucleotide, or contiguous nucleotide sequence thereof, are phosphorothioate.
  • all of the internucleoside linkages of the oligonucleotide, or contiguous nucleotide sequence thereof are phosphorothioate.
  • the oligonucleotide of the invention comprises both phosphorothioate internucleoside linkages and at least one phosphodiester linkage, such as 2, 3 or 4 phosphodiester linkages, in addition to the phosphorodithioate linkage(s).
  • phosphodiester linkages when present, are suitably not located between contiguous DNA nucleosides in the gap region G.
  • Nuclease resistant linkages such as phosphorothioate linkages, are particularly useful in oligonucleotide regions capable of recruiting nuclease when forming a duplex with the target nucleic acid, such as region G for gapmers.
  • Phosphorothioate linkages may, however, also be useful in non-nuclease recruiting regions and/or affinity enhancing regions such as regions F and F’ for gapmers.
  • Gapmer oligonucleotides may, in some embodiments comprise one or more phosphodiester linkages in region F or F’, or both region F and F’, where all the internucleoside linkages in region G may be phosphorothioate.
  • all the internucleoside linkages of the contiguous nucleotide sequence of the oligonucleotide are phosphorothioate, or all the internucleoside linkages of the oligonucleotide are phosphorothioate linkages.
  • all the internucleoside linkages of the contiguous nucleotide sequence of the antisense oligonucleotide are phosphorothioate, or all the internucleoside linkages of the antisense oligonucleotide are phosphorothioate linkages.
  • therapeutic oligonucleotides may comprise other internucleoside linkages (other than phosphodiester and phosphorothioate), for example alkyl phosphonate/methyl phosphonate internucleoside, which according to EP 2 742 135 may for example be tolerated in an otherwise DNA phosphorothioate the gap region.
  • nucleobase includes the purine (e.g. adenine and guanine) and pyrimidine (e.g. uracil, thymine and cytosine) moiety present in nucleosides and nucleotides which form hydrogen bonds in nucleic acid hybridization.
  • pyrimidine e.g. uracil, thymine and cytosine
  • nucleobase also encompasses modified nucleobases which may differ from naturally occurring nucleobases, but are functional during nucleic acid hybridization.
  • nucleobase refers to both naturally occurring nucleobases such as adenine, guanine, cytosine, thymidine, uracil, xanthine and hypoxanthine, as well as non-naturally occurring variants. Such variants are for example described in Hirao et al (2012) Accounts of Chemical Research vol 45 page 2055 and Bergstrom (2009) Current Protocols in Nucleic Acid Chemistry Suppl. 37 1.4.1.
  • the nucleobase moiety is modified by changing the purine or pyrimidine into a modified purine or pyrimidine, such as substituted purine or substituted pyrimidine, such as a nucleobase selected from isocytosine, pseudoisocytosine, 5-methyl cytosine, 5-thiozolo-cytosine, 5-propynyl-cytosine, 5-propynyl-uracil, 5-bromouracil 5- thiazolo-uracil, 2-thio-uracil, 2’thio-thymine, inosine, diaminopurine, 6-aminopurine, 2- aminopurine, 2,6-diaminopurine and 2-chloro-6-aminopurine.
  • a nucleobase selected from isocytosine, pseudoisocytosine, 5-methyl cytosine, 5-thiozolo-cytosine, 5-propynyl-cytosine, 5-propynyl-uracil, 5-bromour
  • nucleobase moieties may be indicated by the letter code for each corresponding nucleobase, e.g. A, T, G, C or II, wherein each letter may optionally include modified nucleobases of equivalent function.
  • the nucleobase moieties are selected from A, T, G, C, and 5-methyl cytosine.
  • 5-methyl cytosine LNA nucleosides may be used.
  • modified oligonucleotide describes an oligonucleotide comprising one or more sugar-modified nucleosides and/or modified internucleoside linkages.
  • chimeric oligonucleotide is a term that has been used in the literature to describe oligonucleotides with modified nucleosides.
  • complementary refers to a structural relationship between two nucleotides (e.g., on two opposing nucleic acids or on opposing regions of a single nucleic acid strand), or between two sequences of nucleotides, that permits the two nucleotides, or two sequences of nucleotides, to form base pairs with one another.
  • a purine nucleotide of one nucleic acid that is complementary to a pyrimidine nucleotide of an opposing nucleic acid may base pair together by forming hydrogen bonds with one another.
  • complementary nucleotides can base pair in the Watson-Crick manner or in any other manner that allows for the formation of stable duplexes.
  • Watson- Crick base pairs are guanine (G)-cytosine (C) and adenine (A) - thymine (T)/uracil (II).
  • G guanine
  • C cytosine
  • A adenine
  • T thymine
  • II uracil
  • oligonucleotides may comprise nucleosides with modified nucleobases, for example 5-methyl cytosine is often used in place of cytosine, and as such the term complementarity encompasses Watson Crick base-paring between non-modified and modified nucleobases (see for example Hirao et al (2012) Accounts of Chemical Research vol 45 page 2055 and Bergstrom (2009) Current Protocols in Nucleic Acid Chemistry Suppl. 37 1.4.1).
  • % complementary refers to the proportion of nucleotides (in percent) of a contiguous nucleotide sequence in a nucleic acid molecule (e.g. oligonucleotide) which across the contiguous nucleotide sequence, is complementary to a reference sequence (e.g. a target sequence or sequence motif). The percentage of complementarity is thus calculated by counting the number of aligned nucleobases that are complementary (from e.g.
  • Watson Crick base pair between the two sequences (when aligned with the target sequence 5’-3’ and the oligonucleotide sequence from 3’-5’), dividing that number by the total number of nucleotides in the oligonucleotide and multiplying by 100.
  • a nucleobase/nucleotide which does not align e.g. form a base pair
  • Insertions and deletions are not allowed in the calculation of % complementarity of a contiguous nucleotide sequence. It will be understood that in determining complementarity, chemical modifications of the nucleobases are disregarded as long as the functional capacity of the nucleobase to form e.g. Watson Crick base pairing is retained (e.g. 5’-methyl cytosine is considered identical to a cytosine for the purpose of calculating % identity).
  • two nucleic acids may have regions of multiple nucleotides that are complementary with each other so as to form regions of complementarity, as described herein.
  • region of complementarity refers to a sequence of nucleotides of a nucleic acid (e.g., a double-stranded oligonucleotide) that is sufficiently complementary to an antiparallel sequence of nucleotides to permit hybridization between the two sequences of nucleotides under appropriate hybridization conditions, e.g., in a phosphate buffer, in a cell, etc.
  • a nucleic acid e.g., a double-stranded oligonucleotide
  • Identity refers to the proportion of nucleotides (expressed in percent) of a contiguous nucleotide sequence in a nucleic acid molecule (e.g. oligonucleotide) which across the contiguous nucleotide sequence, is identical to a reference sequence (e.g. a sequence motif).
  • the percentage of identity is thus calculated by counting the number of aligned nucleobases that are identical (a Match) between two sequences (in the contiguous nucleotide sequence of the compound of the invention and in the reference sequence), dividing that number by the total number of nucleotides in the oligonucleotide and multiplying by 100.
  • Percentage of Identity (Matches x 100)/Length of aligned region (e.g. the contiguous nucleotide sequence). Insertions and deletions are not allowed in the calculation of the percentage of identity of a contiguous nucleotide sequence. It will be understood that in determining identity, chemical modifications of the nucleobases are disregarded as long as the functional capacity of the nucleobase to form Watson Crick base pairing is retained (e.g. 5-methyl cytosine is considered identical to a cytosine for the purpose of calculating % identity).
  • hybridizing or “hybridizes” as used herein is to be understood as two nucleic acid strands (e.g. an oligonucleotide and a target nucleic acid) forming hydrogen bonds between base pairs on opposite strands thereby forming a duplex.
  • the affinity of the binding between two nucleic acid strands is the strength of the hybridization. It is often described in terms of the melting temperature (T m ) defined as the temperature at which half of the oligonucleotides are duplexed with the target nucleic acid. At physiological conditions T m is not strictly proportional to the affinity (Mergny and Lacroix, 2003, Oligonucleotides 13:515-537).
  • AG° is the energy associated with a reaction where aqueous concentrations are 1M, the pH is 7, and the temperature is 37°C.
  • the hybridization of oligonucleotides to a target nucleic acid is a spontaneous reaction and for spontaneous reactions AG° is less than zero.
  • AG° can be measured experimentally, for example, by use of the isothermal titration calorimetry (ITC) method as described in Hansen et al., 1965, Chem. Comm. 36-38 and Holdgate et al., 2005, Drug Discov Today. The skilled person will know that commercial equipment is available for AG° measurements. AG° can also be estimated numerically by using the nearest neighbor model as described by SantaLucia, 1998, Proc Natl Acad Sci USA. 95: 1460-1465 using appropriately derived thermodynamic parameters described by Sugimoto et al., 1995, Biochemistry 34:11211-11216 and McTigue et al., 2004, Biochemistry 43: 5388- 5405.
  • ITC isothermal titration calorimetry
  • oligonucleotides of the present invention hybridize to a target nucleic acid with estimated AG° values below -10 kcal for oligonucleotides that are 10-30 nucleotides in length. In some embodiments the degree or strength of hybridization is measured by the standard state Gibbs free energy AG°.
  • the oligonucleotides may hybridize to a target nucleic acid with estimated AG° values below the range of -10 kcal, such as below -15 kcal, such as below -20 kcal and such as below -25 kcal for oligonucleotides that are 8-30 nucleotides in length.
  • the oligonucleotides hybridize to a target nucleic acid with an estimated AG° value of -10 to -60 kcal, such as -12 to -40, such as from -15 to -30 kcal or- 16 to -27 kcal such as -18 to -25 kcal.
  • the target nucleic acid may for example be a gene, a RNA, mRNA, viral mRNA or a cDNA sequence.
  • the oligonucleotide of the invention is typically capable of inhibiting the expression of the HBV target nucleic acid in a cell which is expressing the HBV target nucleic acid.
  • the contiguous sequence of nucleobases of the oligonucleotide of the invention is typically complementary to the HBV target nucleic acid, as measured across the length of the oligonucleotide, optionally with the exception of one or two mismatches, and optionally excluding nucleotide based linker regions which may link the oligonucleotide to an optional functional group such as a conjugate, or other non-complementary terminal nucleotides (e.g. region D’ or D”).
  • target sequence refers to a sequence of nucleotides present in the target nucleic acid which comprises the nucleobase sequence which is complementary to the oligonucleotide of the invention.
  • the target sequence consists of a region on the target nucleic acid with a nucleobase sequence that is complementary to the contiguous nucleotide sequence of the oligonucleotide of the invention. This region of the target nucleic acid may interchangeably be referred to as the target nucleotide sequence, target sequence or target region.
  • the target sequence is longer than the complementary sequence of a single oligonucleotide, and may, for example represent a preferred region of the target nucleic acid which may be targeted by several oligonucleotides of the invention.
  • a “target cell” as used herein refers to a cell which is expressing the target nucleic acid.
  • the target cell may be in vivo or in vitro.
  • the target cell is a HBV infected mammalian cell such as a rodent cell, such as a mouse cell or a human cell, in particular a HBV infected hepatocyte.
  • the target cell expresses HBV mRNA and secretes HBsAg and HBeAg.
  • hepatocyte refers to cells of the parenchymal tissues of the liver. These cells make up approximately 70-85% of the liver’s mass and manufacture serum albumin, fibrinogen, and the prothrombin group of clotting factors (except for Factors 3 and 4). Markers for hepatocyte lineage cells may include, but are not limited to: transthyretin (Ttr), glutamine synthetase (Glul), hepatocyte nuclear factor 1a (Hnfla), and hepatocyte nuclear factor 4a (Hnf4a).
  • Ttr transthyretin
  • Glul glutamine synthetase
  • Hnfla hepatocyte nuclear factor 1a
  • Hnf4a hepatocyte nuclear factor 4a
  • Markers for mature hepatocytes may include, but are not limited to: cytochrome P450 (Cyp3a11), fumarylacetoacetate hydrolase (Fah), glucose 6-phosphate (G6p), albumin (Alb), and OC2-2F8. See, e.g., Huch et al., (2013), Nature, 494(7436): 247-250, the contents of which relating to hepatocyte markers is incorporated herein by reference.
  • the term “reduced expression” of a gene refers to a decrease in the amount of RNA transcript or protein encoded by the gene and/or a decrease in the amount of activity of the gene in a cell or subject, as compared to an appropriate reference cell or subject.
  • the act of treating a cell with a pharmaceutical combination or a double-stranded oligonucleotide may result in a decrease in the amount of RNA transcript, protein and/or enzymatic activity (e.g., encoded by the S gene of an HBV genome) compared to a cell that is not treated with the pharmaceutical combination or double-stranded oligonucleotide respectively.
  • reducing expression refers to an act that results in reduced expression of a gene (e.g., the S gene of an HBV genome).
  • naturally occurring variant thereof refers to variants of the target nucleic acid which exist naturally within the defined taxonomic group, such as HBV genotypes A-H.
  • the term may also encompass any allelic variant of the target sequence encoding genomic DNA which are found by chromosomal translocation or duplication, and the RNA, such as mRNA derived therefrom.
  • “Naturally occurring variants” may also include variants derived from alternative splicing of the target sequence mRNA.
  • the term also includes naturally occurring forms of the protein which may therefore be processed, e.g. by co- or post-translational modifications, such as signal peptide cleavage, proteolytic cleavage, glycosylation, etc.
  • a high affinity modified nucleoside is a modified nucleotide which, when incorporated into the oligonucleotide, enhances the affinity of the oligonucleotide for its complementary target, for example as measured by the melting temperature (T m ).
  • a high affinity modified nucleoside of the present invention preferably result in an increase in melting temperature between +0.5 to +12°C, more preferably between +1.5 to +10°C and most preferably between+3 to +8°C per modified nucleoside.
  • Numerous high affinity modified nucleosides are known in the art and include for example, many 2’ substituted nucleosides as well as locked nucleic acids (LNA) (see e.g. Freier & Altmann; Nucl. Acid Res., 1997, 25, 4429-4443 and Uhlmann; Curr. Opinion in Drug Development, 2000, 3(2), 293-213).
  • the oligomer of the invention may comprise one or more nucleosides which have a modified sugar moiety, i.e. a modification of the sugar moiety when compared to the ribose sugar moiety found in DNA and RNA.
  • nucleosides with modification of the ribose sugar moiety have been made, primarily with the aim of improving certain properties of oligonucleotides, such as affinity and/or nuclease resistance.
  • Such modifications include those where the ribose ring structure is modified, e.g. by replacement with a hexose ring (HNA), or a bicyclic ring, which typically have a biradicle bridge between the C2 and C4 carbons on the ribose ring (LNA), or an unlinked ribose ring which typically lacks a bond between the C2 and C3 carbons (e.g. UNA).
  • HNA hexose ring
  • LNA ribose ring
  • UPA unlinked ribose ring which typically lacks a bond between the C2 and C3 carbons
  • Other sugar modified nucleosides include, for example, bicyclohexose nucleic acids (WO2011/017521) or tricyclic nucleic acids (WO2013/154798).
  • Modified nucleosides also include nucleosides where the sugar moiety is replaced with a non-sugar moiety, for example in the case of peptide nucleic acids (PNA), or morpholino nucleic acids.
  • Sugar modifications also include modifications made via altering the substituent groups on the ribose ring to groups other than hydrogen, or the 2’-OH group naturally found in DNA and RNA nucleosides. Substituents may, for example be introduced at the 2’, 3’, 4’ or 5’ positions.
  • a 2’ sugar modified nucleoside is a nucleoside which has a substituent other than H or -OH at the 2’ position (2’ substituted nucleoside) or comprises a 2’ linked biradicle capable of forming a bridge between the 2’ carbon and a second carbon in the ribose ring, such as LNA (2’ - 4’ biradicle bridged) nucleosides.
  • the 2’ modified sugar may provide enhanced binding affinity and/or increased nuclease resistance to the oligonucleotide.
  • 2’ substituted modified nucleosides are 2’-O-alkyl-RNA, 2’-O-methyl-RNA, 2’- alkoxy-RNA, 2’-O-methoxyethyl-RNA (MOE), 2’-amino-DNA, 2’-Fluoro-RNA, and 2’-F-ANA nucleoside.
  • substituted sugar modified nucleosides does not include 2’ bridged nucleosides like LNA.
  • LNA nucleosides Locked Nucleic Acid Nucleosides
  • a “LNA nucleoside” is a 2’- modified nucleoside which comprises a biradical linking the C2’ and C4’ of the ribose sugar ring of said nucleoside (also referred to as a “2’- 4’ bridge”), which restricts or locks the conformation of the ribose ring.
  • These nucleosides are also termed bridged nucleic acid or bicyclic nucleic acid (BNA) in the literature.
  • BNA bicyclic nucleic acid
  • the locking of the conformation of the ribose is associated with an enhanced affinity of hybridization (duplex stabilization) when the LNA is incorporated into an oligonucleotide for a complementary RNA or DNA molecule. This can be routinely determined by measuring the melting temperature of the oligonucleotide/complement duplex.
  • Non limiting, exemplary LNA nucleosides are disclosed in WO 99/014226, WO 00/66604, WO 98/039352, WO 2004/046160, WO 00/047599, WO 2007/134181, WO 2010/077578, WO 2010/036698, WO 2007/090071, WO 2009/006478, WO 2011/156202, WO 2008/154401 , WO 2009/067647, WO 2008/150729, Morita et al., Bioorganic & Med. Chem. Lett. 12, 73-76, Seth et al. J. Org. Chem. 2010, Vol 75(5) pp. 1569-81 , and Mitsuoka et al., Nucleic Acids Research 2009, 37(4), 1225-1238, and Wan and Seth, J. Medical Chemistry 2016, 59, 9645-9667.
  • LNA nucleosides are beta- D-oxy- LNA, 6’-methyl-beta-D-oxy LNA such as (S)-6’- methyl-beta-D-oxy-LNA (ScET) and ENA.
  • a particularly advantageous LNA is beta-D-oxy- LNA.
  • phosphate analog refers to a chemical moiety that mimics the electrostatic and/or steric properties of a phosphate group.
  • a phosphate analog is positioned at the 5' terminal nucleotide of an oligonucleotide in place of a 5'-phosphate, which is often susceptible to enzymatic removal.
  • a 5' phosphate analog contains a phosphatase-resistant linkage. Examples of phosphate analogs include 5' phosphonates, such as 5' methylenephosphonate (5'-MP) and 5'-(E)- vinylphosphonate (5'-VP).
  • an oligonucleotide has a phosphate analog at a 4'-carbon position of the sugar (referred to as a “4'-phosphate analog”) at a 5'- terminal nucleotide.
  • a 4'-phosphate analog is oxymethylphosphonate, in which the oxygen atom of the oxymethyl group is bound to the sugar moiety (e.g., at its 4'- carbon) or analog thereof. See, for example, U.S. Provisional Application numbers 62/383,207, filed on September 2, 2016, and 62/393,401 , filed on September 12, 2016, the contents of each of which relating to phosphate analogs are incorporated herein by reference.
  • Nuclease mediated degradation refers to an oligonucleotide capable of mediating degradation of a complementary nucleotide sequence when forming a duplex with such a sequence.
  • the antisense oligonucleotide may function via nuclease mediated degradation of the target nucleic acid, where the oligonucleotides of the invention are capable of recruiting a nuclease, particularly an endonuclease, preferably an endoribonuclease (RNase), such as RNase H.
  • RNase endoribonuclease
  • examples of oligonucleotide designs which operate via nuclease mediated mechanisms are oligonucleotides which typically comprise a region of at least 5 or 6 consecutive DNA nucleosides and are flanked on one side or both sides by affinity enhancing nucleosides, for example gapmers, headmers and tailmers.
  • the therapeutic oligonucleotide is an antisense oligonucleotide capable of recruiting RNase H.
  • the RNase H activity of an antisense oligonucleotide refers to its ability to recruit RNase H when in a duplex with a complementary RNA molecule.
  • WO01/23613 provides in vitro methods for determining RNase H activity, which may be used to determine the ability to recruit RNase H.
  • an oligonucleotide is deemed capable of recruiting RNase H if it, when provided with a complementary target nucleic acid sequence, has an initial rate, as measured in pmol/l/min, of at least 5%, such as at least 10% or more than 20% of the of the initial rate determined when using a oligonucleotide having the same base sequence as the modified oligonucleotide being tested, but containing only DNA monomers with phosphorothioate linkages between all monomers in the oligonucleotide, and using the methodology provided by Example 91 - 95 of WO01/23613 (hereby incorporated by reference).
  • recombinant human RNase H1 is available from Lubio Science GmbH, Lucerne, Switzerland. Gapmer
  • the nucleic acid molecule of the invention, or contiguous nucleotide sequence thereof are gapmer antisense oligonucleotides.
  • the antisense gapmers are commonly used to inhibit a target nucleic acid via RNase H mediated degradation.
  • the antisense oligonucleotide of the invention is capable of recruiting RNase H.
  • a gapmer antisense oligonucleotide comprises at least three distinct structural regions: a 5’- flank, a gap and a 3’-flank, F-G-F’ in the ‘5 -> 3’ orientation.
  • the “gap” region (G) comprises a stretch of contiguous DNA nucleotides which enable the oligonucleotide to recruit RNase H.
  • the gap region is flanked by a 5’ flanking region (F) comprising one or more sugar modified nucleosides, advantageously high affinity sugar modified nucleosides, and by a 3’ flanking region (F’) comprising one or more sugar modified nucleosides, advantageously high affinity sugar modified nucleosides.
  • the one or more sugar modified nucleosides in region F and F’ enhance the affinity of the oligonucleotide for the target nucleic acid (/.e. are affinity enhancing sugar modified nucleosides).
  • the one or more sugar modified nucleosides in region F and F’ are 2’ sugar modified nucleosides, such as high affinity 2’ sugar modifications, such as independently selected from LNA and 2’-MOE.
  • the 5’ and 3’ most nucleosides of the gap region are DNA nucleosides, and are positioned adjacent to a sugar modified nucleoside of the 5’ (F) or 3’ (F’) region respectively.
  • the flanks may further be defined by having at least one sugar modified nucleoside at the end most distant from the gap region, i.e. at the 5’ end of the 5’ flank and at the 3’ end of the 3’ flank.
  • Regions F-G-F’ form a contiguous nucleotide sequence.
  • Antisense oligonucleotides of the invention, or the contiguous nucleotide sequence thereof, may comprise a gapmer region of formula F-G-F’.
  • the overall length of the gapmer design F-G-F’ may be, for example 12 to 30 nucleosides, such as 13 to 24, such as 14 to 22 nucleosides, Such as from 13 to 17, such as 14 to 16 nucleosides.
  • the gapmer oligonucleotide of the present invention can be represented by the following formulae: Fi-6-G6-i6-F’i-6, such as Fl-4-G?-10-F’2-4 with the proviso that the overall length of the gapmer regions F-G-F’ is at least 12, such as at least 13 nucleotides in length.
  • the antisense oligonucleotide or contiguous nucleotide sequence thereof consists of or comprises a gapmer of formula 5’-F-G-F’-3’, where region F and F’ independently comprise or consist of 1- 8 nucleosides, of which 1-4 are 2’ sugar modified and defines the 5’ and 3’ end of the F and F’ region, and G is a region of between 6 and 16 nucleosides which are capable of recruiting RNase H.
  • the contiguous nucleotide sequence is a gapmer of formula 5’-F-G-F’-3’, where region F and F’ independently consist of 2 - 42’ sugar modified nucleotides and defines the 5’ and 3’ end of the F and F’ region, and G is a region between 6 and 10 DNA nucleosides which are capable of recruiting RNase H.
  • the gap region G may consist of 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16 contiguous phosphorothioate linked DNA nucleosides. In some embodiments the gap region G consist of 7 to 10 DNA nucleosides. In some embodiments, all internucleoside linkages in the gap are phosphorothioate linkages.
  • region F and F’ independently consists of or comprises a contiguous sequence of sugar modified nucleosides.
  • the sugar modified nucleosides of region F may be independently selected from 2’-O-alkyl-RNA units, 2’-O- methyl-RNA, 2’-amino-DNA units, 2’-fluoro-DNA units, 2’-alkoxy-RNA, MOE units, LNA units, arabino nucleic acid (ANA) units and 2’-fluoro-ANA units.
  • all the nucleosides of region F or F’, or F and F’ are LNA nucleosides, such as independently selected from beta-D-oxy LNA, ENA or ScET nucleosides.
  • region F consists of 1-5, such as 2-4, such as 3-4 such as 1 , 2, 3, 4 or 5 contiguous LNA nucleosides.
  • all the nucleosides of region F and F’ are beta-D-oxy LNA nucleosides.
  • all the nucleosides of region F or F’, or F and F’ are 2’ substituted nucleosides, such as OMe or MOE nucleosides.
  • region F consists of 1, 2, 3, 4, 5, 6, 7, or 8 contiguous OMe or MOE nucleosides.
  • only one of the flanking regions can consist of 2’ substituted nucleosides, such as OMe or MOE nucleosides.
  • the 5’ (F) flanking region that consists 2’ substituted nucleosides, such as OMe or MOE nucleosides whereas the 3’ (F’) flanking region comprises at least one LNA nucleoside, such as beta-D-oxy LNA nucleosides or cET nucleosides.
  • the 3’ (F’) flanking region that consists 2’ substituted nucleosides, such as OMe or MOE nucleosides
  • the 5’ (F) flanking region comprises at least one LNA nucleoside, such as beta-D-oxy LNA nucleosides or cET nucleosides.
  • An LNA gapmer is a gapmer wherein either one or both of region F and F’ comprises or consists of LNA nucleosides.
  • a beta-D-oxy gapmer is a gapmer wherein either one or both of region F and F’ comprises or consists of beta-D-oxy LNA nucleosides.
  • the LNA gapmer is of formula: [LNA]i-5-[region G]e-io-[LNA]i-5, wherein region G is as defined in the Gapmer region G definition.
  • a MOE gapmers is a gapmer wherein regions F and F’ consist of MOE nucleosides.
  • the MOE gapmer is of design [MOE]i.s-[Region G]5-i6-[MOE]i-8, such as [MOE]2-7-[Region G]e-i4-[MOE]2-7, such as [MOE]3-6-[Region G]s-i2-[MOE]3-6, wherein region G is as defined in the Gapmer definition.
  • MOE gapmers with a 5-10-5 design have been widely used in the art.
  • a mixed wing gapmer is an LNA gapmer wherein one or both of region F and F’ comprise a 2’ substituted nucleoside, such as a 2’ substituted nucleoside independently selected from the group consisting of 2’-O-alkyl-RNA units, 2’-O-methyl-RNA, 2’-amino-DNA units, 2’- fluoro-DNA units, 2’-alkoxy-RNA, MOE units, arabino nucleic acid (ANA) units and 2’-fluoro- ANA units, such as MOE nucleosides.
  • a 2’ substituted nucleoside independently selected from the group consisting of 2’-O-alkyl-RNA units, 2’-O-methyl-RNA, 2’-amino-DNA units, 2’- fluoro-DNA units, 2’-alkoxy-RNA, MOE units, arabino nucleic acid (ANA) units and 2’-fluoro- ANA units, such as MOE nucleosides.
  • region F and F’, or both region F and F’ comprise at least one LNA nucleoside
  • the remaining nucleosides of region F and F’ are independently selected from the group consisting of MOE and LNA.
  • at least one of region F and F’, or both region F and F’ comprise at least two LNA nucleosides
  • the remaining nucleosides of region F and F’ are independently selected from the group consisting of MOE and LNA.
  • one or both of region F and F’ may further comprise one or more DNA nucleosides.
  • the oligonucleotide of the invention may in some embodiments comprise or consist of the contiguous nucleotide sequence of the oligonucleotide which is complementary to the target nucleic acid, such as the gapmer F-G-F’, and further 5’ and/or 3’ nucleosides.
  • the further 5’ and/or 3’ nucleosides may or may not be fully complementary to the target nucleic acid.
  • Such further 5’ and/or 3’ nucleosides may be referred to as region D’ and D” herein.
  • region D’ or D may be used for the purpose of joining the contiguous nucleotide sequence, such as the gapmer, to a conjugate moiety or another functional group.
  • region D may be used for joining the contiguous nucleotide sequence with a conjugate moiety it can serve as a biocleavable linker. Alternatively, it may be used to provide exonuclease protection or for ease of synthesis or manufacture.
  • Region D’ and D can be attached to the 5’ end of region F or the 3’ end of region F’, respectively to generate designs of the following formulas D’-F-G-F’, F-G-F’-D” or D’-F-G-F’-D”.
  • the F-G-F’ is the gapmer portion of the oligonucleotide and region D’ or D” constitute a separate part of the oligonucleotide.
  • region D’ and F region and between region F’ and D” region is characterized by a nucleoside with a phosphodiester linkage towards the D’ or D” region and a phosphorothioate linkage towards the F or F’ region, and the nucleoside is considered to be a part of the gapmer (contiguous nucleotide sequence which is complementary to the target nucleic acid).
  • Region D’ or D may independently comprise or consist of 1, 2, 3, 4 or 5 additional nucleotides, which may be complementary or non-complementary to the target nucleic acid.
  • the nucleotide adjacent to the F or F’ region is not a sugar-modified nucleotide, such as a DNA or RNA or base modified versions of these.
  • the D’ or D” region may serve as a nuclease susceptible biocleavable linker (see definition of linkers).
  • the additional 5’ and/or 3’ end nucleotides are linked with phosphodiester linkages, and are DNA or RNA.
  • Nucleotide based biocleavable linkers suitable for use as region D’ or D” are disclosed in WO2014/076195, which include by way of example a phosphodiester linked DNA dinucleotide.
  • region D’ or D” is not complementary to or comprises at least 50% mismatches to the target nucleic acid.
  • region D’ or D comprises or consists of a dinucleotide of sequence AA, AT, AC, AG, TA, TT, TC, TG, CA, CT, CC, CG, GA, GT, GC, or GG, wherein C may be 5-methylcytosine, and/or T may be replaced with II.
  • the internucleoside linkage in the dinucleotide is a phosphodiester linkage.
  • region D’ or D comprises or consists of a trinucleotide of sequence AAA, AAT, AAC, AAG, ATA, ATT, ATC, ATG, ACA, ACT, ACC, ACG, AGA, AGT, AGC, AGG, TAA, TAT, TAG, TAG, TTA, TTT, TTC, TAG, TCA, TCT, TCC, TCG, TGA, TGT, TGC, TGG, CAA, CAT, CAC, CAG, CTA, CTG, CTC, CTT, CCA, CCT, CCC, CCG, CGA, CGT, CGC, CGG, GAA, GAT, GAC, CAG, GTA, GTT, GTC, GTG, GCA, GCT, GCC, GCG, GGA, GGT, GGC, and GGG wherein C may be 5- methylcytosine and/or T may be replaced with II.
  • the internucleoside linkages are phosphodiester linkages. It will be recognized that when referring to (naturally occurring) nucleobases A (adenine, T (thymine), II (uracil), G (guanine), C (cytosine), these may be substituted with nucleobase analogues which function as the equivalent natural nucleobase (e.g. base pair with the complementary nucleoside).
  • the antisense oligonucleotide of the invention comprises a region D’ and/or D” in addition to the contiguous nucleotide sequence which constitutes the gapmer.
  • the antisense oligonucleotide of the present invention can be represented by the following formulae: D’-F-G-F’, in particular D’I-3-FI-4-G6-IO-F’2-4 F-G-F’-D”, in particular FI-4-G6-IO-F’2-4-D”I-3
  • the internucleoside linkage positioned between region D’ and region F is a phosphodiester linkage. In some embodiments the internucleoside linkage positioned between region F’ and region D” is a phosphodiester linkage.
  • conjugate refers to a non-nucleotide moiety (conjugate), such as a GalNAc cluster, which can be covalently linked to a therapeutic oligonucleotide.
  • conjugate and cluster or conjugate moiety may be used interchangeably.
  • conjugated therapeutic oligonucleotide may also be termed an oligonucleotide conjugate.
  • the conjugate is a targeting ligand.
  • targeting ligand refers to a molecule (e.g., a carbohydrate, amino sugar, cholesterol, polypeptide or lipid) that selectively binds to a cognate molecule (e.g., a receptor) of a tissue or cell of interest and that is conjugatable to another substance for purposes of targeting the other substance to the tissue or cell of interest.
  • a targeting ligand may be conjugated to an oligonucleotide for purposes of targeting the oligonucleotide to a specific tissue or cell of interest.
  • a targeting ligand selectively binds to a cell surface receptor.
  • a targeting ligand when conjugated to an oligonucleotide facilitates delivery of the oligonucleotide into a particular cell through selective binding to a receptor expressed on the surface of the cell and endosomal internalization by the cell of the complex comprising the oligonucleotide, targeting ligand and receptor.
  • a targeting ligand is conjugated to an oligonucleotide via a linker that is cleaved following or during cellular internalization such that the oligonucleotide is released from the targeting ligand in the cell. Oligonucleotide Linkers
  • a linkage or linker is a connection between two atoms that links one chemical group or segment of interest to another chemical group or segment of interest via one or more covalent bonds.
  • Conjugate groups can be attached to the oligonucleotide directly or through a linking moiety (e.g. linker or tether).
  • Linkers serve to covalently connect a conjugate group, to an oligonucleotide or contiguous nucleotide sequence complementary to the target nucleic acid.
  • the therapeutic oligonucleotide may optionally comprise a linker region which is positioned between the oligonucleotide or contiguous nucleotide sequence complementary to the target nucleic acid and the conjugate.
  • Such linkers can be biocleavable linkers comprising or consisting of a physiologically labile bond that is cleavable under conditions normally encountered or analogous to those encountered within a mammalian body.
  • the biocleavable linker is susceptible to S1 nuclease cleavage.
  • the cleavage rate seen in the target tissue for example muscle, liver, kidney or a tumor is greater than that found in blood serum.
  • the biocleavable linker is at least about 20% cleaved, such as at least about 30% cleaved, such as at least about 40% cleaved, such as at least about 50% cleaved, such as at least about 60% cleaved, such as at least about 70% cleaved, such as at least about 75% cleaved when compared against a standard.
  • the nuclease susceptible linker comprises between 1 and 10 nucleosides, such as 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleosides, more preferably between 2 and 6 nucleosides and most preferably between 2 and 4 linked nucleosides comprising at least two consecutive phosphodiester linkages, such as at least 3 or 4 or 5 consecutive phosphodiester linkages.
  • the nucleosides are DNA or RNA.
  • Phosphodiester containing biocleavable linkers are described in more detail in WO 2014/076195 (hereby incorporated by reference).
  • linkers that are not necessarily biocleavable but primarily serve to covalently connect a conjugate to the oligonucleotide may also be used either alone or in combination with PO linkers.
  • the non-cleavable linkers may comprise a chain structure or an oligomer of repeating units such as ethylene glycol, amino acid units or amino alkyl groups.
  • the non-cleavable linker is an amino alkyl, such as a C2 - C36 amino alkyl group, including, for example C6 to C12 amino alkyl groups.
  • the linker is a C6 amino alkyl group.
  • hepatitis B virus or “HBV” refers to a member of the Hepadnaviridae family having a small double-stranded DNA genome of approximately 3,200 base pairs and a tropism for liver cells. “HBV” includes hepatitis B virus that infects any of a variety of mammalian (e.g., human, non-human primate, etc.) and avian (duck, etc.) hosts.
  • mammalian e.g., human, non-human primate, etc.
  • avian duck, etc.
  • HBV includes any known HBV genotype, e.g., serotype A, B, C, D, E, F, and G; any HBV serotype or HBV subtype; any HBV isolate; HBV variants, e.g., HBeAg-negative variants, drug-resistant HBV variants (e.g., lamivudine-resistant variants; adefovir-resistant mutants; tenofovir-resistant mutants; entecavir-resistant mutants; etc.); and the like.
  • HBV genotype e.g., serotype A, B, C, D, E, F, and G
  • HBV serotype or HBV subtype e.g., HBeAg-negative variants
  • drug-resistant HBV variants e.g., lamivudine-resistant variants; adefovir-resistant mutants; tenofovir-resistant mutants; entecavir-resistant mutants; etc.
  • HBV is a small DNA virus belonging to the Hepadnaviridae family and classified as the type species of the genus Orthohepadnavirus.
  • HBV virus particles comprise an outer lipid envelope and an icosahedral nucleocapsid core composed of protein.
  • the nucleocapsid generally encloses viral DNA and a DNA polymerase that has reverse transcriptase activity similar to retroviruses.
  • the HBV outer envelope contains embedded proteins which are involved in viral binding of, and entry into, susceptible cells. HBV, which attacks the liver, has been classified according to at least ten genotypes (A-J) based on sequence.
  • genes there are four genes encoded by the genome, which genes are referred to as C, P, S, and X.
  • the core protein is encoded by gene C (HBcAg), and its start codon is preceded by an upstream in-frame AUG start codon from which the pre-core protein is produced.
  • HBeAg is produced by proteolytic processing of the pre-core protein.
  • the DNA polymerase is encoded by gene P.
  • Gene S encodes surface antigen (HBsAg).
  • the HBsAg gene is one long open reading frame but contains three in frame "start" (ATG) codons that divide the gene into three sections, pre-S1, pre-S2, and S.
  • polypeptides of three different sizes called large, middle, and small (pre-S1 + pre-S2 + S, pre-S2 + S, or S) are produced. These may have a ratio of 1 :1 :4 (Heermann et al, 1984).
  • Hepatitis B Virus (HBV) proteins can be organized into several categories and functions. Polymerases function as a reverse transcriptase (RT) to make viral DNA from pregenomic RNA (pgRNA), and also as a DNA-dependent polymerase to make covalently closed circular DNA (cccDNA) from viral DNA. They are covalently attached to the 5' end of the minus strand. Core proteins make the viral capsid and the secreted E antigen. Surface antigens are the hepatocyte internalization ligands, and also the primary component of aviral spherical and filamentous particles. Aviral particles are produced >1000-fold over Dane particles (infectious virions) and may act as immune decoys.
  • RT reverse transcriptase
  • pgRNA pregenomic RNA
  • cccDNA covalently closed circular DNA
  • Core proteins make the viral capsid and the secreted E antigen.
  • Surface antigens are the hepatocyte internalization ligand
  • hepatitis B virus surface antigen or “HBsAg” refers to an S- domain protein encoded by gene S (e.g., ORF S) of an HBV genome.
  • Hepatitis B virus particles carry viral nucleic acid in core particles enveloped by three proteins encoded by gene S, which are the large surface, middle surface, and major surface proteins.
  • the major surface protein is generally about 226 amino acids and contains just the S-domain.
  • Hepatitis B e Antigen HBeAg
  • Hepatitis B e antigen or “HBeAg” is an indicator of viral replication, although some variant forms of the virus do not express HBeAg. Active infection can be described as HBeAg-positive or HBeAg-negative according to whether HBeAg is secreted.
  • infection refers to the pathogenic invasion and/or expansion of microorganisms, such as viruses, in a subject.
  • An infection may be lysogenic, e.g., in which viral DNA lies dormant within a cell.
  • an infection may be lytic, e.g., in which the virus actively proliferates and causes destruction of infected cells.
  • An infection may or may not cause clinically apparent symptoms.
  • An infection may remain localized, or it may spread, e.g., through a subject’s blood or lymphatic system.
  • An individual having, for example, an HBV infection can be identified by detecting one or more of viral load, surface antigen (HBsAg), e-antigen (HBeAg), and various other assays for detecting HBV infection known in the art.
  • Assays for detection of HBV infection can involve testing serum or blood samples for the presence of HBsAg and/or HBeAg, and optionally further screening for the presence of one or more viral antibodies (e.g., IgM and/or IgG) to compensate for any periods in which an HBV antigen may be at an undetectable level.
  • hepatitis B virus infection or “HBV infection” is commonly known in the art and refers to an infectious disease that is caused by the hepatitis B virus (HBV) and affects the liver.
  • a HBV infection can be an acute or a chronic infection.
  • Some infected persons have no symptoms during the initial infection and some develop a rapid onset of sickness with vomiting, yellowish skin, tiredness, dark urine and abdominal pain (“Hepatitis B Fact sheet N°204”. who.int. July 2014. Retrieved 4 November 2014). Often these symptoms last a few weeks and can result in death. It may take 30 to 180 days for symptoms to begin.
  • HBV infection includes the acute and chronic hepatitis B infection.
  • HBV infection also includes the asymptotic stage of the initial infection, the symptomatic stages, as well as the asymptotic chronic stage of the HBV infection.
  • liver inflammation refers to a physical condition in which the liver becomes swollen, dysfunctional, and/or painful, especially as a result of injury or infection, as may be caused by exposure to a hepatotoxic agent. Symptoms may include jaundice (yellowing of the skin or eyes), fatigue, weakness, nausea, vomiting, appetite reduction, and weight loss. Liver inflammation, if left untreated, may progress to fibrosis, cirrhosis, liver failure, or liver cancer.
  • liver fibrosis refers to an excessive accumulation in the liver of extracellular matrix proteins, which could include collagens (I, III, and IV), fibronectin, undulin, elastin, laminin, hyaluronan, and proteoglycans resulting from inflammation and liver cell death. Liver fibrosis, if left untreated, may progress to cirrhosis, liver failure, or liver cancer.
  • extracellular matrix proteins which could include collagens (I, III, and IV), fibronectin, undulin, elastin, laminin, hyaluronan, and proteoglycans resulting from inflammation and liver cell death.
  • Liver fibrosis if left untreated, may progress to cirrhosis, liver failure, or liver cancer.
  • TLR7 refers to the Toll-like receptor 7 of any species of origin (e.g., human, murine, woodchuck etc.). TLR7 agonist
  • TLR7 agonist refers to a compound that acts as an agonist of TLR7.
  • a TLR7 agonist can include the compound in any pharmaceutically acceptable form, including any isomer (e.g., diastereomer or enantiomer), salt, solvate, polymorph, and the like.
  • the TLR agonism for a particular compound may be determined in any suitable manner. For example, assays for detecting TLR agonism of test compounds are described, for example, in U.S. Provisional Patent Application Ser. No. 60/432,650, filed Dec. 11 , 2002, and recombinant cell lines suitable for use in such assays are described, for example, in U.S. Provisional Patent Application Ser. No.
  • a further assay for evaluating TLR7 agonists is the HEK293-Blue-hTLR-7 cell assay described in Example 43 of WO2016/091698 (the assay is hereby incorporated by reference).
  • diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, activities and reactivities.
  • Racemates can be separated according to known methods into the enantiomers.
  • diastereomeric salts which can be separated by crystallization are formed from the racemic mixtures by reaction with an optically active acid such as e.g. D- or L-tartaric acid, mandelic acid, malic acid, lactic acid or camphorsulfonic acid.
  • the compounds according to the present invention may exist in the form of their pharmaceutically acceptable salts.
  • salts refers to those salts which retain the biological effectiveness and properties of the free bases or free acids, which are not biologically or otherwise undesirable.
  • the salts are formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, particularly hydrochloric acid, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid, N-acetylcystein.
  • salts derived from an inorganic base include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium salts.
  • Salts derived from organic bases include, but are not limited to salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, ethanolamine, lysine, arginine, N-ethylpiperidine, piperidine, polyamine resins.
  • the compound of formula (I) can also be present in the form of zwitterions.
  • Particularly preferred pharmaceutically acceptable salts of compounds of formula (I) are the salts of hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid and methanesulfonic acid.
  • the chemical modification of a pharmaceutical compound into a salt is a technique well known to pharmaceutical chemists in order to obtain improved physical and chemical stability, hygroscopicity, flowability and solubility of compounds. It is for example described in Bastin, Organic Process Research & Development 2000, 4, 427-435 or in Ansel, In: Pharmaceutical Dosage Forms and Drug Delivery Systems, 6th ed. (1995), pp. 196 and 1456-1457.
  • the pharmaceutically acceptable salt of the compounds provided herein may be a sodium salt.
  • a pharmaceutical combination is understood as the combination at least two different HBV therapeutics, e.g. active compounds or prodrugs (medical compounds or medicaments), for treatment of a disease.
  • a pharmaceutical combination can involve compounds that are physically, chemically, or otherwise combined (e.g., in the same vial); compounds that are packaged together (e.g., as two separate objects in the same package (kit of parts) either for simultaneous administration or separate administration); or compounds that are provided separately but intended to be used together (e.g. the combination is expressly stated on the compound label, instructions or package insert).
  • the pharmaceutical combination consists of a medical compound formulated for oral administration and a medical compound formulated for subcutaneous injection.
  • administering means to provide a substance (e.g., a pharmaceutical combination or an oligonucleotide) to a subject in a manner that is pharmacologically useful (e.g., to treat a condition in the subject).
  • a substance e.g., a pharmaceutical combination or an oligonucleotide
  • ASGPR As used herein, the term “Asialoglycoprotein receptor” or “ASGPR” refers to a bipartite C- type lectin formed by a major 48 kDa (ASGPR-1) and minor 40 kDa subunit (ASGPR-2). ASGPR is primarily expressed on the sinusoidal surface of hepatocyte cells and has a major role in binding, internalization, and subsequent clearance of circulating glycoproteins that contain terminal galactose or N-acetylgalactosamine residues (asialoglycoproteins).
  • prodrug refers to a form or derivative of a compound which is metabolized in vivo, e.g., by biological fluids or enzymes by a subject after administration, into a pharmacologically active form of the compound in order to produce the desired pharmacological effect.
  • Prodrugs are described e.g. in the Organic Chemistry of Drug Design and Drug Action by Richard B. Silverman, Academic Press, San Diego, 2004, Chapter 8 Prodrugs and Drug Delivery Systems, pp. 497-558.
  • the term “subject” means any mammal, including mice, rabbits, and humans. In one embodiment, the subject is a human or non-human primate.
  • the terms “individual” or “patient” may be used interchangeably with “subject.” Treatment
  • treatment generally mean obtaining a desired pharmacological and/or physiological effect.
  • This effect is therapeutic in terms of partially or completely curing a disease and/or adverse effect attributed to the disease.
  • the effect is provided through the administration a therapeutic agent (e.g., a pharmaceutical combination or an oligonucleotide) to the subject, for purposes of improving the health and/or well-being of the subject with respect to an existing condition (e.g., an existing HBV infection) or to prevent or decrease the likelihood of the occurrence of a condition (e.g., preventing liver fibrosis, hepatitis, liver cancer or other condition associated with an HBV infection).
  • an existing condition e.g., an existing HBV infection
  • a condition e.g., preventing liver fibrosis, hepatitis, liver cancer or other condition associated with an HBV infection.
  • treatment covers any treatment of HBV infection in a subject and includes: (a) inhibiting the disease, i.e. arresting its development like the inhibiting of increase of HBsAg and/or HBeAg; or (b) ameliorating (i.e. relieving) the disease, i.e. causing regression of the disease, like the repression of HBsAg and/or HBeAg production.
  • a compound or compound combination that ameliorates and/or inhibits a HBV infection is a compound or compound combination that treats a HBV invention.
  • the term “treatment” as used herein relates to medical intervention of an already manifested disorder, like the treatment of an already defined and manifested HBV infection, in particular a chronic HBV infection.
  • treatment involves reducing the frequency or severity of at least one sign, symptom or contributing factor of a condition (e.g., HBV infection or related condition) experienced by a subject.
  • a condition e.g., HBV infection or related condition
  • a subject may exhibit symptoms such as yellowing of the skin and eyes (jaundice), dark urine, extreme fatigue, nausea, vomiting and abdominal pain.
  • a treatment e.g. a pharmaceutical combination, provided herein may result in a reduction in the frequency or severity of one or more of such symptoms.
  • HBV infection can develop into one or more liver conditions, such as cirrhosis, liver fibrosis, liver inflammation or liver cancer.
  • a treatment, e.g. pharmaceutical combination, provided herein may result in a reduction in the frequency or severity of, or prevent or attenuate, one or more of such conditions.
  • therapeutically effective amount denotes an amount of a compound the pharmaceutical combination of the present invention that, when administered to a subject, (i) treats or prevents the particular disease, condition or disorder, (ii) attenuates, ameliorates or eliminates one or more symptoms of the particular disease, condition, or disorder, or (iii) prevents or delays the onset of one or more symptoms of the particular disease, condition or disorder described herein.
  • the therapeutically effective amount will vary depending on the compound, the disease state being treated, the severity of the disease treated, the age and relative health of the subject, the route and form of administration, the judgement of the attending medical or veterinary practitioner, and other factors.
  • excipient refers to a non-therapeutic agent that may be included in one or more of the compositions comprising a medicament which is part of a pharmaceutical combination, for example, to provide or contribute to a desired consistency or stabilizing effect.
  • the present invention relates to pharmaceutical combinations comprising at least two HBV therapeutics. More particularly, the present invention relates to a pharmaceutical combination comprising an RNAi oligonucleotide targeting HBV and an anti-PDL1 antisense oligonucleotide as defined herein.
  • a therapeutic used in the pharmaceutical combination of the present invention is an RNAi oligonucleotide targeting HBV that can be used to achieve a therapeutic benefit.
  • This RNAi oligonucleotide is capable of reducing the expression of HBsAg mRNA.
  • the RNAi oligonucleotide in the pharmaceutical combination of the present invention is an oligonucleotide targeting HBsAg mRNA.
  • the RNAi oligonucleotide in the pharmaceutical combination of the present invention is an oligonucleotide which targets HBsAg mRNA, thereby reducing the expression of HBsAg mRNA.
  • RNAi oligonucleotides provided herein, in some embodiments, are designed to target HBsAg mRNA sequences covering >95% of known HBV genomes across all known genotypes. In some embodiments, such oligonucleotides when used as part of a pharmaceutical combination of the invention result in more than 90% reduction of HBV pre-genomic RNA (pgRNA) and HBsAg mRNAs in liver. In some embodiments, the reduction in HBsAg expression persists for an extended period of time following a treatment regimen of the pharmaceutical combination.
  • RNAi oligonucleotides provided herein are designed so as to have regions of complementarity to HBsAg mRNA for purposes of targeting the transcripts in cells and inhibiting their expression.
  • the region of complementarity is generally of a suitable length and base content to enable annealing of the oligonucleotide (or a strand thereof) to HBsAg mRNA for purposes of inhibiting its expression.
  • the region of complementarity is at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19 or at least 20 nucleotides in length.
  • an oligonucleotide provided herein has a region of complementarity to HBsAg mRNA that is in the range of 12 to 30 (e.g., 12 to 30, 12 to 22, 15 to 25, 17 to 21 , 18 to 27, 19 to 27, or 15 to 30) nucleotides in length.
  • an RNAi oligonucleotide provided herein has a region of complementarity to HBsAg mRNA that is 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides in length.
  • RNAi oligonucleotides provided herein are designed to target mRNA sequences encoding HBsAg.
  • an RNAi oligonucleotide that has an antisense strand having a region of complementarity to a sequence set forth as: ACAANAAUCCUCACAAUA (SEQ ID NO: 1), which N refers to any nucleotide (A, G, T/U, or C).
  • the oligonucleotide further comprises a sense strand that forms a duplex region with the antisense strand.
  • the sense strand has a region of complementarity to a sequence set forth as: UUNUUGUGAGGAUUN (SEQ ID NO: 2).
  • the sense strand comprises a region of complementarity to a sequence as set forth in (shown 5' to 3'): UUAUUGUGAGGAUUNUUGUC (SEQ ID NO: 3).
  • the antisense strand comprises, or consists of, a sequence set forth as: UUAUUGUGAGGAUUNUUGUCGG (SEQ ID NO: 4). In some embodiments, the antisense strand comprises, or consists of, a sequence set forth as: UUAUUGUGAGGAUUCUUGUCGG (SEQ ID NO: 5). In some embodiments, the antisense strand comprises, or consists of, a sequence set forth as: UUAUUGUGAGGAUUUUUGUCGG (SEQ ID NO: 6). In some embodiments, the sense strand comprises, or consists of, a sequence set forth as: ACAANAAUCCUCACAAUAA (SEQ ID NO: 7).
  • the sense strand comprises, or consists of, a sequence set forth as: GACAANAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 8). In some embodiments, the sense strand comprises, or consists of, a sequence set forth as: GACAAAAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 9). In some embodiments, the sense strand comprises, or consists of, a sequence set forth as: GACAAGAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 10).
  • the RNAi oligonucleotide for reducing expression of HBsAg mRNA comprises a sense strand forming a duplex region with an antisense strand, where the sense strand comprises a sequence as set forth in any one of SEQ ID NOs: 7-10, and the antisense strand comprises a sequence as set forth in any one of SEQ ID NOs: 4-6.
  • the sense strand comprises 2'-fluoro and 2'-O-methyl modified nucleotides and at least one phosphorothioate internucleotide linkage.
  • the sense strand is conjugated to an N-acetylgalactosamine (GalNAc) moiety.
  • the antisense strand comprises 2'-fluoro and 2'-O-methyl modified nucleotides and at least one phosphorothioate internucleotide linkage.
  • the 4'-carbon of the sugar of the 5'-nucleotide of the antisense strand comprises a phosphate analog.
  • each of the antisense strand and the sense strand comprises 2'-fluoro and 2'-O-methyl modified nucleotides and at least one phosphorothioate internucleotide linkage, where the 4'-carbon of the sugar of the 5'- nucleotide of the antisense strand comprises a phosphate analog, and the sense strand is conjugated to an N-acetylgalactosamine (GalNAc) moiety.
  • GalNAc N-acetylgalactosamine
  • a sense strand comprising a sequence as set forth in any one of SEQ ID NOs: 8-10 comprises 2'-fluoro modified nucleotides at positions 3, 8-10, 12, 13, and 17.
  • the sense strand comprises 2'-O-methyl modified nucleotides at positions 1 , 2, 4-7, 11, 14-16, 18-26, and 31-36.
  • the sense strand comprises one phosphorothioate internucleotide linkage.
  • the sense strand comprises a phosphorothioate internucleotide linkage between nucleotides at positions 1 and 2.
  • the sense strand is conjugated to an N- acetylgalactosamine (GalNAc) moiety.
  • an antisense strand comprising a sequence as set forth in any one of SEQ ID NOs: 4-6 comprises 2'-fluoro modified nucleotides at positions 2, 3, 5, 7, 8, 10, 12, 14, 16, and 19. In some embodiments, the antisense strand comprises 2'-O-methyl modified nucleotides at positions 1, 4, 6, 9, 11, 13, 15, 17, 18, and 20-22. In some embodiments, the antisense strand comprises three phosphorothioate internucleotide linkages.
  • the antisense strand comprises phosphorothioate internucleotide linkages between nucleotides at positions 1 and 2, between nucleotides at positions 2 and 3, between nucleotides at positions 3 and 4, between nucleotides at positions 20 and 21, and between nucleotides at positions 21 and 22.
  • the 4'-carbon of the sugar of the 5'-nucleotide of the antisense strand comprises a phosphate analog.
  • the RNAi oligonucleotide is an oligonucleotide comprising an antisense strand of 19 to 30 nucleotides in length, wherein the antisense strand comprises a region of complementarity to a sequence of HBsAg mRNA set forth as ACAANAAUCCUCACAAUA (SEQ ID NO: 1) (N can refer to any nucleotide A, G, C or T/ll).
  • the oligonucleotide further comprises a sense strand that forms a duplex region with the antisense strand.
  • the sense strand has a region of complementarity to the sequence set forth as UUNUUGUGAGGAUUN (SEQ ID NO: 2). In some embodiments, the sense strand comprises a region of complementarity to a sequence as set forth as (shown 5' to 3') UUAUUGUGAGGAUUNUUGUC (SEQ ID NO: 3).
  • the RNAi oligonucleotide in the pharmaceutical combination of the present invention is an oligonucleotide for reducing expression of hepatitis B virus surface antigen (HBsAg) mRNA, the oligonucleotide comprising a sense strand forming a duplex region with an antisense strand, wherein: the sense strand consists of a sequence GACAAAAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 9) and comprising 2'-fluoro modified nucleotides at positions 3, 8-10, 12, 13, and 17, 2'-O-methyl modified nucleotides at positions 1, 2, 4-7, 11, 14-16, 18-26, and 31-36, and a phosphorothioate linkage between the nucleotides at positions 1 and 2, wherein each of the nucleotides of the -GAAA- sequence on the sense strand is conjugated to a monovalent GalNac moiety; and the antisense strand
  • the RNAi oligonucleotide in the pharmaceutical combination of the present invention is an oligonucleotide comprising a sense strand forming a duplex region with an antisense strand, wherein: the sense strand comprises a sequence
  • GACAAAAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 9) and comprising 2'-fluoro modified nucleotides at positions 3, 8-10, 12, 13, and 17, 2'-O-methyl modified nucleotides at positions 1 , 2, 4-7, 11, 14-16, 18-26, and 31-36, and one phosphorothioate internucleotide linkage between the nucleotides at positions 1 and 2, wherein each of the nucleotides of the -GAAA- sequence on the sense strand is conjugated to a monovalent GalNac moiety, wherein the -GAAA- sequence comprises the structure: the antisense strand comprises a sequence as set forth in
  • RNAi oligonucleotide targeting HBV used in the pharmaceutical combinations of the present invention is referred to herein as “T1” or “Therapeutic T1”.
  • T1 may be further defined as the molecule in Figure 5.
  • the RNAi oligonucleotide is administered subcutaneously.
  • the RNAi oligonucleotide is administered at an initial dose of about 0.1 mg/kg to about 12 mg/kg, preferably of about 0.1 mg/kg to about 9 mg/kg, more preferably of about 0.5 mg/kg to about 7 mg/kg, more preferably of about 0.5 mg/kg to about 6.5 mg/kg, more preferably of about 1 mg/kg to about 6 mg/kg, more preferably of about 1.5 mg/kg to about 6 mg/kg, more preferably of about 2 mg/kg to about 6 mg/kg, most preferably of about 3 mg/kg or about 6 mg/kg.
  • the RNAi oligonucleotide is administered at an initial dose of from about 6 to about 800 mg, preferably about 100 mg, about 200 mg or about 400 mg.
  • the initial dose is a single dose or is the only dose administered.
  • one or more subsequent doses of the RNAi oligonucleotide in an amount that is from about 0.1 mg/kg to about 12 mg/kg are administered. In an embodiment, the subsequent dose(s) is about 1.5 mg/kg, about 3 mg/kg or about 6 mg/kg.
  • one or more subsequent doses of the oligonucleotide in an amount that is from about 6 mg to about 800 mg is administered. In an embodiment, the subsequent dose(s) is about 100 mg, about 200 mg or about 400 mg.
  • each dose is administered at least about once every two weeks, at least about once every three weeks, at least about once every four weeks, at least about once every five weeks, at least about once every six weeks, at least about once every seven weeks, or at least about once every eight weeks.
  • the doses are separated in time from each other by at least about four weeks.
  • doses of about 1 mg/kg to 6 mg/kg are administered, each separated by at least about four weeks.
  • the doses are separated in time from each other by about four weeks and are administered over a period of about 48 weeks, about 24 weeks, about three months or about 12 weeks.
  • the period of time between each of the doses is independently selected from the group consisting of: about four weeks, about one month, about two months, about three months or about six months.
  • RNAi oligonucleotide targeting HBV in the pharmaceutical combinations of the present invention are provided below.
  • Double-stranded oligonucleotides for targeting HBV antigen expression (e.g., via the RNAi pathway) generally have a sense strand and an antisense strand that form a duplex with one another.
  • the sense and antisense strands are not covalently linked.
  • the sense and antisense strands are covalently linked.
  • double-stranded oligonucleotides for reducing the expression of HBsAg mRNA expression engage RNA interference (RNAi).
  • RNAi oligonucleotides have been developed with each strand having sizes of 19- 25 nucleotides with at least one 3’ overhang of 1 to 5 nucleotides (see, e.g., U.S. Patent No. 8,372,968). Longer oligonucleotides have also been developed that are processed by Dicer to generate active RNAi products (see, e.g., U.S. Patent No. 8,883,996).
  • extended double-stranded oligonucleotides where at least one end of at least one strand is extended beyond a duplex targeting region, including structures where one of the strands includes a thermodynamically-stabilizing tetraloop structure (see, e.g., U.S. Patent Nos. 8,513,207 and 8,927,705, as well as WO2010033225, which are incorporated by reference herein for their disclosure of these oligonucleotides).
  • Such structures may include single-stranded extensions (on one or both sides of the molecule) as well as doublestranded extensions.
  • oligonucleotides provided herein are cleavable by Dicer enzymes. Such oligonucleotides may have an overhang (e.g., of 1 , 2, or 3 nucleotides in length) in the 3’ end of the sense strand. Such oligonucleotides (e.g., siRNAs) may comprise a 21 nucleotide guide strand that is antisense to a target RNA and a complementary passenger strand, in which both strands anneal to form a 19-bp duplex and 2 nucleotide overhangs at either or both 3’ ends.
  • siRNAs e.g., siRNAs
  • oligonucleotide designs are also available including oligonucleotides having a guide strand of 23 nucleotides and a passenger strand of 21 nucleotides, where there is a blunt end on the right side of the molecule (3'-end of passenger strand/5'-end of guide strand) and a two nucleotide 3'-guide strand overhang on the left side of the molecule (5'-end of the passenger strand/3'-end of the guide strand). In such molecules, there is a 21 base pair duplex region. See, for example, US9012138, US9012621, and US9193753, each of which are incorporated herein for their relevant disclosures.
  • oligonucleotides as disclosed herein may comprise sense and antisense strands that are both in the range of 17 to 26 (e.g., 17 to 26, 20 to 25, 19 to 21 or 21-23) nucleotides in length.
  • the sense and antisense strands are of equal length.
  • a 3’ overhang on the sense, antisense, or both sense and antisense strands is 1 or 2 nucleotides in length.
  • the oligonucleotide has a guide strand of 23 nucleotides and a passenger strand of 21 nucleotides, where there is a blunt end on the right side of the molecule (3'-end of passenger strand/5'-end of guide strand) and a two nucleotide 3'-guide strand overhang on the left side of the molecule (5'-end of the passenger strand/3'-end of the guide strand). In such molecules, there is a 21 base pair duplex region.
  • an oligonucleotide comprises a 25 nucleotide sense strand and a 27 nucleotide antisense strand that when acted upon by a dicer enzyme results in an antisense strand that is incorporated into the mature RISC.
  • oligonucleotide designs for use with the compositions and methods disclosed herein include: 16-mer siRNAs (see, e.g., Nucleic Acids in Chemistry and Biology. Blackburn (ed.), Royal Society of Chemistry, 2006), shRNAs (e.g., having 19 bp or shorter stems; see, e.g., Moore et al. Methods Mol. Biol. 2010; 629:141-158), blunt siRNAs (e.g., of 19 bps in length; see: e.g., Kraynack and Baker, RNA Vol. 12, p163-176 (2006)), asymmetrical siRNAs (aiRNA; see, e.g., Sun et al., Nat. Biotechnol.
  • siRNAs see, e.g., Nucleic Acids in Chemistry and Biology. Blackburn (ed.), Royal Society of Chemistry, 2006
  • shRNAs e.g., having 19 bp or shorter stems; see, e.g.
  • oligonucleotide structures that may be used in some embodiments in a pharmaceutical combination to reduce or inhibit the expression of HBsAg are microRNA (miRNA), short hairpin RNA (shRNA), and short siRNA (see, e.g., Hamilton et al., Embo J., 2002, 21(17): 4671-4679; see also U.S. Application No. 20090099115).
  • miRNA microRNA
  • shRNA short hairpin RNA
  • siRNA see, e.g., Hamilton et al., Embo J., 2002, 21(17): 4671-4679; see also U.S. Application No. 20090099115.
  • an antisense strand of an oligonucleotide may be referred to as a “guide strand”.
  • a guide strand For example, if an antisense strand can engage with RNA-induced silencing complex (RISC) and bind to an Argonaut protein, or engage with or bind to one or more similar factors, and direct silencing of a target gene, it may be referred to as a guide strand.
  • RISC RNA-induced silencing complex
  • a sense strand complementary with a guide strand may be referred to as a “passenger strand”.
  • an oligonucleotide provided herein comprises an antisense strand that is up to 50 nucleotides in length (e.g., up to 30, up to 27, up to 25, up to 21 , or up to 19 nucleotides in length). In some embodiments, an oligonucleotide provided herein comprises an antisense strand that is at least 12 nucleotides in length (e.g., at least 12, at least 15, at least 19, at least 21, at least 25, or at least 27 nucleotides in length).
  • an antisense strand of an oligonucleotide disclosed herein is in the range of 12 to 50 or 12 to 30 (e.g., 12 to 30, 11 to 27, 11 to 25, 15 to 21 , 15 to 27, 17 to 21 , 17 to 25, 19 to 27, or 19 to 30) nucleotides in length.
  • an antisense strand of any one of the oligonucleotides disclosed herein is 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleotides in length.
  • a double-stranded oligonucleotide may have a sense strand of up to 40 nucleotides in length (e.g., up to 40, up to 35, up to 30, up to 27, up to 25, up to 21 , up to 19, up to 17, or up to 12 nucleotides in length).
  • an oligonucleotide may have a sense strand of at least 12 nucleotides in length (e.g., at least 12, at least 15, at least 19, at least 21, at least 25, at least 27, at least 30, at least 35, or at least 38 nucleotides in length).
  • an oligonucleotide may have a sense strand in a range of 12 to 50 (e.g., 12 to 40, 12 to 36, 12 to 32, 12 to 28, 15 to 40, 15 to 36, 15 to 32, 15 to 28, 17 to 21 , 17 to 25, 19 to 27, 19 to 30, 20 to 40, 22 to 40, 25 to 40, or 32 to 40) nucleotides in length.
  • an oligonucleotide may have a sense strand of 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 nucleotides in length.
  • a sense strand of an oligonucleotide is longer than 27 nucleotides (e.g., 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39 or 40 nucleotides). In some embodiments, a sense strand of an oligonucleotide is longer than 25 nucleotides (e.g., 26, 27, 28, 29 or 30 nucleotides).
  • a sense strand comprises a stem-loop at its 3'-end. In some embodiments, a sense strand comprises a stem-loop at its 5'-end. In some embodiments, a strand comprising a stem loop is in the range of 2 to 66 nucleotides long (e.g., 2 to 66, 10 to 52, 14 to 40, 2 to 30, 4 to 26, 8 to 22, 12 to 18, 10 to 22, 14 to 26, or 14 to 30 nucleotides long). In some embodiments, a strand comprising a stem loop is 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
  • a stem comprises a duplex of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, or 14 nucleotides in length.
  • a stem-loop provides the molecule better protection against degradation (e.g., enzymatic degradation) and facilitates targeting characteristics for delivery to a target cell.
  • a loop provides added nucleotides on which modification can be made without substantially affecting the gene expression inhibition activity of an oligonucleotide.
  • an oligonucleotide in which the sense strand comprises (e.g., at its 3'-end) a stem-loop set forth as: S1-L-S2, in which Si is complementary to S2, and in which L forms a loop between Si and S2 of up to 10 nucleotides in length (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides in length).
  • a loop (L) of a stem-loop is a tetraloop (e.g., within a nicked tetraloop structure).
  • a tetraloop may contain ribonucleotides, deoxyribonucleotides, modified nucleotides, and combinations thereof.
  • a tetraloop has 4 to 5 nucleotides.
  • a duplex formed between a sense and antisense strand is at least 12 (e.g., at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, or at least 21) nucleotides in length. In some embodiments, a duplex formed between a sense and antisense strand is in the range of 12-30 nucleotides in length (e.g., 12 to 30, 12 to 27, 12 to 22, 15 to 25, 18 to 30, 18 to 22, 18 to 25, 18 to 27, 18 to 30, 19 to 30 or 21 to 30 nucleotides in length).
  • a duplex formed between a sense and antisense strand is 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length. In some embodiments a duplex formed between a sense and antisense strand does not span the entire length of the sense strand and/or antisense strand. In some embodiments, a duplex between a sense and antisense strand spans the entire length of either the sense or antisense strands. In certain embodiments, a duplex between a sense and antisense strand spans the entire length of both the sense strand and the antisense strand. d. Oligonucleotide Ends
  • an oligonucleotide comprises sense and antisense strands, such that there is a 3’-overhang on either the sense strand or the antisense strand, or both the sense and antisense strand.
  • oligonucleotides provided herein have one 5’ end that is thermodynamically less stable compared to the other 5’ end.
  • an asymmetry oligonucleotide is provided that includes a blunt end at the 3’ end of a sense strand and an overhang at the 3’ end of an antisense strand.
  • a 3’ overhang on an antisense strand is 1-8 nucleotides in length (e.g., 1, 2, 3, 4, 5, 6, 7 or 8 nucleotides in length).
  • an oligonucleotide for RNAi has a two nucleotide overhang on the 3’ end of the antisense (guide) strand.
  • an overhang is a 3' overhang comprising a length of between one and six nucleotides, optionally one to five, one to four, one to three, one to two, two to six, two to five, two to four, two to three, three to six, three to five, three to four, four to six, four to five, five to six nucleotides, or one, two, three, four, five or six nucleotides.
  • the overhang is a 5' overhang comprising a length of between one and six nucleotides, optionally one to five, one to four, one to three, one to two, two to six, two to five, two to four, two to three, three to six, three to five, three to four, four to six, four to five, five to six nucleotides, or one, two, three, four, five or six nucleotides.
  • one or more (e.g., 2, 3, 4) terminal nucleotides of the 3’ end or 5’ end of a sense and/or antisense strand are modified.
  • one or two terminal nucleotides of the 3’ end of an antisense strand are modified.
  • the last nucleotide at the 3' end of an antisense strand is modified, e.g., comprises 2’-modification, e.g., a 2’-O-methoxyethyl.
  • the last one or two terminal nucleotides at the 3’ end of an antisense strand are complementary with the target.
  • the last one or two nucleotides at the 3’ end of the antisense strand are not complementary with the target.
  • a double stranded oligonucleotide that has a nicked tetraloop structure at the 3’ end sense strand, and two terminal overhang nucleotides at the 3’ end of its antisense strand.
  • the two terminal overhang nucleotides are GG.
  • one or both of the two terminal GG nucleotides of the antisense strand is or are not complementary with the target.
  • the 5’ end and/or the 3’ end of a sense or antisense strand has an inverted cap nucleotide.
  • one or more (e.g., 2, 3, 4, 5, 6) modified internucleotide linkages are provided between terminal nucleotides of the 3’ end or 5’ end of a sense and/or antisense strand.
  • modified internucleotide linkages are provided between overhang nucleotides at the 3’ end or 5’ end of a sense and/or antisense strand.
  • an oligonucleotide may have one or more (e.g., 1 , 2, 3, 4, 5) mismatches between a sense and antisense strand. If there is more than one mismatch between a sense and antisense strand, they may be positioned consecutively (e.g., 2, 3 or more in a row), or interspersed throughout the region of complementarity.
  • the 3’- terminus of the sense strand contains one or more mismatches. In one embodiment, two mismatches are incorporated at the 3’ terminus of the sense strand.
  • base mismatches or destabilization of segments at the 3’-end of the sense strand of the oligonucleotide improved the potency of synthetic duplexes in RNAi, possibly through facilitating processing by Dicer.
  • an antisense strand may have a region of complementarity to an HBsAg transcript that contains one or more mismatches compared with a corresponding transcript sequence.
  • a region of complementarity on an oligonucleotide may have up to 1, up to 2, up to 3, up to 4, up to 5, etc. mismatches provided that it maintains the ability to form complementary base pairs with the transcript under appropriate hybridization conditions.
  • a region of complementarity of an oligonucleotide may have no more than 1, no more than 2, no more than 3, no more than 4, or no more than 5 mismatches provided that it maintains the ability to form complementary base pairs with HBsAg mRNA under appropriate hybridization conditions.
  • oligonucleotide may be positioned consecutively (e.g., 2, 3, 4, or more in a row), or interspersed throughout the region of complementarity provided that the oligonucleotide maintains the ability to form complementary base pairs with HBsAg mRNA under appropriate hybridization conditions.
  • an RNAi oligonucleotide for reducing HBsAg expression as described herein is a single-stranded oligonucleotide having complementarity with HBsAg mRNA.
  • Such structures may include, but are not limited to single-stranded RNAi oligonucleotides. Recent efforts have demonstrated the activity of single-stranded RNAi oligonucleotides (see, e.g., Matsui et al. (May 2016), Molecular Therapy, Vol. 24(5), 946- 955).
  • RNAi oligonucleotide may technically be considered an antisense oligonucleotide, it can still function through the mechanism of RNA interference and will have the characteristics as described herein for an RNAi oligonucleotide.
  • Oligonucleotides may be modified in various ways to improve or control specificity, stability, delivery, bioavailability, resistance from nuclease degradation, immunogenicity, base-paring properties, RNA distribution and cellular uptake and other features relevant to therapeutic or research use. See, e.g., Bramsen et al., Nucleic Acids Res., 2009, 37, 2867-2881; Bramsen and Kjems (Frontiers in Genetics, 3 (2012): 1-22). Accordingly, in some embodiments, therapeutic oligonucleotides of the present disclosure may include one or more suitable modifications.
  • a modified nucleotide has a modification in its base (or nucleobase), the sugar (e.g., ribose, deoxyribose), or the phosphate group.
  • oligonucleotides may be delivered in vivo by conjugating them to or encompassing them in a lipid nanoparticle (LNP) or similar carrier.
  • LNP lipid nanoparticle
  • an oligonucleotide is not protected by an LNP or similar carrier, it may be advantageous for at least some of its nucleotides to be modified. Accordingly, in certain embodiments of any of the therapeutic oligonucleotides provided herein, all or substantially all of the nucleotides of an oligonucleotide are modified. In certain embodiments, more than half of the nucleotides are modified.
  • an oligonucleotide as disclosed herein has a number and type of modified nucleotides sufficient to cause the desired characteristic (e.g., protection from enzymatic degradation, capacity to target a desired cell after in vivo administration, and/or thermodynamic stability).
  • a modified sugar (also referred to herein as a sugar analog) includes a modified deoxyribose or ribose moiety, e.g., in which one or more modifications occur at the 2', 3', 4', and/or 5' carbon position of the sugar.
  • a modified sugar may also include non-natural alternative carbon structures such as those present in locked nucleic acids (“LNA”) (see, e.g., Koshkin et al. (1998), Tetrahedron 54, 3607-3630), unlocked nucleic acids (“UNA”) (see, e.g., Snead et al.
  • LNA locked nucleic acids
  • NAA unlocked nucleic acids
  • a nucleotide modification in a sugar comprises a 2'-modification.
  • a 2'-modification may be 2'-aminoethyl, 2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl, and 2'- deoxy-2'-fluoro-p-d-arabinonucleic acid.
  • the modification is 2'-fluoro, 2'-O-methyl, or 2'-O-methoxyethyl.
  • a modification in a sugar comprises a modification of the sugar ring, which may comprise modification of one or more carbons of the sugar ring.
  • a modification of a sugar of a nucleotide may comprise a 2'- oxygen of a sugar is linked to a 1 '-carbon or 4'-carbon of the sugar, or a 2'-oxygen is linked to the T-carbon or 4'-carbon via an ethylene or methylene bridge.
  • a modified nucleotide has an acyclic sugar that lacks a 2'-carbon to 3'-carbon bond.
  • a modified nucleotide has a thiol group, e.g., in the 4' position of the sugar.
  • the terminal 3'-end group (e.g., a 3'-hydroxyl) is a phosphate group or other group, which can be used, for example, to attach linkers, adapters or labels or for the direct ligation of an oligonucleotide to another nucleic acid.
  • 5'-terminal phosphate groups of oligonucleotides enhance the interaction with Argonaut 2.
  • oligonucleotides comprising a 5'-phosphate group may be susceptible to degradation via phosphatases or other enzymes, which can limit their bioavailability in vivo.
  • oligonucleotides include analogs of 5' phosphates that are resistant to such degradation.
  • a phosphate analog may be oxymethylphosphonate, vinylphosphonate, or malonylphosphonate.
  • the 5' end of an oligonucleotide strand is attached to a chemical moiety that mimics the electrostatic and steric properties of a natural 5'-phosphate group (“phosphate mimic”) (see, e.g., Prakash et al. (2015), Nucleic Acids Res., Nucleic Acids Res. 2015 Mar 31; 43(6): 2993-3011, the contents of which relating to phosphate analogs are incorporated herein by reference). Many phosphate mimics have been developed that can be attached to the 5' end (see, e.g., U.S. Patent No. 8,927,513, the contents of which relating to phosphate analogs are incorporated herein by reference).
  • a hydroxyl group is attached to the 5' end of the oligonucleotide.
  • an oligonucleotide has a phosphate analog at a 4'-carbon position of the sugar (referred to as a “4'-phosphate analog”).
  • a 4'-phosphate analog a phosphate analog at a 4'-carbon position of the sugar
  • an oligonucleotide provided herein comprises a 4'- phosphate analog at a 5'-terminal nucleotide.
  • a phosphate analog is an oxymethylphosphonate, in which the oxygen atom of the oxymethyl group is bound to the sugar moiety (e.g., at its 4'-carbon) or analog thereof.
  • a 4'-phosphate analog is a thiomethylphosphonate or an aminomethylphosphonate, in which the sulfur atom of the thiomethyl group or the nitrogen atom of the aminomethyl group is bound to the 4'- carbon of the sugar moiety or analog thereof.
  • a 4'-phosphate analog is an oxymethylphosphonate.
  • an oxymethylphosphonate is represented by the formula -O-CH2-PO(OH)2 or -O-CH2-PO(OR)2, in which R is independently selected from H, CH3, an alkyl group, CH2CH2CN, CH2OCOC(CH3)3, CH2OCH2CH2Si(CH3)3, or a protecting group.
  • R is independently selected from H, CH3, or CH2CH3.
  • a phosphate analog attached to the oligonucleotide is a methoxy phosphonate (MOP). In certain embodiments, a phosphate analog attached to the oligonucleotide is a 5' mono-methyl protected MOP.
  • the following uridine nucleotide comprising a phosphate analog may be used, e.g., at the first position of a guide (antisense) strand: which modified nucleotide is referred to as [MePhosphonate-4O-mU] or 5'-Methoxy, Phosphonate-4'oxy- 2'-O-methyluridine.
  • phosphate modifications or substitutions may result in an oligonucleotide that comprises at least one (e.g., at least 1 , at least 2, at least 3 or at least 5) modified internucleotide linkage.
  • any one of the oligonucleotides disclosed herein comprises 1 to 10 (e.g., 1 to 10, 2 to 8, 4 to 6, 3 to 10, 5 to 10, 1 to 5, 1 to 3 or 1 to 2) modified internucleotide linkages.
  • any one of the oligonucleotides disclosed herein comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 modified internucleotide linkages.
  • a modified internucleotide linkage may be a phosphorothioate linkage, a phosphorothioate linkage, a phosphotriester linkage, a thionoalkylphosphonate linkage, a thionoalkylphosphotriester linkage, a phosphoramidite linkage, a phosphonate linkage or a boranophosphate linkage.
  • at least one modified internucleotide linkage of any one of the oligonucleotides as disclosed herein is a phosphorothioate linkage.
  • oligonucleotides provided herein have one or more modified nucleobases.
  • modified nucleobases also referred to herein as base analogs
  • a modified nucleobase is a nitrogenous base.
  • a modified nucleobase does not contain a nitrogen atom. See e.g., U.S. Published Patent Application No. 20080274462.
  • a modified nucleotide comprises a universal base. However, in certain embodiments, a modified nucleotide does not contain a nucleobase (abasic).
  • a universal base is a heterocyclic moiety located at the T position of a nucleotide sugar moiety in a modified nucleotide, or the equivalent position in a nucleotide sugar moiety substitution that, when present in a duplex, can be positioned opposite more than one type of base without substantially altering the structure of the duplex.
  • a reference single-stranded nucleic acid e.g., oligonucleotide
  • a single-stranded nucleic acid containing a universal base forms a duplex with the target nucleic acid that has a lower T m than a duplex formed with the complementary nucleic acid.
  • the single-stranded nucleic acid containing the universal base forms a duplex with the target nucleic acid that has a higher T m than a duplex formed with the nucleic acid comprising the mismatched base.
  • Non-limiting examples of universal-binding nucleotides include inosine, 1-p-D-ribofuranosyl- 5-nitroindole, and/or 1-p-D-ribofuranosyl-3-nitropyrrole (US Pat. Appl. Publ. No.
  • Reversible modifications can be made such that the molecule retains desirable properties outside of the cell, which are then removed upon entering the cytosolic environment of the cell. Reversible modification can be removed, for example, by the action of an intracellular enzyme or by the chemical conditions inside of a cell (e.g., through reduction by intracellular glutathione).
  • a reversibly modified nucleotide comprises a glutathione-sensitive moiety.
  • nucleic acid molecules have been chemically modified with cyclic disulfide moieties to mask the negative charge created by the internucleotide diphosphate linkages and improve cellular uptake and nuclease resistance.
  • Traversa PCT Publication No. WO 2015/188197 to Solstice Biologies, Ltd.
  • Solstice Meade et al., Nature Biotechnology, 2014, 32:1256-1263
  • such a reversible modification allows protection during in vivo administration (e.g., transit through the blood and/or lysosomal/endosomal compartments of a cell) where the oligonucleotide will be exposed to nucleases and other harsh environmental conditions (e.g., pH).
  • nucleases and other harsh environmental conditions e.g., pH
  • the modification is reversed and the result is a cleaved oligonucleotide.
  • glutathione sensitive moieties it is possible to introduce sterically larger chemical groups into the oligonucleotide of interest as compared to the options available using irreversible chemical modifications.
  • these larger chemical groups will be removed in the cytosol and, therefore, should not interfere with the biological activity of the oligonucleotides inside the cytosol of a cell.
  • these larger chemical groups can be engineered to confer various advantages to the nucleotide or oligonucleotide, such as nuclease resistance, lipophilicity, charge, thermal stability, specificity, and reduced immunogenicity.
  • the structure of the glutathione-sensitive moiety can be engineered to modify the kinetics of its release.
  • a glutathione-sensitive moiety is attached to the sugar of the nucleotide.
  • a glutathione-sensitive moiety is attached to the 2’- carbon of the sugar of a modified nucleotide.
  • the glutathionesensitive moiety is located at the 5’-carbon of a sugar, particularly when the modified nucleotide is the 5’-terminal nucleotide of the oligonucleotide.
  • the glutathione-sensitive moiety is located at the 3’-carbon of a sugar, particularly when the modified nucleotide is the 3’-terminal nucleotide of the oligonucleotide.
  • the glutathione-sensitive moiety comprises a sulfonyl group. See, e.g., U.S.
  • oligonucleotides of the disclosure may be desirable to target the oligonucleotides of the disclosure to one or more cells or one or more organs. Such a strategy may help to avoid undesirable effects in other organs, or may avoid undue loss of the oligonucleotide to cells, tissue or organs that would not benefit for the oligonucleotide. Accordingly, in some embodiments, oligonucleotides disclosed herein may be modified to facilitate targeting of a particular tissue, cell or organ, e.g., to facilitate delivery of the oligonucleotide to the liver. In certain embodiments, oligonucleotides disclosed herein may be modified to facilitate delivery of the oligonucleotide to the hepatocytes of the liver. In some embodiments, an oligonucleotide comprises a nucleotide that is conjugated to one or more targeting ligands.
  • a targeting ligand may comprise a carbohydrate, amino sugar, cholesterol, peptide, polypeptide, protein or part of a protein (e.g., an antibody or antibody fragment) or lipid.
  • a targeting ligand is an aptamer.
  • a targeting ligand may be an RGD peptide that is used to target tumor vasculature or glioma cells, CREKA peptide to target tumor vasculature or stoma, transferrin, lactoferrin, or an aptamer to target transferrin receptors expressed on CNS vasculature, or an anti-EGFR antibody to target EGFR on glioma cells.
  • the targeting ligand is one or more GalNAc moieties.
  • nucleotides of an oligonucleotide are each conjugated to a separate targeting ligand. In some embodiments, 2 to 4 nucleotides of an oligonucleotide are each conjugated to a separate targeting ligand.
  • targeting ligands are conjugated to 2 to 4 nucleotides at either ends of the sense or antisense strand (e.g., ligands are conjugated to a 2 to 4 nucleotide overhang or extension on the 5' or 3' end of the sense or antisense strand) such that the targeting ligands resemble bristles of a toothbrush and the oligonucleotide resembles a toothbrush.
  • an oligonucleotide may comprise a stem-loop at either the 5' or 3' end of the sense strand and 1 , 2, 3 or 4 nucleotides of the loop of the stem may be individually conjugated to a targeting ligand.
  • oligonucleotide that reduces the expression of HBV antigen to the hepatocytes of the liver of a subject.
  • Any suitable hepatocyte targeting moiety may be used for this purpose.
  • GalNAc is a high affinity ligand for asialoglycoprotein receptor (ASGPR), which is primarily expressed on the sinusoidal surface of hepatocyte cells and has a major role in binding, internalization, and subsequent clearance of circulating glycoproteins that contain terminal galactose or N-acetylgalactosamine residues (asialoglycoproteins).
  • Conjugation (either indirect or direct) of GalNAc moieties to oligonucleotides of the instant disclosure may be used to target these oligonucleotides to the ASGPR expressed on these hepatocyte cells.
  • an oligonucleotide of the instant disclosure is conjugated directly or indirectly to a monovalent GalNAc.
  • the oligonucleotide is conjugated directly or indirectly to more than one monovalent GalNAc (/.e., is conjugated to 2, 3, or 4 monovalent GalNAc moieties, and is typically conjugated to 3 or 4 monovalent GalNAc moieties).
  • an oligonucleotide of the instant disclosure is conjugated to one or more bivalent GalNAc, trivalent GalNAc, or tetravalent GalNAc moieties.
  • nucleotides of an oligonucleotide are each conjugated to a GalNAc moiety.
  • 2 to 4 nucleotides of the loop (L) of the stem-loop are each conjugated to a separate GalNAc.
  • targeting ligands are conjugated to 2 to 4 nucleotides at either ends of the sense or antisense strand (e.g., ligands are conjugated to a 2 to 4 nucleotide overhang or extension on the 5' or 3' end of the sense or antisense strand) such that the GalNAc moieties resemble bristles of a toothbrush and the oligonucleotide resembles a toothbrush.
  • an oligonucleotide may comprise a stem-loop at either the 5' or 3' end of the sense strand and 1 , 2, 3 or 4 nucleotides of the loop of the stem may be individually conjugated to a GalNAc moiety.
  • GalNAc moieties are conjugated to a nucleotide of the sense strand.
  • four GalNAc moieties can be conjugated to nucleotides in the tetraloop of the sense strand, where each GalNAc moiety is conjugated to one nucleotide.
  • an oligonucleotide herein comprises a monovalent GalNAc attached to a Guanidine nucleotide, referred to as [ademG-GalNAc] or 2'-aminodiethoxymethanol- Guanidine-GalNAc, as depicted below:
  • an oligonucleotide herein comprises a monovalent GalNAc attached to an adenine nucleotide, referred to as [ademA-GalNAc] or 2'-aminodiethoxymethanol- Adenine-GalNAc, as depicted below.
  • a targeting ligand is conjugated to a nucleotide using a click linker.
  • an acetal-based linker is used to conjugate a targeting ligand to a nucleotide of any one of the oligonucleotides described herein.
  • Acetal-based linkers are disclosed, for example, in International Patent Application Publication Number WO2016100401 A1 , which published on June 23, 2016, and the contents of which relating to such linkers are incorporated herein by reference.
  • the linker is a labile linker.
  • the linker is fairly stable.
  • An example is shown below for a loop comprising from 5' to 3' the nucleotides GAAA, in which GalNAc moieties are attached to nucleotides of the loop using an acetal linker. In the chemical formula, is an attachment point to the oligonucleotide strand.
  • a therapeutic used in the pharmaceutical combination of the present invention is an anti-PDL1 antisense oligonucleotide.
  • the anti-PDL1 antisense oligonucleotide is an N-acetylgalactosamine (GalNAc)-conjugated locked nucleic acid (LNA) single-stranded oligonucleotide (SSO) that induces RNAseH-mediated degradation of PDL1 mRNA.
  • the anti-PDL1 antisense oligonucleotides in the pharmaceutical combination of the present invention is disclosed in WO2017/157899 which is fully incorporated herein by reference.
  • the anti-PDL1 antisense oligonucleotide in the pharmaceutical combination of the present invention is CMP ID NO: 768_2 disclosed in WO2017/157899 or a pharmaceutically acceptable salt thereof.
  • the anti-PDL1 antisense oligonucleotide in the pharmaceutical combination of the present invention comprises the sequence CCTATTTAACATCAGAC (SEQ ID NO: 11).
  • the anti-PDL1 antisense oligonucleotide in the pharmaceutical combination of the present invention has the formula GN2-C6 0 c 0 a 0 CCtatttaacatcAGAC, wherein C6 represents an amino alkyl group with 6 carbons, capital letters represent beta-D- oxy LNA nucleosides, lowercase letters represent DNA nucleosides, all LNA C are 5-methyl cytosine, subscript 0 represents a phosphodiester nucleoside linkage, and unless otherwise indicated, all internucleoside linkages are phosphorothioate internucleoside linkages, and wherein GN2 represents the following trivalent GalNAc cluster: and further wherein the wavy line of the trivalent GalNAc cluster illustrates the site of conjugation of the trivalent GalNAc cluster to the C6 amino alkyl group; or a pharmaceutically acceptable salt thereof.
  • the anti-PDL1 antisense oligonucleotide is administered subcutaneously. In an embodiment, the anti-PDL1 antisense oligonucleotide is administered in a dose or doses of about 0.1 mg/kg to about 35 mg/kg, or about 0.1 mg/kg to about 15 mg/kg, or about 0.1 mg/kg to about 10 mg/kg, or about 0.2 m/kg to about 10 mg/kg, or about 0.25 mg/kg to about 10 mg/kg, or about 0.1 mg/kg to about 5 mg/kg, or about 0.2 mg/kg to about 5 mg/kg, or about 0.25 mg/kg to about 5 mg/kg.
  • the anti-PDL1 antisense oligonucleotide is administered in a dose or doses of about 7 mg/kg to about 35 mg/kg.
  • the doses of the anti-PDL1 antisense oligonucleotide are administered once a week, once every two weeks, once every three weeks or once a month.
  • the anti-PDL1 antisense oligonucleotide is administered in up to five doses.
  • each dose is about 3 mg/kg.
  • the doses are administered Q2W (every two weeks). /.
  • contiguous nucleobase sequences can be modified to for example increase nuclease resistance and/or binding affinity to the target nucleic acid.
  • the contiguous nucleobase sequence of the oligonucleotide comprises at least one modified internucleoside linkage. Suitable internucleoside modifications are described in the “Definitions” section under “Modified internucleoside linkage”. It is advantageous if at least 75%, such as all, the internucleoside linkages within the contiguous nucleotide sequence are internucleoside linkages. In some embodiments all the internucleotide linkages in the contiguous sequence of the oligonucleotide are phosphorothioate linkages.
  • the oligonucleotides of the invention are designed with modified nucleosides and DNA nucleosides.
  • modified nucleosides and DNA nucleosides are used.
  • high affinity modified nucleosides are used.
  • the oligonucleotide comprises at least 3 modified nucleosides, such as at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11 , at least 12, at least 13, at least 14, at least 15 or at least 16 modified nucleosides. In an embodiment the oligonucleotide comprises from 3 to 8 modified nucleosides, such as from 4 to 6 modified nucleosides, such as 4, 5 or 6 nucleosides, such as from 5 or 6 modified nucleosides.
  • the oligonucleotide comprises one or more sugar modified nucleosides, such as 2’ sugar modified nucleosides.
  • the oligonucleotide of the invention comprises one or more 2’ sugar modified nucleoside independently selected from the group consisting of 2’-O-alkyl-RNA, 2’-O-methyl-RNA, 2’-alkoxy-RNA, 2’-O-methoxyethyl-RNA, 2’- amino-DNA, 2’-fluoro-DNA, arabino nucleic acid (ANA), 2’-fluoro-ANA and LNA nucleosides. It is advantageous if one or more or all of the modified nucleoside(s) is a locked nucleic acid (LNA).
  • LNA locked nucleic acid
  • the oligonucleotide of the invention comprises at least one LNA nucleoside, such as 1 , 2, 3, 4, 5, 6, 7, or 8 LNA nucleosides, such as from 2 to 6 LNA nucleosides, such as from 3 to 6 LNA nucleosides, 4 to 6 LNA nucleosides or 4, 5 or 6 LNA nucleosides.
  • LNA nucleoside such as 1 , 2, 3, 4, 5, 6, 7, or 8 LNA nucleosides, such as from 2 to 6 LNA nucleosides, such as from 3 to 6 LNA nucleosides, 4 to 6 LNA nucleosides or 4, 5 or 6 LNA nucleosides.
  • At least 75% of the modified nucleosides in the oligonucleotide are LNA nucleosides, such as at least 80%, such as at least 85%, such as at least 90% of the modified nucleosides are LNA nucleosides.
  • all the modified nucleosides in the oligonucleotide are LNA nucleosides.
  • the LNA nucleosides are selected from beta-D-oxy-LNA, thio-LNA, amino-LNA, oxy-LNA, ScET and/or ENA in either the beta-D or alpha-L configurations or combinations thereof.
  • all LNA nucleosides are beta-D-oxy-LNA.
  • cytosine units are 5-methyl-cytosine. It is advantageous for the nuclease stability of the oligonucleotide or contiguous nucleotide sequence to have at least 1 LNA nucleoside at the 5’ end and at least 2 LNA nucleosides at the 3’ end of the nucleotide sequence.
  • a therapeutic used in the pharmaceutical combination of the present invention is a TLR7 agonist.
  • the TLR7 agonist in the pharmaceutical combination of the present invention is a 3-substituted 5-amino-6H-thiazolo[4,5-c(]pyrimidine-2, 7-dione compound, that has Toll-like receptor agonism activity, or a prodrug thereof.
  • WO 2006/066080, WO 2016/055553 and WO 2016/091698 describe such TLR7 agonists and their prodrug and their manufacture (hereby incorporated by reference).
  • TLR7 agonist in the pharmaceutical combination of the present invention is represented by formula (I):
  • X is CH2 or S
  • R1 is -OH or -H
  • R2 is 1 -hydroxypropyl or hydroxymethyl; or formula (II): wherein X is CH 2 or S;
  • R1 is -OH or -H or acetoxy
  • R2 is 1-acetoxypropyl or 1 -hydroxypropyl or 1 -hydroxymethyl or acetoxy(cyclopropyl) methyl or acetoxy(propyn-1-yl)methyl, or a pharmaceutically acceptable salt, enantiomer or diastereomer thereof.
  • Compounds of formula (I) are active TLR7 agonists.
  • a subset of the active TLR7 agonist of formula (I) in the pharmaceutical combination of the present invention are represented by formula (V): wherein R1 is -OH and R2 is 1-hydroxypropyl or hydroxymethyl, or a pharmaceutically acceptable salt, enantiomer or diastereomer thereof.
  • substituent at R2 in formula (I) or (V) is selected from:
  • compositions of formula (II) are TLR7 agonist prodrugs.
  • the prodrug is a single prodrug with substituent at R2 selected from:
  • the prodrug is a double prodrug with substituent at R2 selected from:
  • a subset of the TLR7 agonist prodrugs of formula (II) in the pharmaceutical combination of the present invention is represented by formula (III): wherein R1 is -OH or acetoxy and R2 is 1-acetoxypropyl or 1 -hydroxypropyl or 1- hydroxymethyl or or a pharmaceutically acceptable salt, enantiomer or diastereomer thereof; or formula (IV):
  • Ri is acetoxy(cyclopropyl)methyl or acetoxy(propyn-1-yl)methyl or or a pharmaceutically acceptable salt, enantiomer or diastereomer thereof.
  • the compounds of formula (IV) are double prodrugs as is the compound of formula (III) where Ri is OH and R2 is 1-acetoxypropyl.
  • compounds of formula (II), (III) or formula (IV) are metabolized into their active forms which are useful TLR7 agonists.
  • the TLR7 agonist in the pharmaceutical combination of the present invention is selected from the group consisting of:
  • CMP ID NO: X 5-amino-3-(2’-O-acetyl-3’-deoxy-p-D-ribofuranosyl)-3H-thiazolo[4,5-d]pyrimidin-2-one
  • CMP ID NO: XI 5-amino-3-(3’-deoxy-p-D-ribofuranosyl)-3H,6H-thiazolo[4,5-d]pyrimidin-2, 7-dione
  • Table 1 lists the TLR7 agonists in embodiments of the pharmaceutical combination of the present invention, including reference to documents that describe their manufacture.
  • Table 1 TLR7 agonist compounds identified with individual compound identification numbers (CMP ID NO).
  • the TLR7 agonist is CMP ID NO: VI.
  • This definition of TLR7 agonist used in the pharmaceutical combinations of the present invention is referred to herein as “T3” or “Therapeutic T3”.
  • the TLR7 agonist is administered orally.
  • T3 is administered orally as a unit dose ranging between 150 and 170 mg every other day (QOD) for 8 to 26 weeks such as 10 to 24 weeks such as 12 or 13 weeks followed by a weekly administration (QW) for 24 to 48 weeks such as 30 to 40 weeks such as 35 weeks.
  • the number of doses administered of T3 is between 60 and 100 doses, such as between 75 and 90 doses, such as 81, 82, 83 or 84 doses throughout the treatment period.
  • the TLR7 agonist is administered over a period of not more than twelve weeks.
  • a pharmaceutical combination of the present invention which comprises T1 or T2 as well as T3, T 1 and T3, or T2 and T3, are administered less than a month apart, such as less than a week apart, such as two days apart, such as on the same day.
  • the TLR7 agonist in the pharmaceutical combination of the invention is administered enterally (such as orally or through the gastrointestinal tract).
  • the TLR7 agonist compounds in the present invention may be administered in unit doses of any convenient administrative form, e.g., tablets, powders, capsules, solutions, dispersions, suspensions, syrups, sprays, suppositories, gels, emulsions.
  • oral unit dosage forms such as tablets and capsules, can be used.
  • the pharmaceutically effective amount of the TLR7 agonist compound of the invention will be in the range of about 75-250 mg, such as 100 to 200 mg such as 150 to 170 mg pr. dose.
  • the administration can be daily, every other day (QOD) or weekly (QW).
  • the TLR7 agonist is administered in a dose of at least about 100 mg, or about 100 mg, or preferably about 150 mg.
  • the TLR7 agonist is administered at least QW (weekly), or QW, or more preferably QOD (every other day).
  • Suitable carriers and excipients are well known to those skilled in the art and are described in detail in, e.g., Ansel, Howard C., et al., Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems. Philadelphia: Lippincott, Williams & Wilkins, 2004; Gennaro, Alfonso R., et al. Remington: The Science and Practice of Pharmacy. Philadelphia: Lippincott, Williams & Wilkins, 2000; and Rowe, Raymond C. Handbook of Pharmaceutical Excipients. Chicago, Pharmaceutical Press, 2005.
  • a therapeutic used in the pharmaceutical combination of the present invention is interferon-alpha (IFNa).
  • IFNa interferon-alpha
  • the interferon-alpha in the pharmaceutical combination of the present invention may be interferon alpha-2b, interferon alpha-2a, and interferon alphacon-1 (pegylated and unpegylated).
  • IFN-a in the pharmaceutical combination of the present invention is Pegasys® (Roche), PEG-lntron® (Merck& Co., Inc.) or Y-pegylated recombinant interferon alpha-2a (YPEG-IFNa-2a, Xiamen Amoytop Biotech Co., Ltd).
  • the IFNa in the pharmaceutical combination of the present invention is pegylated IFNa.
  • This definition of IFNa used in the pharmaceutical combinations of the present invention is referred to herein as “T4” or “Therapeutic T4”.
  • the interferon-alpha is administered subcutaneously.
  • a therapeutic used in the pharmaceutical combination of the present invention is an anti-HBV antibody.
  • the anti-HBV antibody in the pharmaceutical combination of the present invention is an antibody that binds to hepatitis B surface antigen (anti-HBsAg).
  • anti-HBsAg hepatitis B surface antigen
  • the combination comprising an oligonucleotide therapeutic and an anti- HBV antibody may lead to seroclearance of HBsAg in the patient.
  • the anti-HBV antibody in the pharmaceutical combination of the present invention is monoclonal.
  • the anti-HBV antibody in the pharmaceutical combination of the present invention is monoclonal is human.
  • the anti-HBV antibody in the pharmaceutical combination of the present invention is an anti-HBsAg monoclonal antibody.
  • This definition of anti-HBV antibody used in the pharmaceutical combinations of the present invention is referred to herein as “T5” or “Therapeutic T5”.
  • T5 is an anti-HBsAg antibody that comprises a heavy chain variable domain (VH) comprising (a) CDR-H1 comprising the amino acid sequence of NYGMQ (SEQ ID NO:12), (b) CDR-H2 comprising the amino acid sequence of IIWADGTKQYYGDSVKG (SEQ ID NO:13), and (c) CDR-H3 comprising the amino acid sequence of DGLYASAPNDV (SEQ ID NO:14), and
  • T5 is an anti-HBsAg antibody that comprises a heavy chain variable domain (VH) comprising (a) CDR-H1 comprising the amino acid sequence of SYAMS (SEQ ID NO:18), (b) CDR-H2 comprising the amino acid sequence of AFSGTGGSTYYADSVKG (SEQ ID NO:19), and (c) CDR-H3 comprising the amino acid sequence of DPGHTSNWRDNYQYYQMDV (SEQ ID NO:1)
  • T5 is an anti-HBsAg antibody that comprises a heavy chain variable domain (VH) comprising (a) CDR-H1 comprising the amino acid sequence of NYHIH (SEQ ID NO:24), (b) CDR-H2 comprising the amino acid sequence of IINPRRLSTAYAPKFQG (SEQ ID NO:25), and (c) CDR-H3 comprising the amino acid sequence of DAGDDTSGPFDS (SEQ ID NO:26), and a heavy chain variable domain (VH) comprising (a) CDR-H1 comprising the amino acid sequence of NYHIH (SEQ ID NO:24), (b) CDR-H2 comprising the amino acid sequence of IINPRRLSTAYAPKFQG (SEQ ID NO:25), and (c) CDR-H3 comprising the amino acid sequence of DAGDDTSGPFDS (SEQ ID NO:26), and a
  • T5 is an anti-HBsAg antibody that comprises a heavy chain variable domain (VH) comprising (a) CDR-H1 comprising the amino acid sequence of TNNWWS (SEQ ID NQ:30), (b) CDR-H2 comprising the amino acid sequence of EIHHIGSTNYNPSLKS (SEQ ID NO:31), and (c) CDR-H3 comprising the amino acid sequence of GRLGITRDRYYFDS (SEQ ID NO:32
  • T5 is an anti-HBsAg antibody that comprises a heavy chain variable domain (VH) comprising the amino acid sequence of QVQLVESGGGVVQPGRSLRLSCEASGFTFSNYGMQWVRQAPGKGLEWVAIIWADGTKQY YGDSVKGRFTISRDNFKNTLYLQMNSLRGEDTAMYFCARDGLYASAPNDVWGQGTLVTVS S (SEQ ID NO: 39), and a light chain
  • T5 is an anti-HBsAg antibody that comprises a heavy chain comprising the amino acid sequence of
  • the anti-HBV antibody is administered subcutaneously.
  • a therapeutic used in the pharmaceutical combination of the present invention is an antibody which antagonises PD1 signalling.
  • this antibody is an anti-PDL1 antibody.
  • this antibody is an anti-PD1 antibody.
  • the anti-PD1 antibody in the pharmaceutical combination of the present invention is nivolumab (trade name OPDIVO®, available from Bristol Myers Squibb). This definition of anti-PD1 antibody used in the pharmaceutical combinations of the present invention is referred to herein as “T6” or “Therapeutic T6”.
  • the anti-PDL1 antibody in the pharmaceutical combination of the present invention is atezolizumab (trade name Tecentriq®, available from Genentech/Roche). This definition of anti-PDL1 antibody used in the pharmaceutical combinations of the present invention is referred to herein as “T7” or “Therapeutic T7”.
  • the most preferred pharmaceutical combinations of the present invention which comprise an antibody which antagonises PD1 signalling comprise only one type of antibody which antagonises PD1 signalling.
  • the antibody which antagonises PD1 signalling is administered subcutaneously.
  • the antibody is T6 and is administered subcutaneously.
  • a therapeutic used in the pharmaceutical combination of the present invention is a nucleotide analogue.
  • the nucleotide analogue in the pharmaceutical combination of the present invention is selected from among: Lamivudine, Telbivudine, Entecavir, Adefovir, Tenofovir, Clevudine, Tenofovir alafenamide, CMX157, and AGX-1009.
  • nucleotide analogue in the pharmaceutical combination of the present invention is Entecavir.
  • This definition of nucleotide analogue used in the pharmaceutical combinations of the present invention is referred to herein as “T8” or “Therapeutic T8”.
  • the nucleotide analogue in the pharmaceutical combination of the present invention is Tenofovir.
  • This definition of nucleotide analogue used in the pharmaceutical combinations of the present invention is referred to herein as “T9” or “Therapeutic T9.
  • the nucleotide analogue is administered subcutaneously.
  • the present invention provides various pharmaceutical combinations comprising at least two HBV therapeutics, preferably comprising two or three HBV therapeutics.
  • Table 2 Preferred pharmaceutical combinations of the present invention which comprise two specified HBV therapeutics designated as Element A and Element B.
  • Combination C1 comprises an Element A which is the therapeutic T1 as defined above, and further comprises an Element B which is the therapeutic T2 as defined above.
  • Combination C37 comprises an Element A which is the therapeutic T1 as defined above, further comprises an Element B which is the therapeutic T2 as defined above, and further comprises an Element C which is the therapeutic T3 as defined above.
  • the pharmaceutical combinations of the present invention are those wherein the same combination does not comprise both Therapeutic T6 and Therapeutic T7.
  • the pharmaceutical combinations of the present invention are those which comprise Therapeutic T1 in combination with one or more further HBV therapeutics.
  • the pharmaceutical combinations of the present invention are those which comprise Therapeutic T1 and Therapeutic T2, optionally in combination with a further, third HBV therapeutic, preferably any one of T3, T4, T5, T6, T7, T8 or T9.
  • the pharmaceutical combination of the present invention comprises T1 and T2, optionally in combination with T3.
  • the combinations above comprise the recited Elements, i.e. they include the stated HBV therapeutics but do not exclude the inclusion of further, unrecited HBV therapeutics.
  • the combinations defined above are limited to the recited elements, i.e. the pharmaceutical combinations consist essentially of the recited elements to the exclusion of any other HBV therapeutics. This does not preclude the presence of any carrier, excipient, adjuvant, diluent or salt in the combination. Therefore, in another embodiment, a pharmaceutical combination of the present invention consists essentially of the relevant Elements recited for that combination in Table 2 or 3.
  • each of the HBV therapeutics in the pharmaceutical combination of the present invention is formulated in a pharmaceutically acceptable carrier. More preferably, each HBV therapeutic is formulated in a pharmaceutically acceptable carrier which is suitable for the administration of the HBV therapeutic in question.
  • the pharmaceutical combinations of the present invention can be used to treat an HBV infection more effectively than the comprised individual HBV therapeutics alone.
  • the pharmaceutical combination of the present invention can be used to inhibit HBV more rapidly, to inhibit HBV with an increased duration and/or to inhibit HBV with greater effect than the comprised individual HBV therapeutics alone. These effects may be measured by a reduction in HBsAg, HBeAg or HBV-DNA titre.
  • the pharmaceutical combination of the present invention causes a more rapid reduction in HBsAg, HBeAg or HBV-DNA titre than the comprised individual HBV therapeutics alone.
  • the pharmaceutical combination of the present invention causes a more prolonged reduction in HBsAg, HBeAg or HBV-DNA titre than the comprised individual HBV therapeutics alone. In an embodiment, the pharmaceutical combination of the present invention causes a greater decrease in HBsAg, HBeAg or HBV-DNA titre than the comprised individual HBV therapeutics alone. Primarily, HBsAg is measured for this purpose.
  • kit or kit of parts refers to an assembly of materials that are used in performing the treatment of an HBV infected individual, including a description of how to conduct the treatment.
  • An aspect of the invention is a kit of parts containing two or a plurality of therapeutically effective components (such as medical components or medicaments) selected from the HBV therapeutics as described herein.
  • One embodiment of the invention is a kit of parts comprising a first HBV therapeutic as described herein and a second HBV therapeutic as described herein, optionally further comprising a third HBV therapeutic as described herein, as medical components.
  • the kit of the invention contains a first medicament which is an RNAi oligonucleotide targeting HBV formulated for subcutaneous injection and a second medicament which is an anti-PDL1 antisense oligonucleotide also formulated for subcutaneous administration.
  • the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are formulated separately.
  • Each of the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide can be formulated as a liquid in a vial with one or multiple doses or in a prefilled syringe with one pharmaceutically effective dose.
  • each of the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide can be in the form of lyophilized powder and the kit contains dissolvent for preparation for injection. It is understood that all medicaments for injection are sterile. If a TLR7 agonist is included in the kit, it can be in tablet form (or alternative unit dose forms for oral administrations such as capsules and gels) with a single pharmaceutically effective dose pr. tablet, the kit can contain multiple tablets.
  • kit of parts of the present invention further comprises instructions for administration of RNAi oligonucleotide targeting HBV in combination with an anti-PDL1 antisense oligonucleotide to treat a hepatitis B virus infection.
  • the instructions describe the treatment of a chronic hepatitis B virus infection.
  • the kit may contain just one of the medical components and instructions for its use in combination with the other medical component.
  • the kit of parts of the invention comprises or contains a first medicament which is an RNAi oligonucleotide targeting HBV and instructions for its use in combination with an anti-PDL1 antisense oligonucleotide as the second medicament, but which is purchased separately.
  • the kit of parts of the invention comprises or contains a first medicament which is an anti-PDL1 antisense oligonucleotide and instructions for its use in combination with an RNAi oligonucleotide targeting HBV as the second medicament, but which is purchased separately.
  • the pharmaceutical combination of the invention may be used in combination with a third or further therapeutic agent(s), which may be included in the kits of part or supplied separately.
  • the further therapeutic agent is any of T3, T4, T5, T6, T7, T8 or T9.
  • the further therapeutic agent is T3.
  • Element A is administered first and Element B is administered second.
  • the first or initial dose of Element A of Combination C1 (which is the HBV therapeutic defined herein as T1) is administered before the first or initial dose of Element B of combination C1 (which is the HBV therapeutic defined herein as T2).
  • the specified orders in respect of the administration of the Elements of a specific pharmaceutical combination of the present invention are relative only to the Elements that are explicitly part of that pharmaceutical combination.
  • an Element specified as being “administered first” does not necessarily preclude that the patient has never previously been administered a different HBV therapeutic which was not administered as part of the administration of a pharmaceutical combination of the present invention.
  • the Elements of the pharmaceutical combinations of the present invention can be administered at a single time point, e.g. as a single dose, or as multiple doses given over a period of time.
  • a reference to an Element being “administered” herein can refer either to the specific time where that Element is administered (with a dose given at a single time point), or to the time where the administering of the Element is initiated (with doses given over a period of time).
  • pharmaceutical combinations of the invention may involve overlapping dosage regimes.
  • an Element A is administered first and an Element B is administered second
  • the administration of further doses of Element A may overlap with the administration of Element B, provided that the initial dose of Element A is administered before the single or initial dose of Element B.
  • the pharmaceutical combination is combination C1 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C2 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C3 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C4 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C5 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C6 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C7 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C8 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C9 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C10 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C11 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C12 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C13 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C14 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C15 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C16 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C17 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C18 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C19 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C20 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C21 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C22 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C23 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C24 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C25 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C26 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C27 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C28 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C29 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C30 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C31 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C32 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C33 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C34 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C35 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C36 comprising the Element A and Element B as defined in Table 2 above.
  • Element A is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C37 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C38 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C39 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C40 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C41 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C42 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C43 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C44 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C45 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C46 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C47 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C48 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C49 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C50 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C51 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • Combination C52 In an embodiment of the present invention, the pharmaceutical combination is combination C52 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A.
  • Element C is administered prior to the administering of Element A, and Element A is administered prior to the administering of Element B. In a further embodiment of this combination, Element C is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C53 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C54 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C55 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C56 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C57 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C58 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C59 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C60 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C61 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C62 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C63 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C64 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C65 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C66 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C67 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C68 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C69 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C70 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C71 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C72 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C73 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C74 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C75 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C76 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C77 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C78 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • Combination C79 In an embodiment of the present invention, the pharmaceutical combination is combination C79 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A.
  • Element C is administered prior to the administering of Element A, and Element A is administered prior to the administering of Element B. In a further embodiment of this combination, Element C is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element A.
  • Combination C80 is administered prior to the administering of Element A, and Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C80 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C81 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C82 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C83 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C84 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C85 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C86 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C87 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C88 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C89 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C90 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C91 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C92 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C93 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C94 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C95 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C96 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C97 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C98 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C99 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C100 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C101 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C102 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C103 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C104 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C105 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • Combination C106 In an embodiment of the present invention, the pharmaceutical combination is combination C106 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A.
  • Element C is administered prior to the administering of Element A, and Element A is administered prior to the administering of Element B. In a further embodiment of this combination, Element C is administered prior to the administering of Element B, and Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C107 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C108 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C109 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C110 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C111 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C112 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C113 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C114 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C115 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C116 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C117 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C118 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C119 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • the pharmaceutical combination is combination C120 comprising the Element A, Element B and Element C as defined in Table 3 above.
  • Element A is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element C.
  • Element A is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element B.
  • Element B is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element C.
  • Element B is administered prior to the administering of Element C
  • Element C is administered prior to the administering of Element A
  • Element A is administered prior to the administering of Element B
  • Element C is administered prior to the administering of Element B
  • Element B is administered prior to the administering of Element A.
  • a pharmaceutical combination of the present invention comprises the Therapeutic T 1
  • Therapeutic T1 is administered first.
  • Therapeutic T1 is administered prior to the administering of Therapeutic T2, preferably at least a week (seven days) prior to the administering of Therapeutic T2, more preferably at least four weeks prior to the administering of Therapeutic T2.
  • a pharmaceutical combination of the present invention comprises the Therapeutic T1 , the Therapeutic T2 and an additional third H BV therapeutic
  • Therapeutic T 1 is administered prior to the administering of Therapeutic T2 and the additional third HBV therapeutic, preferably at least a week prior to the administering of Therapeutic T2 and the additional third HBV therapeutic.
  • Therapeutic T1 is administered first, preferably at least a week prior to the administration of the other comprised HBV therapeutics.
  • Therapeutic T1 is administered prior to the administering of Therapeutic T2, preferably at least a week prior to the administering of Therapeutic T2, more preferably at least four weeks prior to the administering of Therapeutic T2.
  • Therapeutic T1 is administered prior to the administering of Therapeutic T2 and the additional HBV therapeutic, preferably at least a week prior to the administering of Therapeutic T2 and the additional HBV therapeutic.
  • a most preferred pharmaceutical combination of the present invention comprises an RNAi oligonucleotide targeting HBV as defined herein and an anti-PDL1 antisense oligonucleotide as defined herein.
  • the present inventors have unexpectedly found advantageous and synergistic effects between these HBV therapeutics when used in a pharmaceutical combination.
  • the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide defined herein are capable of achieving a reduction in HBV viral markers (serum HBsAg, HBeAg and HBV-DNA) which is greater than the reduction achieved by either HBV therapeutic as a monotherapy alone, and is even greater than the sum of both the effects achieved by each HBV therapeutic as a monotherapy.
  • This combination optionally comprises a further, different, third HBV therapeutic as described herein.
  • the third HBV therapeutic is selected from a TLR7 agonist, interferon-alpha, an anti-HBV antibody, an anti-PDL1 antibody or a nucleotide analogue as defined herein.
  • the third HBV therapeutic is a TLR7 agonist, preferably the TLR7 agonist defined as T3 herein.
  • the dosage of the TLR7 agonist in this combination is according to the dosage disclosed for TLR7 agonists in the corresponding section above.
  • the anti-PDL1 antisense oligonucleotide is administered in one or more doses of at least about 0.1 mg/kg, preferably of at least about 1 mg/kg, preferably at least about 2 mg/kg, preferably at least about 3 mg/kg. In an embodiment, the doses are more than 3 mg/kg.
  • the anti-PDL1 antisense oligonucleotide is administered in one or more doses of about 0.1 mg/kg to about 35 mg/kg, preferably about 1 mg/kg to about 35 mg/kg, preferably about 2 mg/kg to about 35 mg/kg, preferably about 3 mg/kg to about 35 mg/kg, preferably about 7 mg/kg to about 35 mg/kg.
  • this combination results in continuously and significantly decreased serum levels of HBsAg, relative to a vehicle control.
  • this combination provides a reduction in serum HBsAg which is greater than the reduction provided by an equivalent monotherapy with the RNAi oligonucleotide targeting HBV or anti-PD-L1 antisense oligonucleotide alone. In an embodiment, the reduction is greater than the sum of these equivalent monotherapies.
  • this combination results in continuously and significantly decreased serum levels of HBeAg, relative to a vehicle control.
  • this combination provides a reduction in serum HBeAg which is greater than the reduction provided by an equivalent monotherapy with the RNAi oligonucleotide targeting HBV or anti-PD-L1 antisense oligonucleotide alone. In an embodiment, the reduction is greater than the sum of these equivalent monotherapies.
  • this combination results in continuously and significantly decreased serum levels of HBV-DNA, relative to a vehicle control.
  • this combination provides a reduction in serum HBV-DNA which is greater than the reduction provided by an equivalent monotherapy with the RNAi oligonucleotide targeting HBV or anti-PD-L1 antisense oligonucleotide alone. In an embodiment, the reduction is greater than the sum of these equivalent monotherapies.
  • this combination results in continuously and significantly decreased serum levels of HBsAg, HBeAg and HBV-DNA, relative to a vehicle control.
  • reduction in serum HBsAg, HBV-DNA and HBeAg is greater than the reduction provided by an equivalent monotherapy with the RNAi oligonucleotide targeting HBV or anti- PD-L1 antisense oligonucleotide alone.
  • the reduction is greater than the sum of these equivalent monotherapies
  • an equivalent monotherapy it is meant that the pharmaceutical combination of the present invention obtains a greater reduction in HBV serum marker over the same dose of either of the same medicaments as are comprised in the combination.
  • the pharmaceutical combination obtains an improved reduction in HBV serum markers which is greater than the sum of the reductions that would be seen when administering each of the medicaments comprised therein - the RNAi oligonucleotide and anti-PDL1 oligonucleotide - as a monotherapy.
  • the reduction in HBV serum markers including HBsAg, HBeAg and HBV-DNA is seen in the serum of the patient to which the pharmaceutical combination is administered.
  • the pharmaceutical combination comprising an RNAi oligonucleotide targeting HBV as defined herein and an anti-PDL1 antisense oligonucleotide as defined herein provides a synergistic effect on reducing HBV serum viral markers, preferably on one or more or all of HBsAg, HBeAg and HBV-DNA.
  • the synergistic effect obtained by this combination is unexpectedly greater than the sum of the individual effects of 1) the RNAi oligonucleotide targeting HBV and 2) the anti-PDL1 antisense oligonucleotide, i.e. when they are each administered as an equivalent mono-therapy.
  • the RNAi oligonucleotide targeting HBV is administered first.
  • the initial or single dose of the RNAi oligonucleotide targeting HBV is administered prior to the initial or single dose of the anti-PDL1 antisense oligonucleotide.
  • the RNAi oligonucleotide targeting HBV is administered in one or more doses of at least about 3 mg/kg, preferably more than 3 mg/kg, preferably at least about 6 mg/kg, preferably at least about 9 mg/kg.
  • the anti-PDL1 antisense oligonucleotide is administered in one or more doses of at least about 3mg/kg, preferably more than 3 mg/kg, preferably at least about 6mg/kg.
  • the RNAi oligonucleotide targeting HBV is administered first and the anti- PDL1 antisense oligonucleotide is administered second. In an embodiment, the RNAi oligonucleotide targeting HBV is administered first at a single dose (DO of treatment), prior to the administering of the anti-PDL1 antisense oligonucleotide once weekly, or once every two weeks, in at least two or more doses.
  • DO of treatment a single dose
  • the single or initial dose of the RNAi oligonucleotide targeting HBV is administered at least about a week, at least about two weeks, at least about three weeks, at least about four weeks, at least about five weeks, at least about six weeks, at least about seven weeks, at least about eight weeks or longer than eight weeks prior to the administering of the initial dose of the anti-PDL1 antisense oligonucleotide.
  • the RNAi oligonucleotide targeting HBV is administered at a dose of between 3 mg/kg and 9 mg/kg
  • the anti-PDL1 antisense oligonucleotide is administered at doses from about 3 mg/kg to about 6 mg/kg.
  • the RNAi oligonucleotide targeting HBV is administered at a single dose of between 3 and 9 mg/kg, prior to the administering of the anti-PDL1 antisense oligonucleotide, once weekly, in at least 5 doses of between 3 and 6 mg/kg.
  • the initial dose of the RNAi oligonucleotide targeting HBV is administered at least 7 days, preferably at least a month, prior to the dose of the anti-PDL1 antisense oligonucleotide.
  • two or more, preferably at least five, doses of antiPDLl antisense oligonucleotide are administered, once weekly or once every two weeks, with the single or initial dose of the RNAi oligonucleotide targeting HBV being administered at least about 7 days prior to the initial dose of anti-PDL1 antisense oligonucleotide.
  • the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg.
  • the dose of the anti-PDL1 antisense oligonucleotide is more than 3 mg/kg, preferably at least about 6 mg/kg.
  • two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly or once every two weeks, with the single or initial dose of the RNAi oligonucleotide targeting HBV being administered at least about 7 days prior to the initial dose of anti-PDL1 antisense oligonucleotide; and the doses of the anti-PDL1 antisense oligonucleotide are more than 3 mg/kg, preferably at least about 6 mg/kg.
  • two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the single or initial dose of the RNAi oligonucleotide targeting HBV being administered at least about 7 days prior to the initial dose of anti-PDL1 antisense oligonucleotide; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg.
  • two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the single or initial dose of the RNAi oligonucleotide targeting HBV being administered at least about 7 days prior to the initial dose of anti-PDL1 antisense oligonucleotide; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg; and each dose of the anti-PDL1 antisense oligonucleotide is more than 3 mg/kg, preferably at least about 6 mg/kg.
  • the invention provides pharmaceutical compositions comprising each of the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide described herein and a pharmaceutically acceptable excipient, diluent, carrier, salt and/or adjuvant.
  • the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide in the pharmaceutical combination of the present invention are present in separate compositions.
  • the therapeutic oligonucleotides are each formulated in phosphate buffered saline for subcutaneous administration.
  • a therapeutic oligonucleotide in the pharmaceutical combination of the invention may be mixed with pharmaceutically acceptable active or inert substances for the preparation of pharmaceutical compositions or formulations.
  • Compositions and methods for the formulation of pharmaceutical compositions are dependent upon a number of criteria, including, but not limited to, route of administration, extent of disease, or dose to be administered.
  • a pharmaceutically acceptable diluent of therapeutic oligonucleotides includes phosphate- buffered saline (PBS) and pharmaceutically acceptable salts include, but are not limited to, sodium and potassium salts.
  • the pharmaceutically acceptable diluent of the therapeutic oligonucleotide is sterile phosphate buffered saline.
  • the oligonucleotide is used in the pharmaceutically acceptable diluent at a concentration of 50 - 150 mg/ml solution.
  • the therapeutic oligonucleotide or pharmaceutical composition comprising the therapeutic oligonucleotide is administered by a parenteral route including intravenous, intraarterial, subcutaneous or intramuscular injection or infusion.
  • the oligonucleotide conjugate is administered intravenously.
  • therapeutic oligonucleotides it is advantageous if they are administered subcutaneously.
  • compositions may be sterilized by conventional sterilization techniques, or may be sterile filtered.
  • the resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration.
  • the pH of the preparations typically will be between 3 and 11, more preferably between 5 and 9 or between 6 and 8, and most preferably between 7 and 8, such as 7 to 7.5.
  • the resulting compositions in solid form may be packaged in multiple single dose units, each containing a fixed amount of the above-mentioned agent or agents, such as in a sealed package of tablets or capsules.
  • oligonucleotides can be delivered to a subject or a cellular environment using a formulation that minimizes degradation, facilitates delivery and/or uptake, or provides another beneficial property to the oligonucleotides in the formulation.
  • a first medicament which is a composition comprising an oligonucleotide (e.g., a single-stranded or double-stranded oligonucleotide) to reduce the expression of HBV antigen (e.g., HBsAg).
  • HBV antigen e.g., HBsAg
  • compositions can be suitably formulated such that when administered to a subject, either into the immediate environment of a target cell or systemically, a sufficient portion of the oligonucleotides enter the cell to reduce HBV antigen expression.
  • Any of a variety of suitable oligonucleotide formulations can be used to deliver oligonucleotides for the reduction of HBV antigen as disclosed herein.
  • an oligonucleotide of the pharmaceutical combination of the present invention is formulated in buffer solutions such as phosphate-buffered saline solutions, liposomes, micellar structures, and capsids.
  • Formulations of oligonucleotides with cationic lipids can be used to facilitate transfection of the oligonucleotides into cells.
  • cationic lipids such as lipofectin, cationic glycerol derivatives, and polycationic molecules (e.g., polylysine) can be used.
  • Suitable lipids include Oligofectamine, Lipofectamine (Life Technologies), NC388 (Ribozyme Pharmaceuticals, Inc., Boulder, Colo.), or FuGene 6 (Roche) all of which can be used according to the manufacturer’s instructions.
  • an oligonucleotide formulation comprises a lipid nanoparticle.
  • an excipient comprises a liposome, a lipid, a lipid complex, a microsphere, a microparticle, a nanosphere, or a nanoparticle, or may be otherwise formulated for administration to the cells, tissues, organs, or body of a subject in need thereof (see, e.g., Remington: The Science and Practice of Pharmacy, 22nd edition, Pharmaceutical Press, 2013).
  • formulations as disclosed herein comprise an excipient.
  • an excipient confers to a composition improved stability, improved absorption, improved solubility and/or therapeutic enhancement of the active ingredient.
  • an excipient is a buffering agent (e.g., sodium citrate, sodium phosphate, a tris base, or sodium hydroxide) or a vehicle (e.g., a buffered solution, petrolatum, dimethyl sulfoxide, or mineral oil).
  • a buffering agent e.g., sodium citrate, sodium phosphate, a tris base, or sodium hydroxide
  • a vehicle e.g., a buffered solution, petrolatum, dimethyl sulfoxide, or mineral oil.
  • an oligonucleotide is lyophilized for extending its shelf-life and then made into a solution before use (e.g., administration to a subject).
  • an excipient in a composition comprising any one of the oligonucleotides described herein may be a lyoprotectant (e.g., mannitol, lactose, polyethylene glycol, or polyvinyl pyrolidone), or a collapse temperature modifier (e.g., dextran, ficoll, or gelatin).
  • a lyoprotectant e.g., mannitol, lactose, polyethylene glycol, or polyvinyl pyrolidone
  • a collapse temperature modifier e.g., dextran, ficoll, or gelatin
  • the composition comprising an oligonucleotide is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
  • Formulation for subcutaneous is particularly advantageous where the oligonucleotide in the pharmaceutical combination of the present invention is an RNAi oligonucleotide.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • Suitable carriers include physiological saline, bacteriostatic water, Cremophor EL.TM. (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the carrier may be water or a solvent or dispersion medium.
  • the solvent or dispersion medium may contain, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride in the composition.
  • Sterile injectable solutions can be prepared by incorporating the oligonucleotides in a required amount in a selected solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • a composition in the combination may contain at least about 0.1% of the therapeutic agent (e.g., an oligonucleotide for reducing HBV antigen expression) or more, although the percentage of the active ingredient(s) may be between about 1% and about 80% or more of the weight or volume of the total composition.
  • the therapeutic agent e.g., an oligonucleotide for reducing HBV antigen expression
  • the percentage of the active ingredient(s) may be between about 1% and about 80% or more of the weight or volume of the total composition.
  • Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such pharmaceutical formulations, and as such, a variety of dosages and treatment regimens may be desirable.
  • the pharmaceutical combination of the present invention is for use in treatment of Hepatitis B virus infections, in particular treatment of patients with chronic HBV.
  • the pharmaceutical combination of the invention may be utilized as therapeutics and in prophylaxis.
  • the pharmaceutical combination of the invention can be used as a combined hepatitis B virus targeting therapy and an immunotherapy.
  • the pharmaceutical combination of the invention is capable of affecting one or more of the following HBV infection parameters i) reducing cellular HBV mRNA, ii) reducing HBV DNA in serum and/or iii) reducing HBV viral antigens, such as HBsAg and HBeAg when used in the treatment of HBV in an infected cell.
  • HBV infection parameters i) reducing cellular HBV mRNA, ii) reducing HBV DNA in serum and/or iii) reducing HBV viral antigens, such as HBsAg and HBeAg when used in the treatment of HBV in an infected cell.
  • HBV viral antigens such as HBsAg and HBeAg
  • the effect on a HBV infection may be measured in vitro using HBV infected primary human hepatocytes or HBV infected HepaRG cells or ASGPR-HepaRG cells (see for example PCT/EP2018/078136).
  • the effect on a HBV infection may also be measured in vivo using AAV/HBV mouse model of mice infected with a recombinant adeno-associated virus (AAV) carrying the HBV genome (AAV/HBV) (Dan Yang, et al.
  • AAV recombinant adeno-associated virus
  • HBV minicircle mouse available at Covance Shanghai, see also Guo et al 2016 Sci Rep 6: 2552 and Yan et al 2017 J Hepatology 66(6):1149-1157
  • humanized hepatocytes PXB mouse model available at PhoenixBio, see also Kakuni et al 2014 Int. J. Mol. Sci. 15:58-74.
  • Inhibition of secretion of HBsAg and/or HBeAg may be measured by ELISA, e.g. by using the CLIA ELISA Kit (Autobio Diagnostic) according to the manufacturers’ instructions.
  • Reduction of HBV mRNA and pgRNA may be measured by qPCR. Further methods for evaluating whether a test compound inhibits HBV infection are measuring secretion of HBV DNA by qPCR e.g. as described in WO 2015/173208 or using Northern Blot; in-situ hybridization, or immuno-fluorescence.
  • the pharmaceutical combination as described herein provides an advantage over the corresponding mono-compound treatments.
  • the advantage can for example be i) prolonged serum HBV-DNA reduction compared to monotherapy; ii) delayed rebound in HBsAg compared to mono-therapy and/or iii) increased therapeutic window.
  • therapeutic window or “pharmaceutical window” in relation to a drug is the range of drug dosages which can treat disease effectively without having toxic effects.
  • an increase in the therapeutic window can be achieved by the combination treatment as compared to mono-therapy.
  • the invention provides methods for treating or preventing HBV infection, comprising administering a therapeutically or prophylactical ly effective amount of a pharmaceutical combination of the present invention to a subject suffering from or susceptible to HBV infection.
  • a further aspect of the invention relates to the use of the pharmaceutical combination of the present invention to inhibit development of or treat a chronic HBV infection.
  • One aspect of the present invention is a method of treating an individual infected with HBV, such as an individual with chronic HBV infection, comprising administering a pharmaceutically effective amount of an RNAi oligonucleotide targeting HBV and a pharmaceutically effective amount of an anti-PDL1 antisense oligonucleotide.
  • the invention also relates to an RNAi oligonucleotide targeting HBV for use as a medicament in a combination treatment.
  • the invention also relates to an anti-PDL1 antisense oligonucleotide for use as a medicament in a combination treatment.
  • the RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are for use in treatment of a hepatitis B virus infection.
  • One embodiment of the invention is the use of an RNAi oligonucleotide targeting HBV in the manufacture of a first medicament for treating a hepatitis B virus infection, such as a chronic HBV virus infection, wherein the first medicament is an RNAi oligonucleotide targeting HBV as described in the present application and wherein the first medicament is to be administered in combination with a second medicament, wherein the second medicament is an anti-PDL1 antisense oligonucleotide as described in the present application.
  • the medical composition containing the RNAi oligonucleotide targeting HBV or the anti-PDL1 antisense oligonucleotide is to be administered as a subcutaneous dose.
  • any TLR7 agonist is to be administered as an oral dose.
  • the medical composition may be administered through different routes of administration and can follow different administration regiments.
  • the pharmaceutical combination according to the present invention is typically administered in an effective amount.
  • RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide as described in the present application are administered subcutaneously with weekly or monthly dosing in between 24 and 72 weeks, such as between 36 and 60 weeks, such as 48 weeks. In the period with administration every other day there may be a 10 to 14 week, such as a 12 week period off treatment.
  • methods are provided for delivering to a cell an effective amount any one of the pharmaceutical combinations of the present invention, particularly the RNAi oligonucleotide targeting HBV and anti-PDL1 antisense oligonucleotide as described herein, for purposes of reducing expression of HBsAg. Methods provided herein are useful in any appropriate cell type.
  • a cell is any cell that expresses HBV antigen (e.g., hepatocytes, macrophages, monocyte-derived cells, prostate cancer cells, cells of the brain, endocrine tissue, bone marrow, lymph nodes, lung, gall bladder, liver, duodenum, small intestine, pancreas, kidney, gastrointestinal tract, bladder, adipose and soft tissue and skin).
  • HBV antigen e.g., hepatocytes, macrophages, monocyte-derived cells, prostate cancer cells, cells of the brain, endocrine tissue, bone marrow, lymph nodes, lung, gall bladder, liver, duodenum, small intestine, pancreas, kidney, gastrointestinal tract, bladder, adipose and soft tissue and skin.
  • the cell is a primary cell that has been obtained from a subject and that may have undergone a limited number of passages, such that the cell substantially maintains its natural phenotypic properties.
  • a cell to which the oligonucleotide is delivered is ex vivo or in vitro (i.e., can be delivered to a cell in culture or to an organism in which the cell resides).
  • methods are provided for delivering to a cell a pharmaceutical combination comprising effective amounts of the RNAi oligonucleotide targeting HBV and anti-PDL1 antisense oligonucleotide as described herein for purposes of reducing expression of HBsAg solely in hepatocytes.
  • the oligonucleotide therapeutics in the pharmaceutical combinations of the invention can be introduced using appropriate nucleic acid delivery methods including injection of a solution containing the oligonucleotides, bombardment by particles covered by the oligonucleotides, exposing the cell or organism to a solution containing the oligonucleotides, or electroporation of cell membranes in the presence of the oligonucleotides.
  • appropriate methods for delivering oligonucleotides to cells may be used, such as lipid-mediated carrier transport, chemical-mediated transport, and cationic liposome transfection such as calcium phosphate, and others.
  • the consequences of inhibition can be confirmed by an appropriate assay to evaluate one or more properties of a cell or subject, or by biochemical techniques that evaluate molecules indicative of HBV antigen expression (e.g., RNA, protein).
  • the extent to which an oligonucleotide of a pharmaceutical combination provided herein reduces levels of expression of HBV antigen is evaluated by comparing expression levels (e.g., mRNA or protein levels) of HBV antigen to an appropriate control (e.g., a level of HBV antigen expression in a cell or population of cells to which the pharmaceutical combination has not been delivered or to which a negative control has been delivered).
  • an appropriate control level of HBV antigen expression may be a predetermined level or value, such that a control level need not be measured every time.
  • the predetermined level or value can take a variety of forms.
  • a predetermined level or value can be single cut-off value, such as a median or mean.
  • administering results in a reduction in the level of HBV antigen (e.g., HBsAg) expression in a cell.
  • HBV antigen e.g., HBsAg
  • the reduction in levels of HBV antigen expression may be a reduction to 1% or lower, 5% or lower, 10% or lower, 15% or lower, 20% or lower, 25% or lower, 30% or lower, 35% or lower, 40% or lower, 45% or lower, 50% or lower, 55% or lower, 60% or lower, 70% or lower, 80% or lower, or 90% or lower compared with an appropriate control level of HBV antigen.
  • the appropriate control level may be a level of HBV antigen expression in a cell or population of cells that has not been contacted with a pharmaceutical combination comprising an oligonucleotide, particularly an RNAi oligonucleotide, as described herein.
  • the effect of delivery of an oligonucleotide of a pharmaceutical combination of the present invention to a cell according to a method disclosed herein is assessed after a finite period of time.
  • levels of HBV antigen may be analyzed in a cell at least 8 hours, 12 hours, 18 hours, 24 hours; or at least one, two, three, four, five, six, seven, fourteen, twenty-one, twenty-eight, thirty-five, forty-two, forty-nine, fifty-six, sixty- three, seventy, seventy-seven, eighty-four, ninety-one, ninety-eight, 105, 112, 119, 126, 133, 140, or 147 days after introduction of the oligonucleotide into the cell.
  • the reduction in the level of HBV antigen e.g., HBsAg
  • a detectable reduction in HBsAg expression persists within a period of 7 to 70 days following administration of an oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • the detectable reduction persists within a period of 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 30, or 10 to 20 days following administration of the oligonucleotide.
  • the detectable reduction persists within a period of 20 to 70, 20 to 60, 20 to 50, 20 to 40, or 20 to 30 days following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide. In some embodiments, the detectable reduction persists within a period of 30 to 70, 30 to 60, 30 to 50, or 30 to 40 days following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • the detectable reduction persists within a period of 40 to 70, 40 to 60, 40 to 50, 50 to 70, 50 to 60, or 60 to 70 days following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • a detectable reduction in HBsAg expression persists within a period of 2 to 21 weeks following administration of an oligonucleotide of a pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • the detectable reduction persists within a period of 2 to 20, 4 to 20, 6 to 20, 8 to 20, 10 to 20, 12 to 20, 14 to 20, 16 to 20, or 18 to 20 weeks following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • the detectable reduction persists within a period of 2 to 16, 4 to 16, 6 to 16, 8 to 16, 10 to 16, 12 to 16, or 14 to 16 weeks following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide. In some embodiments, the detectable reduction persists within a period of 2 to 12, 4 to 12, 6 to 12, 8 to 12, or 10 to 12 weeks following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • the detectable reduction persists within a period of 2 to 10, 4 to 10, 6 to 10, or 8 to 10 weeks following administration of the oligonucleotide of the pharmaceutical combination of the present invention, particularly where the oligonucleotide is an antisense oligonucleotide.
  • an oligonucleotide of the pharmaceutical combination of the present invention is delivered in the form of a transgene that is engineered to express the oligonucleotide (e.g., its sense and antisense strands) in a cell.
  • an oligonucleotide of the pharmaceutical combination of the present invention particularly where the oligonucleotide is an antisense oligonucleotide is delivered using a transgene that is engineered to express any oligonucleotide disclosed herein.
  • Transgenes may be delivered using viral vectors (e.g., adenovirus, retrovirus, vaccinia virus, poxvirus, adeno-associated virus or herpes simplex virus) or non-viral vectors (e.g., plasmids or synthetic mRNAs).
  • viral vectors e.g., adenovirus, retrovirus, vaccinia virus, poxvirus, adeno-associated virus or herpes simplex virus
  • non-viral vectors e.g., plasmids or synthetic mRNAs.
  • transgenes of the pharmaceutical combinations of the present invention can be injected directly to a subject.
  • aspects of the disclosure relate to methods for reducing HBsAg expression (e.g., reducing HBsAg expression) for the treatment of HBV infection in a subject.
  • the methods may comprise administering to a subject in need thereof a pharmaceutical combination comprising effective amounts of the RNAi oligonucleotide targeting HBV and anti-PDL1 antisense oligonucleotide as described herein.
  • the present disclosure provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) HBV infection and/or a disease or disorder associated with HBV infection.
  • the disclosure provides a method for preventing in a subject, a disease or disorder as described herein by administering to the subject a therapeutic agent (e.g., a pharmaceutical combination, an oligonucleotide or vector or transgene encoding same).
  • a therapeutic agent e.g., a pharmaceutical combination, an oligonucleotide or vector or transgene encoding same.
  • the subject to be treated is a subject who will benefit therapeutically from a reduction in the amount of HBsAg protein, e.g., in the liver.
  • Subjects at risk for the disease or disorder can be identified by, for example, one or a combination of diagnostic or prognostic assays known in the art (e.g., identification of liver cirrhosis and/or liver inflammation).
  • Administration of a prophylactic agent can occur prior to the detection of or the manifestation of symptoms characteristic of the disease or disorder, such that the disease or disorder is prevented or, alternatively, delayed in its progression.
  • Methods described herein typically involve administering to a subject an effective amount of a pharmaceutical combination, that is, an amount capable of producing a desirable therapeutic result.
  • a therapeutically acceptable amount may be an amount that is capable of treating a disease or disorder.
  • the appropriate dosage for any one subject will depend on certain factors, including the subject’s size, body surface area, age, the particular composition to be administered, the active ingredient(s) in the composition, time and route of administration, general health, and other drugs being administered concurrently.
  • a subject is administered any one of the compositions of the pharmaceutical combinations disclosed herein either enterally (e.g., orally, by gastric feeding tube, by duodenal feeding tube, via gastrostomy or rectally), parenterally (e.g., subcutaneous injection, intravenous injection or infusion, intra-arterial injection or infusion, intraosseous infusion, intramuscular injection, intracerebral injection, intracerebroventricular injection, intrathecal), topically (e.g., epicutaneous, inhalational, via eye drops, or through a mucous membrane), or by direct injection into a target organ (e.g., the liver of a subject).
  • oligonucleotides of the pharmaceutical combinations disclosed herein are administered intravenously or subcutaneously.
  • the subject to be treated is a human or non-human primate or other mammalian subject.
  • Other exemplary subjects include domesticated animals such as dogs and cats; livestock such as horses, cattle, pigs, sheep, goats, and chickens; and animals such as mice, rats, guinea pigs, and hamsters.
  • a pharmaceutical combination for treating HBV comprising at least two HBV therapeutics selected from the group consisting of an RNAi oligonucleotide targeting HBV, an anti-PDL1 antisense oligonucleotide, a TLR7 agonist, interferon-alpha, an anti-HBV antibody, an antibody which antagonises PD1 signalling and a nucleotide analogue.
  • RNAi oligonucleotide is a siRNA oligonucleotide that targets HBsAg mRNA and reduces the expression of HBsAg mRNA.
  • RNAi oligonucleotide is an oligonucleotide comprising an antisense strand of 19 to 30 nucleotides in length, wherein the antisense strand comprises a region of complementarity to a sequence of HBsAg mRNA set forth as ACAANAAUCCUCACAAUA (SEQ ID NO: 1).
  • RNAi oligonucleotide comprises a sense strand that has a region of complementarity to the sequence set forth as UUNUUGUGAGGAUUN (SEQ ID NO: 2).
  • RNAi oligonucleotide comprises a sense strand comprising a sequence GACAANAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 8) wherein one or more of the nucleotides of the -GAAA- sequence on the sense strand are conjugated to a GalNac moiety, preferably wherein the RNAi oligonucleotide further comprises an antisense strain comprising a sequence UUAUUGUGAGGAUUNUUGUCGG (SEQ ID NO: 4).
  • RNAi oligonucleotide is an oligonucleotide comprising a sense strand forming a duplex region with an antisense strand
  • the sense strand consists of a sequence GACAAAAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 9) and comprising 2'-fluoro modified nucleotides at positions 3, 8-10, 12, 13, and 17, 2'-O-methyl modified nucleotides at positions 1, 2, 4-7, 11, 14-16, 18-26, and 31-36, and a phosphorothioate linkage between the nucleotides at positions 1 and 2, wherein each of the nucleotides of the -GAAA- sequence on the sense strand is conjugated to a monovalent GalNac moiety; and the antisense strand consists of a sequence UUAUUGUGAGGAUUUUUGUCGG (SEQ ID NO: 6) and comprising
  • RNAi oligonucleotide is an oligonucleotide comprising a sense strand forming a duplex region with an antisense strand
  • the sense strand comprises a sequence GACAAAAAUCCUCACAAUAAGCAGCCGAAAGGCUGC (SEQ ID NO: 9) and comprising 2 -fluoro modified nucleotides at positions 3, 8-10, 12, 13, and 17, 2 -O-methyl modified nucleotides at positions 1 , 2, 4-7, 11, 14-16, 18-26, and 31-36, and one phosphorothioate internucleotide linkage between the nucleotides at positions 1 and 2, wherein each of the nucleotides of the -GAAA- sequence on the sense strand is conjugated to a monovalent GalNac moiety, wherein the -GAAA- sequence comprises the structure:
  • the antisense strand comprises a sequence as set forth in UUAUUGUGAGGAUUUUUGUCGG (SEQ ID NO: 6) and comprising 2'-fluoro modified nucleotides at positions 2, 3, 5, 7, 8, 10, 12, 14, 16, and 19, 2'-O-methyl modified nucleotides at positions 1, 4, 6, 9, 11, 13, 15, 17, 18, and 20-22, and five phosphorothioate internucleotide linkages between nucleotides 1 and 2, 2 and 3, 3 and 4, 20 and 21, and 21 and 22, wherein the 5'-nucleotide of the antisense strand has the following structure: or a pharmaceutically acceptable salt thereof. 10.
  • anti-PDL1 antisense oligonucleotide is an N-acetylgalactosamine (GalNAc)-conjugated locked nucleic acid (LNA) single-stranded oligonucleotide (SSO) that induces RNAseH- mediated degradation of PDL1 mRNA.
  • GalNAc N-acetylgalactosamine
  • LNA locked nucleic acid
  • SSO single-stranded oligonucleotide
  • anti-PDL1 antisense oligonucleotide comprises the sequence CCTATTTAACATCAGAC (SEQ ID NO: 11).
  • any one of embodiments 3 to 12, wherein the anti-PDL1 antisense oligonucleotide has the formula GN2-C6 0 c 0 a 0 CCtatttaacatcAGAC, wherein C6 represents an amino alkyl group with 6 carbons, capital letters represent beta-D- oxy LNA nucleosides, lowercase letters represent DNA nucleosides, all LNA C are 5-methyl cytosine, subscript 0 represents a phosphodiester nucleoside linkage, and unless otherwise indicated, all internucleoside linkages are phosphorothioate internucleoside linkages, and wherein GN2 represents the following trivalent GalNAc cluster: and further wherein the wavy line of the trivalent GalNAc cluster illustrates the site of conjugation of the trivalent GalNAc cluster to the C6 amino alkyl group; or a pharmaceutically acceptable salt thereof. 14. The pharmaceutical combination of any one of embodiments 3 to 13, wherein the combination is capable of
  • RNAi oligonucleotide targeting HBV is present in an amount which will result in a dose of at least about 0.1 mg/kg to about 12 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is present in an amount which will result in a dose of about 3 mg/kg to about 9 mg/kg, or a dose of about 3 mg/kg, or a dose of about 6 mg/kg, or a dose of about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is present in an amount which will result in a dose of more than 3 mg/kg, or at least about 6 mg/kg, or at least about 9 mg/kg.
  • HBV therapeutic is a TLR7 agonist, interferon-alpha, an anti-HBV antibody, an antibody which inhibits PD1 signalling, or a nucleotide analogue.
  • composition comprising the pharmaceutical combination according to any one of embodiments 3 to 30.
  • kits of parts comprising the RNAi oligonucleotide targeting HBV according to any one of embodiments 3 to 29 and instructions for administration with an anti-PDL1 antisense oligonucleotide to treat a hepatitis B virus infection.
  • kits of parts of embodiment 32, wherein the anti-PDL1 antisense oligonucleotide mentioned in the instructions is an anti-PDL1 antisense oligonucleotide according to any one of embodiments 3 to 30.
  • kit of parts of embodiment 32 or 33 wherein the kit comprises an RNAi oligonucleotide targeting HBV according to embodiment 9 and an anti-PDL1 antisense oligonucleotide according to embodiment 13.
  • 35 The kit of parts of any one of embodiments 32 to 34, wherein the RNAi oligonucleotide targeting HBV is formulated for subcutaneous injection and the anti-PDL1 antisense oligonucleotide is formulated for subcutaneous administration.
  • RNAi oligonucleotide targeting HBV and/or the anti-PDL1 antisense oligonucleotide are in the form of a transgene engineered to express the oligonucleotide in a cell.
  • embodiment 38 or 39 wherein the single or initial dose of the anti-PDL1 antisense oligonucleotide is administered at least about a week, at least about two weeks, at least about three weeks, at least about four weeks, at least about five weeks, at least about six weeks, at least about seven weeks, at least about eight weeks or longer than eight weeks after the single or initial dose of the RNAi oligonucleotide targeting HBV.
  • RNAi oligonucleotide targeting HBV is administered in weekly doses, and at least two doses are administered.
  • RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are administered in pharmaceutically effective amounts.
  • RNAi oligonucleotide targeting HBV is administered in a dose of at least about 0.1 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of about 3 mg/kg to about 9 mg/kg, or a dose of about 3 mg/kg, or a dose of about 6 mg/kg, or a dose of about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of more than 3 mg/kg, or at least about 6 mg/kg, or at least about 9 mg/kg.
  • any one of embodiments 38 to 51 wherein the anti-PDL1 antisense oligonucleotide is administered in a dose of more than 3 mg/kg, or at least about 6mg/kg.
  • any one of embodiments 38 to 52 wherein two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti- PDL1 antisense oligonucleotide are at least about 3 mg/kg.
  • any one of embodiments 38 to 53 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti-PDL1 antisense oligonucleotide are more than 3 mg/kg, preferably at least about 6 mg/kg.
  • any one of embodiments 38 to 54 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg. 56.
  • any one of embodiments 38 to 55 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg; and each dose of the anti-PDL1 antisense oligonucleotide is more than 3 mg/kg, preferably at least about 6 mg/kg.
  • hepatitis B virus infection to be treated is a chronic hepatitis B virus infection.
  • RNAi oligonucleotide targeting HBV is in a dosage form for subcutaneous administration
  • anti-PDL1 antisense oligonucleotide is in a dosage form for subcutaneous administration.
  • RNAi oligonucleotide targeting HBV and/or the anti-PDL1 antisense oligonucleotide are delivered in the form of a transgene that is engineered to express the oligonucleotide in a cell.
  • any one of embodiments 63 to 65 wherein the single or initial dose of the anti-PDL1 antisense oligonucleotide is administered at least about a week, at least about two weeks, at least about three weeks, at least about four weeks, at least about five weeks, at least about six weeks, at least about seven weeks, at least about eight weeks or longer than eight weeks after the single or initial dose of the RNAi oligonucleotide targeting HBV. 67.
  • any one of embodiments 63 to 66 wherein the single or initial dose of the anti-PDL1 antisense oligonucleotide is administered at least about four weeks after the single or initial dose of the RNAi oligonucleotide targeting HBV.
  • RNAi oligonucleotide targeting HBV is administered in weekly doses, and at least two doses are administered.
  • RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are administered in pharmaceutically effective amounts.
  • RNAi oligonucleotide targeting HBV is administered in a dose of at least about 0.1 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of about 3 mg/kg to about 9 mg/kg, or a dose of about 3 mg/kg, or a dose of about 6 mg/kg, or a dose of about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of more than 3 mg/kg, or at least about 6 mg/kg, or at least about 9 mg/kg.
  • any one of embodiments 63 to 75 wherein the anti-PDL1 antisense oligonucleotide is administered in a dose of at least about 0.1 mg/kg to about 35 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 7 mg/kg, or a dose of about 7 mg/kg to about 35 mg/kg, preferably wherein the anti-PDL1 antisense oligonucleotide is administered in up to five doses of about 3 mg/kg, the doses being administered at least once every two weeks.
  • any one of embodiments 63 to 78 wherein two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti-PDL1 antisense oligonucleotide are at least about 3 mg/kg.
  • any one of embodiments 63 to 79 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti- PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti-PDL1 antisense oligonucleotide are more than 3 mg/kg, preferably at least about 6 mg/kg.
  • RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is in a dosage form for subcutaneous administration
  • anti-PDL1 antisense oligonucleotide is in a dosage form for subcutaneous administration.
  • RNAi oligonucleotide that selectively targets HBxAg mRNA transcript.
  • RNAi oligonucleotide targeting HBV and/or the anti- PDL1 antisense oligonucleotide are delivered in the form of a transgene that is engineered to express the oligonucleotide in a cell.
  • embodiment 89 or 90 wherein the single or initial dose of the RNAi oligonucleotide targeting HBV is administered prior to the administering of the single or initial dose of the anti-PDL1 antisense oligonucleotide.
  • any one of embodiments 89 to 91 wherein the single or initial dose of the anti-PDL1 antisense oligonucleotide is administered at least about a week, at least about two weeks, at least about three weeks, at least about four weeks, at least about five weeks, at least about six weeks, at least about seven weeks, at least about eight weeks or longer than eight weeks after the single or initial dose of the RNAi oligonucleotide targeting HBV.
  • RNAi oligonucleotide targeting HBV is administered in weekly doses, and at least two doses are administered.
  • RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are administered in pharmaceutically effective amounts.
  • RNAi oligonucleotide targeting HBV is administered in a dose of at least about 0.1 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of about 3 mg/kg to about 9 mg/kg, or a dose of about 3 mg/kg, or a dose of about 6 mg/kg, or a dose of about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of more than 3 mg/kg, or at least about 6 mg/kg, or at least about 9 mg/kg.
  • any one of embodiments 89 to 101 wherein the anti-PDL1 antisense oligonucleotide is administered in a dose of at least about 0.1 mg/kg to about 35 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 7 mg/kg, or a dose of about 7 mg/kg to about 35 mg/kg, preferably wherein the anti-PDL1 antisense oligonucleotide is administered in up to five doses of about 3 mg/kg, the doses being administered at least once every two weeks.
  • any one of embodiments 89 to 104 wherein two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti- PDL1 antisense oligonucleotide are at least about 3 mg/kg.
  • any one of embodiments 89 to 105 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti-PDL1 antisense oligonucleotide are more than 3 mg/kg, preferably at least about 6 mg/kg.
  • any one of embodiments 89 to 106 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg.
  • any one of embodiments 89 to 107 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg; and each dose of the anti-PDL1 antisense oligonucleotide is more than 3 mg/kg, preferably at least about 6 mg/kg.
  • hepatitis B virus infection to be treated is a chronic hepatitis B virus infection.
  • RNAi oligonucleotide targeting HBV is in a dosage form for subcutaneous administration
  • anti-PDL1 antisense oligonucleotide is in a dosage form for subcutaneous administration.
  • RNAi oligonucleotide targeting HBV and/or the anti-PDL1 antisense oligonucleotide are delivered in the form of a transgene that is engineered to express the oligonucleotide in a cell.
  • a method for treating a hepatitis B virus infection comprising administering a therapeutically effective amount of the pharmaceutical combination, composition or kit of any one of embodiments 3 to 37 to a subject infected with a hepatitis B virus infection.
  • RNAi oligonucleotide targeting HBV is administered in weekly doses, and at least two doses are administered.
  • RNAi oligonucleotide targeting HBV and the anti-PDL1 antisense oligonucleotide are administered in pharmaceutically effective amounts.
  • RNAi oligonucleotide targeting HBV is administered in a dose of at least about 0.1 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of about 3 mg/kg to about 9 mg/kg, or a dose of about 3 mg/kg, or a dose of about 6 mg/kg, or a dose of about 9 mg/kg.
  • RNAi oligonucleotide targeting HBV is administered in a dose of more than 3 mg/kg, or at least about 6 mg/kg, or at least about 9 mg/kg. 127.
  • any one of embodiments 115 to 126 wherein the anti-PDL1 antisense oligonucleotide is administered in a dose of at least about 0.1 mg/kg to about 35 mg/kg, or a dose of at least about 0.5 mg/kg, or a dose of at least about 1 mg/kg, or a dose of at least about 1.5 mg/kg, or a dose of at least about 2 mg/kg, or a dose of at least about 3 mg/kg, or a dose of at least about 6 mg/kg, or a dose of at least about 7 mg/kg, or a dose of about 7 mg/kg to about 35 mg/kg, preferably wherein the anti-PDL1 antisense oligonucleotide is administered in up to five doses of about 3 mg/kg, the doses being administered at least once every two weeks.
  • any one of embodiments 115 to 129 wherein two or more, preferably at least five, doses of anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti- PDL1 antisense oligonucleotide are at least about 3 mg/kg.
  • any one of embodiments 115 to 130 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the doses of the anti-PDL1 antisense oligonucleotide are more than 3 mg/kg, preferably at least about 6 mg/kg.
  • any one of embodiments 115 to 131 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg.
  • any one of embodiments 115 to 132 wherein two or more, preferably at least five, doses of the anti-PDL1 antisense oligonucleotide are administered, once weekly, with the initial dose of the anti-PDL1 antisense oligonucleotide being administered at least about 7 days after the dose of the RNAi oligonucleotide targeting HBV; and the dose of the RNAi oligonucleotide targeting HBV is more than 3 mg/kg, preferably at least about 9 mg/kg; and each dose of the anti-PDL1 antisense oligonucleotide is more than 3 mg/kg, preferably at least about 6 mg/kg.
  • the hepatitis B virus infection to be treated is a chronic hepatitis B virus infection.
  • RNAi oligonucleotide targeting HBV is in a dosage form for subcutaneous administration
  • anti-PDL1 antisense oligonucleotide is in a dosage form for subcutaneous administration.
  • RNAi oligonucleotide targeting HBV and/or the anti-PDL1 antisense oligonucleotide are delivered in the form of a transgene that is engineered to express the oligonucleotide in a cell.
  • a method of reducing expression of hepatitis B virus surface antigen in a cell comprising delivering to the cell the pharmaceutical combination or composition of any one of embodiments 3 to 37.
  • the present invention concerns pharmaceutical combinations comprising the RNAi oligonucleotide targeting HBV as defined above, and the anti-PDL1 antisense oligonucleotide as defined above. Most specifically, these pharmaceutical combinations comprise the HBV therapeutics defined as T1 and T2 above.
  • surrogate equivalent molecules were used in place of T1 and T2 as defined above.
  • therapeutics tailored for use in mice were used.
  • the results disclosed in the Examples herein with these surrogate molecules will be substantially equivalent to the results that can be obtained with other RNAi oligonucleotides targeting HBV and anti-PDL1 antisense oligonucleotides as defined herein, e.g. T1 and T2.
  • the particular surrogates used in the Examples herein were used because the Examples specifically relate to mice.
  • the skilled person would equally be able to use, e.g., T1 and T2 to obtain equivalent results in human cells, tissues and subjects.
  • RNAi oligonucleotide targeting HBV and anti-PDL1 antisense oligonucleotide will be able to obtain equivalent results with other appropriate RNAi oligonucleotides targeting HBV and anti-PDL1 antisense oligonucleotides as defined herein, e.g. T1 and T2 as defined above.
  • RNAi oligonucleotide targeting HBV that was used in the Examples herein, which is equivalent to T1 and is designated “sT1”, is as follows:
  • a sense strand of formula: 5’ mG-S-mA-fC-mA-mA-mG-mA-fA-fU-fC-mC-fU-fC-mA-mC-mA- fA-mU-mA-mA-mG-mC-mA-mG-mC-mG-[ademA-GalNAc]-[ademA-GalNAc]-[ademA- GalNAc]-mG-mG-mC-mU-mG-mC 3’ (SEQ ID NO: 40); hybridised to an antisense strand of formula: 5’ [MePhosphonate-4O-mU]-S-fU-S-fA-S-mll- fU-mG-fU-f
  • [MePhosphonate-4O-mll] indicates a 4’-O-monomethylphosphonate-2’-O-methyl uridine, and, of the linkages included, denotes phosphodiester and “-S-” denotes phosphorothioate.
  • surrogate anti-PDL1 antisense oligonucleotide that was used in the Examples herein, which is equivalent to T2 and is designated “sT2”, is as follows:
  • AAV-HBV Adeno-Associated Virus-Hepatitis B Virus
  • Vehicle (Group 01) was dosed once weekly during Day 0-35.
  • sT2 at 6 mg/kg (Groups 06, 09 and 10) were dosed once weekly during Day 7-35.
  • sT2 at 3 mg/kg (Groups 04 and 07) and 6 mg/kg (Groups 05 and 08) were dosed once weekly during Day 21-49.
  • sT1 at 3 mg/kg (Groups 02 and 07-09) and 9 mg/kg (Groups 03 and 10) were dosed once on Day 0. All the compounds were administered by subcutaneous injection at 5 mL/kg.
  • Recombinant AAV-HBV solution was provided by Sponsor, and diluted appropriately. Serum levels of Hepatitis B surface antigen (HBsAg) and hepatitis B e-antigen (HBeAg) were detected by ARCHITECT i2000 (Abbott Laboratories, Lake Bluff, IL, USA) and supporting reagents. Serum HBV-DNA was detected by ABI7500 (Applied Biosystems, Foster City, CA, USA) and detection kit (Sansure Biotech Inc., Changsha, Hunan, China). Eighty -eight (88) male C57BL/6 mice aged 4-5 weeks were used.
  • HBsAg Hepatitis B surface antigen
  • HBeAg hepatitis B e-antigen
  • mice were group housed in polycarbonate cages with corncob bedding under controlled temperature (21-25°C), humidity (40-70%), and a 12-hour light / 12-hour dark cycle (7:00 AM to 7:00 PM lights on). Mice were provided ad libitum access to normal diet (Rodent Diet #5C02, PMI Nutrition International, LLC, IN, USA) and sterile water.
  • mice All procedures in this study were in compliance with local animal welfare legislation, CRO global policies and procedures, and the Guide for the Care and Use of Laboratory Animals.
  • the mice were acclimatized in the animal facility for 3 days (Acclimation Day 0-2) after arrival. On Pre-dose Day 0, all the mice were injected through tail vein with 1 * 10 11 vector genome of AAV-HBV in 200 pL of Phosphate Buffer Saline (PBS).
  • PBS Phosphate Buffer Saline
  • sT2 at 6 mg/kg (Groups 06, 09 and 10) were dosed once weekly during Day 7-35.
  • mice in all groups were bled for serum preparation (15 + 15 pL per mouse) on Days 0, 7, 14, 21 , 28, 35, 42, 49 and 56. 15 pL of plasma samples was used for quantitative detection of HBsAg, HBeAg and
  • the serum levels of HBsAg, HBeAg and HBV-DNA in the vehicle control group maintained stable during Day 0-91.
  • treatment of a siRNA oligonucleotide targeting HBV (sT1) combined with an anti-PDL1 antisense oligonucleotide (sT2) continuously and significantly decreased serum levels of HBsAg, HBeAg and HBV-DNA during Day 7-91.
  • the pharmaceutical combination comprising both an RNAi oligonucleotide targeting HBV and an anti-PDL1 antisense oligonucleotide (G07-G10) achieved continuously and significantly decreased levels of the HBV serum markers HBsAg, HBeAg and HBV-DNA, indicating a strong inhibitory effect on HBV. Surprisingly, the effect obtained by this combination was both highly advantageous, eliciting a greater response than either individual therapeutic.
  • the effect was also surprisingly synergistic, with a greater reduction in HBsAg, HBeAg and HBV-DNA serum levels than the sum of both the reduction obtained by an RNAi oligonucleotide targeting HBV alone (G02 and G03) and the reduction obtained by an anti-PDL1 antisense oligonucleotide alone (G04-G06).
  • RNAi oligonucleotide targeting HBV an RNAi oligonucleotide targeting HBV and an anti-PDL1 antisense oligonucleotide
  • the therapeutic class of an RNAi oligonucleotide, particularly siRNA, for targeting HBV when combined with the therapeutic class of an antisense oligonucleotide for targeting PDL1 , contributes to the unexpectedly advantageous results.
  • Advantageous forms and modifications of these therapeutics which are described herein, such as the general RNAi oligonucleotide sequence, GalNAc conjugation and the use of LNA, may also further contribute to the unexpectedly advantageous results.
  • AAV-HBV Adeno-Associated Virus-Hepatitis B Virus
  • AAV- HBV infected mice were selected and sorted into groups of 6 animals based on serum HBsAg, HBeAg, HBV-DNA levels and body weight on Pre-dose Day 28.
  • Vehicle (Group 01) was dosed once at Day 0 with a saline control and once weekly from Day 21-56 with a buffer control.
  • Animal clinical signs were monitored twice daily and body weight were measured twice weekly. Serum levels of HBsAg, HBeAg and HBV-DNA were measured once weekly.
  • Serum HBV-DNA was detected by ABI7500 (Applied Biosystems, Foster City, CA, USA) and detection kit (Sansure Biotech Inc., Changsha, Hunan, China). C57BL/6 male mice aged 4-5 weeks were used. Mice were group housed in polycarbonate cages with corncob bedding under controlled temperature (21-25°C), humidity (40-70%), and a 12-hour light 1 12-hour dark cycle (7:00 AM 25 to 7:00 PM lights on). Mice were provided ad libitum access to normal diet Rodent Diet #5C02 (PMI Nutrition International, LLC, IN, USA) and sterile water. All procedures in this study were in compliance with local animal welfare legislation, CRO global policies and procedures, and the Guide for the Care and Use of Laboratory Animals.
  • mice were acclimatized in the animal facility for 6 days (Acclimation Day 0-5) after arrival. On Pre-dose Day 0, all the mice were injected through tail vein with 1 * 10 11 vector genome of AAV-HBV in 200 pL of Phosphate Buffer Saline (PBS). Animal clinical signs were monitored twice daily during acclimation and pre-treatment phases. Body weight was measured on Acclimation Day 0 and Pre-dose Day 28. On Predose Day 28 (28 days after AAV-HBV injection), blood samples were collected via submandibular vein and centrifuged to prepare serum samples (10 pL per mouse). The serum samples were measured for HBsAg, HBeAg and HBV-DNA.
  • PBS Phosphate Buffer Saline
  • mice were selected and randomized into groups, with 6 per group (Table 4).
  • Vehicle (Group 01) was dosed once at Day 0 with a saline control and weekly at Day 21, 28, 35, 42, 56 with a buffer control.
  • sT3 at 100 mg/kg was dosed weekly at Day 21, 28, 35, 42, 56 in monotherapy (Group 3) or combination therapy with sT1 at 3 mg/kg dosed once on Day 0 (Groups 04).
  • sT 1 was administered by subcutaneous injection at 5 mL/kg, sT3 was administered orally at 10 mL/kg. Animal clinical signs were monitored twice daily during Day 0-140 and body weight was measured twice weekly. Serum levels of HBsAg, HBeAg and HBV DNA were measured weekly from Day 0 to 140.
  • the serum levels of HBsAg and HBV-DNA in the vehicle control group maintained at a relatively stable level during Day 0-140.
  • the combination of a siRNA oligonucleotide targeting HBV with a TLR7 agonist shows an additional reduction of serum levels of HBsAg and HBV-DNA.
  • RNAi oligonucleotide targeting HBV such as T1
  • TLR7 agonist such as T3
  • the pharmaceutical combination comprising both an RNAi oligonucleotide targeting HBV and a TLR7 agonist (Group 04) shows an additional decrease in levels of the HBV serum markers HBsAg and HBV-DNA, indicating an inhibitory effect on HBV.
  • AAV-HBV Adeno-Associated Virus- Hepatitis B Virus
  • T5 was an antibody comprising a VH domain comprising a) CDR-H1 comprising SEQ ID NO:12, b) CDR-H2 comprising SEQ ID NO:13, and c) CDR-H3 comprising SEQ ID NO:14, and a VL domain comprising d) CDR-L1 comprising SEQ ID NO:15, e) CDR-L2 comprising SEQ ID NO:16, and f) CDR-L3 comprising SEQ ID NO:17.
  • T5 was an antibody comprising a VH domain comprising SEQ ID NO: 39, and a VL domain comprising SEQ ID NO: 37.
  • T5 was an antibody comprising a heavy chain comprising SEQ ID NO: 38, and a light chain comprising SEQ ID NO: 36.
  • AAV-HBV infected SCID mice were selected and sorted into groups of 6 animals based on serum HBsAg, HBeAg, HBV-DNA levels and body weight on Pre-dose Day 14.
  • Vehicle (Group 01) was dosed once at Day 0 with a saline control and at Day 21 , 25, 29, 33 with a buffer control.
  • T5 at 20 mg/kg was dosed at Day 21 , 25, 29, 33 (Group 3 and 6).
  • sT1 at 9 mg/kg was dosed once on Day 0 by subcutaneous injection at 5 mL/kg.
  • T5 was administered by intravenous injection at 10 mL/kg.
  • animal clinical signs were monitored twice daily and body weight were measured twice weekly. Serum levels of HBsAg, HBeAg and HBV-DNA were measured once weekly.
  • Serum HBV-DNA was detected by ABI7500 (Applied Biosystems, Foster City, CA, USA) and detection kit (Sansure Biotech Inc., Changsha, Hunan, China). CB17 SCID male mice aged 4-5 weeks were used. Mice were group housed in polycarbonate cages with corncob bedding under controlled temperature (21-25°C), humidity (40-70%), and a 12-hour light / 12-hour dark cycle (7:00 AM 25 to 7:00 PM lights on). Mice were provided ad libitum access to normal diet (Rodent Diet #5CJL, PMI Nutrition International, LLC, IN, USA) and sterile water.
  • mice All procedures in this study were in compliance with local animal welfare legislation, CRO global policies and procedures, and the Guide for the Care and Use of Laboratory Animals.
  • the mice were acclimatized in the animal facility for 6 days (Acclimation Day 0-5) after arrival. On Pre-dose Day 0, all the mice were injected through tail vein with 1* 10 11 vector genome of AAV-HBV in 200 pL of Phosphate Buffer Saline (PBS). Animal clinical signs were monitored twice daily during acclimation and pre-treatment phases. Body weight was measured on Acclimation Day 0 and Pre-dose Day 14. On Pre-dose Day 14 (14 days after AAV-HBV injection), blood samples were collected via submandibular vein and centrifuged to prepare serum samples (10 pL per mouse).
  • PBS Phosphate Buffer Saline
  • mice were selected and randomized into groups, with 6 per group (Table 5).
  • Vehicle (Group 01) was dosed once at Day 0 with a saline control and at Day 21 , 25, 29, 33 with a buffer control.
  • T5 at 20 mg/kg was dosed Day 21 , 25, 29, 33 in monotherapy (Group 3) or combination therapy with sT1 at 9 mg/kg dosed once on Day 0 (Group 06).
  • sT 1 was administered by subcutaneous injection at 5 mL/kg
  • T5 and the IgG control was administered by intravenous injection at 10 mL/kg.
  • the serum levels of HBsAg, HBeAg and HBV-DNA in the vehicle control group maintained stable during Day 0-77.
  • siRNA oligonucleotide targeting HBV (sT1) combined with the IgG control (Group 5) the combination with of a siRNA oligonucleotide targeting HBV (sT1) combined with an anti-HBV antibody (T5) (Group 06) significantly decreased serum levels of HBsAg and HBV-DNA during the anti-HBs antibody treatment period Day 21-33.
  • RNAi oligonucleotide targeting HBV such as T1 or sT1
  • anti-HBs anti-HBV antibody
  • the pharmaceutical combination comprising both an RNAi oligonucleotide targeting HBV and an anti-HBV antibody (Group 06) achieved rapid and significantly decreased levels of the HBV serum markers HBsAg and HBV-DNA, indicating a strong inhibitory effect on HBV.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Organic Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Virology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2022/081355 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv Ceased WO2023083906A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
JP2024527533A JP2024544532A (ja) 2021-11-11 2022-11-09 Hbvの処置のための医薬組合せ
IL312635A IL312635A (en) 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv
AU2022384619A AU2022384619A1 (en) 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv
KR1020247015280A KR20240101580A9 (ko) 2021-11-11 2022-11-09 Hbv 치료를 위한 약학 조합물
CA3234478A CA3234478A1 (en) 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv
CN202280074145.9A CN118284695A (zh) 2021-11-11 2022-11-09 用于治疗hbv的药物组合
MX2024005399A MX2024005399A (es) 2021-11-11 2022-11-09 Combinaciones farmaceuticas para el tratamiento de hbv.
EP22817176.5A EP4430184A2 (en) 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv
US18/659,831 US20250263705A2 (en) 2021-11-11 2024-05-09 Pharmaceutical combinations for treatment of hbv

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP21207715 2021-11-11
EP21207715.0 2021-11-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/659,831 Continuation US20250263705A2 (en) 2021-11-11 2024-05-09 Pharmaceutical combinations for treatment of hbv

Publications (2)

Publication Number Publication Date
WO2023083906A2 true WO2023083906A2 (en) 2023-05-19
WO2023083906A3 WO2023083906A3 (en) 2023-07-13

Family

ID=78598914

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/081355 Ceased WO2023083906A2 (en) 2021-11-11 2022-11-09 Pharmaceutical combinations for treatment of hbv

Country Status (10)

Country Link
US (1) US20250263705A2 (cg-RX-API-DMAC7.html)
EP (1) EP4430184A2 (cg-RX-API-DMAC7.html)
JP (1) JP2024544532A (cg-RX-API-DMAC7.html)
KR (1) KR20240101580A9 (cg-RX-API-DMAC7.html)
CN (1) CN118284695A (cg-RX-API-DMAC7.html)
AU (1) AU2022384619A1 (cg-RX-API-DMAC7.html)
CA (1) CA3234478A1 (cg-RX-API-DMAC7.html)
IL (1) IL312635A (cg-RX-API-DMAC7.html)
MX (1) MX2024005399A (cg-RX-API-DMAC7.html)
WO (1) WO2023083906A2 (cg-RX-API-DMAC7.html)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025031302A1 (zh) * 2023-08-04 2025-02-13 正大天晴药业集团股份有限公司 靶向pd-l1的双链核糖核酸
WO2025242158A1 (en) * 2024-05-22 2025-11-27 Ausperbio Therapeutics Inc. Combination treatments
US12565651B2 (en) 2022-01-10 2026-03-03 Ausperbio Therapeutics Inc. Oligonucleotides comprising segmented gap structures

Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998039352A1 (en) 1997-03-07 1998-09-11 Takeshi Imanishi Novel bicyclonucleoside and oligonucleotide analogues
WO1999014226A2 (en) 1997-09-12 1999-03-25 Exiqon A/S Bi- and tri-cyclic nucleoside, nucleotide and oligonucleotide analogues
WO2000047599A1 (en) 1999-02-12 2000-08-17 Sankyo Company, Limited Novel nucleosides and oligonucleotide analogues
WO2000066604A2 (en) 1999-05-04 2000-11-09 Exiqon A/S L-ribo-lna analogues
WO2001023613A1 (en) 1999-09-30 2001-04-05 Isis Pharmaceuticals, Inc. Human rnase h and oligonucleotide compositions thereof
WO2004046160A2 (en) 2002-11-18 2004-06-03 Santaris Pharma A/S Amino-lna, thio-lna and alpha-l-oxy-ln
WO2004083430A2 (en) 2003-03-21 2004-09-30 Santaris Pharma A/S SHORT INTERFERING RNA (siRNA) ANALOGUES
WO2006066080A1 (en) 2004-12-17 2006-06-22 Anadys Pharmaceuticals, Inc. 3, 5-DISUBSTITUTED AND 3,5,7-TRISUBSTITUTED-3H-OXAZOLO AND 3H-THIAZOLO [4,5-d]PYRIMIDIN-2-ONE COMPOUNDS AND PRODRUGS THEREOF
WO2007085485A2 (en) 2006-01-27 2007-08-02 Santaris Pharma A/S Lna modified phosphorothiolated oligonucleotides
WO2007090071A2 (en) 2006-01-27 2007-08-09 Isis Pharmaceuticals, Inc. 6-modified bicyclic nucleic acid analogs
WO2007107162A2 (en) 2006-03-23 2007-09-27 Santaris Pharma A/S Small internally segmented interfering rna
US20070254362A1 (en) 2005-09-02 2007-11-01 Nastech Pharmaceutical Company Inc. COMPOSITIONS AND METHODS EMPLOYING UNIVERSAL-BINDING NUCLEOTIDES FOR TARGETING MULTIPLE GENE VARIANTS WITH A SINGLE siRNA DUPLEX
WO2007134181A2 (en) 2006-05-11 2007-11-22 Isis Pharmaceuticals, Inc. 5'-modified bicyclic nucleic acid analogs
WO2007146511A2 (en) 2006-05-05 2007-12-21 Isis Pharmaceuticals, Inc. Compounds and methods for modulating gene expression
WO2008049085A1 (en) 2006-10-18 2008-04-24 Isis Pharmaceuticals, Inc. Antisense compounds
WO2008113832A2 (en) 2007-03-22 2008-09-25 Santaris Pharma A/S SHORT RNA ANTAGONIST COMPOUNDS FOR THE MODULATION OF TARGET mRNA
US20080274462A1 (en) 2001-11-07 2008-11-06 Applera Corporation Universal bases for nucleic acid analyses, methods for using universal bases, and kits comprising universal bases
WO2008150729A2 (en) 2007-05-30 2008-12-11 Isis Pharmaceuticals, Inc. N-substituted-aminomethylene bridged bicyclic nucleic acid analogs
WO2008154401A2 (en) 2007-06-08 2008-12-18 Isis Pharmaceuticals, Inc. Carbocyclic bicyclic nucleic acid analogs
WO2009006478A2 (en) 2007-07-05 2009-01-08 Isis Pharmaceuticals, Inc. 6-disubstituted bicyclic nucleic acid analogs
US20090099115A1 (en) 2001-05-18 2009-04-16 Sirna Therapeutics, Inc. RNA INTERFERENCE MEDIATED INHIBITION OF MYC AND/OR MYB GENE EXPRESSION USING SHORT INTERFERING NUCLEIC ACID (siNA)
WO2009067647A1 (en) 2007-11-21 2009-05-28 Isis Pharmaceuticals, Inc. Carbocyclic alpha-l-bicyclic nucleic acid analogs
WO2010033225A2 (en) 2008-09-22 2010-03-25 Dicerna Pharmaceuticals, Inc. Compositions and methods for the specific inhibition of gene expression by dsrna possessing modifications
WO2010036698A1 (en) 2008-09-24 2010-04-01 Isis Pharmaceuticals, Inc. Substituted alpha-l-bicyclic nucleosides
WO2010077578A1 (en) 2008-12-09 2010-07-08 Isis Pharmaceuticals, Inc. Bis-modified bicyclic nucleic acid analogs
WO2011017521A2 (en) 2009-08-06 2011-02-10 Isis Pharmaceuticals, Inc. Bicyclic cyclohexose nucleic acid analogs
WO2011133871A2 (en) 2010-04-22 2011-10-27 Alnylam Pharmaceuticals, Inc. 5'-end derivatives
US20110294869A1 (en) 2008-09-23 2011-12-01 Traversa Therapeutics, Inc. Self delivering bio-labile phosphate protected pro-oligos for oligonucleotide based therapeutics and mediating rna interference
WO2011156202A1 (en) 2010-06-08 2011-12-15 Isis Pharmaceuticals, Inc. Substituted 2 '-amino and 2 '-thio-bicyclic nucleosides and oligomeric compounds prepared therefrom
WO2012109395A1 (en) 2011-02-08 2012-08-16 Isis Pharmaceuticals, Inc. Oligomeric compounds comprising bicyclic nucleotides and uses thereof
US8372968B2 (en) 2000-12-01 2013-02-12 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RNA interference mediating small RNA molecules
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
WO2013154798A1 (en) 2012-04-09 2013-10-17 Isis Pharmaceuticals, Inc. Tricyclic nucleic acid analogs
WO2014076195A1 (en) 2012-11-15 2014-05-22 Santaris Pharma A/S Oligonucleotide conjugates
WO2014088920A1 (en) 2012-12-06 2014-06-12 Merck Sharp & Dohme Corp. Disulfide masked prodrug compositions and methods
EP2742135A1 (en) 2011-08-11 2014-06-18 Isis Pharmaceuticals, Inc. Linkage modified gapped oligomeric compounds and uses thereof
WO2014179627A2 (en) 2013-05-01 2014-11-06 Isis Pharmaceuticals, Inc. Compositions and methods for modulating hbv and ttr expression
US8883996B2 (en) 2007-05-01 2014-11-11 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
US8927705B2 (en) 2008-12-18 2015-01-06 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US8927513B2 (en) 2009-07-07 2015-01-06 Alnylam Pharmaceuticals, Inc. 5′ phosphate mimics
US9012621B2 (en) 2000-03-30 2015-04-21 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RNA sequence-specific mediators of RNA interference
WO2015173208A2 (en) 2014-05-15 2015-11-19 F. Hoffmann-La Roche Ag Oligomers and oligomer conjugates
WO2015188197A2 (en) 2014-06-06 2015-12-10 Solstice Biologics, Ltd. Polynucleotide constructs having bioreversible and non-bioreversible groups
WO2016055553A1 (en) 2014-10-11 2016-04-14 F. Hoffmann-La Roche Ag Compounds for use in the treatment of infectious diseases
WO2016077321A1 (en) 2014-11-10 2016-05-19 Alnylam Pharmaceuticals, Inc. Hepatitis b virus (hbv) irna compositions and methods of use thereof
WO2016091698A1 (en) 2014-12-08 2016-06-16 F. Hoffmann-La Roche Ag 3-substituted 5-amino-6h-thiazolo[4,5-d]pyrimidine-2,7-dione compounds for the treatment and prophylaxis of virus infection
WO2016100401A1 (en) 2014-12-15 2016-06-23 Dicerna Pharmaceuticals, Inc. Ligand-modified double-stranded nucleic acids
WO2017157899A1 (en) 2016-03-14 2017-09-21 F. Hoffmann-La Roche Ag Oligonucleotides for reduction of pd-l1 expression
WO2018098328A1 (en) 2016-11-23 2018-05-31 Alnylam Pharmaceuticals, Inc. Modified rna agents with reduced off-target effect
WO2019079781A2 (en) 2017-10-20 2019-04-25 Dicerna Pharmaceuticals, Inc METHODS OF TREATING HEPATITIS B TYPE INFECTIONS

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MA55375A (fr) * 2019-03-20 2022-01-26 Arbutus Biopharma Corp Méthodes thérapeutiques de traitement de l'hépatite b
MX2022007908A (es) * 2019-12-24 2022-07-21 Hoffmann La Roche Combinacion farmaceutica de un oligonucleotido terapeutico que actua sobre hbv y un agonista de tlr7 para el tratamiento de hbv.
US20210285000A1 (en) * 2020-03-05 2021-09-16 Janssen Pharmaceuticals, Inc. Combination therapy for treating hepatitis b virus infection
TW202221122A (zh) * 2020-08-05 2022-06-01 瑞士商赫孚孟拉羅股份公司 B型肝炎患者之寡核苷酸治療

Patent Citations (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1998039352A1 (en) 1997-03-07 1998-09-11 Takeshi Imanishi Novel bicyclonucleoside and oligonucleotide analogues
WO1999014226A2 (en) 1997-09-12 1999-03-25 Exiqon A/S Bi- and tri-cyclic nucleoside, nucleotide and oligonucleotide analogues
WO2000047599A1 (en) 1999-02-12 2000-08-17 Sankyo Company, Limited Novel nucleosides and oligonucleotide analogues
WO2000066604A2 (en) 1999-05-04 2000-11-09 Exiqon A/S L-ribo-lna analogues
WO2001023613A1 (en) 1999-09-30 2001-04-05 Isis Pharmaceuticals, Inc. Human rnase h and oligonucleotide compositions thereof
US9193753B2 (en) 2000-03-30 2015-11-24 University Of Massachusetts RNA sequence-specific mediators of RNA interference
US9012138B2 (en) 2000-03-30 2015-04-21 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RNA sequence-specific mediators of RNA interference
US9012621B2 (en) 2000-03-30 2015-04-21 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RNA sequence-specific mediators of RNA interference
US8372968B2 (en) 2000-12-01 2013-02-12 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RNA interference mediating small RNA molecules
US20090099115A1 (en) 2001-05-18 2009-04-16 Sirna Therapeutics, Inc. RNA INTERFERENCE MEDIATED INHIBITION OF MYC AND/OR MYB GENE EXPRESSION USING SHORT INTERFERING NUCLEIC ACID (siNA)
US20080274462A1 (en) 2001-11-07 2008-11-06 Applera Corporation Universal bases for nucleic acid analyses, methods for using universal bases, and kits comprising universal bases
WO2004046160A2 (en) 2002-11-18 2004-06-03 Santaris Pharma A/S Amino-lna, thio-lna and alpha-l-oxy-ln
WO2004083430A2 (en) 2003-03-21 2004-09-30 Santaris Pharma A/S SHORT INTERFERING RNA (siRNA) ANALOGUES
WO2006066080A1 (en) 2004-12-17 2006-06-22 Anadys Pharmaceuticals, Inc. 3, 5-DISUBSTITUTED AND 3,5,7-TRISUBSTITUTED-3H-OXAZOLO AND 3H-THIAZOLO [4,5-d]PYRIMIDIN-2-ONE COMPOUNDS AND PRODRUGS THEREOF
US20070254362A1 (en) 2005-09-02 2007-11-01 Nastech Pharmaceutical Company Inc. COMPOSITIONS AND METHODS EMPLOYING UNIVERSAL-BINDING NUCLEOTIDES FOR TARGETING MULTIPLE GENE VARIANTS WITH A SINGLE siRNA DUPLEX
WO2007090071A2 (en) 2006-01-27 2007-08-09 Isis Pharmaceuticals, Inc. 6-modified bicyclic nucleic acid analogs
WO2007085485A2 (en) 2006-01-27 2007-08-02 Santaris Pharma A/S Lna modified phosphorothiolated oligonucleotides
WO2007107162A2 (en) 2006-03-23 2007-09-27 Santaris Pharma A/S Small internally segmented interfering rna
WO2007146511A2 (en) 2006-05-05 2007-12-21 Isis Pharmaceuticals, Inc. Compounds and methods for modulating gene expression
WO2007134181A2 (en) 2006-05-11 2007-11-22 Isis Pharmaceuticals, Inc. 5'-modified bicyclic nucleic acid analogs
WO2008049085A1 (en) 2006-10-18 2008-04-24 Isis Pharmaceuticals, Inc. Antisense compounds
WO2008113832A2 (en) 2007-03-22 2008-09-25 Santaris Pharma A/S SHORT RNA ANTAGONIST COMPOUNDS FOR THE MODULATION OF TARGET mRNA
US8883996B2 (en) 2007-05-01 2014-11-11 City Of Hope Methods and compositions for the specific inhibition of gene expression by double-stranded RNA
WO2008150729A2 (en) 2007-05-30 2008-12-11 Isis Pharmaceuticals, Inc. N-substituted-aminomethylene bridged bicyclic nucleic acid analogs
WO2008154401A2 (en) 2007-06-08 2008-12-18 Isis Pharmaceuticals, Inc. Carbocyclic bicyclic nucleic acid analogs
WO2009006478A2 (en) 2007-07-05 2009-01-08 Isis Pharmaceuticals, Inc. 6-disubstituted bicyclic nucleic acid analogs
WO2009067647A1 (en) 2007-11-21 2009-05-28 Isis Pharmaceuticals, Inc. Carbocyclic alpha-l-bicyclic nucleic acid analogs
WO2010033225A2 (en) 2008-09-22 2010-03-25 Dicerna Pharmaceuticals, Inc. Compositions and methods for the specific inhibition of gene expression by dsrna possessing modifications
US20110294869A1 (en) 2008-09-23 2011-12-01 Traversa Therapeutics, Inc. Self delivering bio-labile phosphate protected pro-oligos for oligonucleotide based therapeutics and mediating rna interference
WO2010036698A1 (en) 2008-09-24 2010-04-01 Isis Pharmaceuticals, Inc. Substituted alpha-l-bicyclic nucleosides
WO2010077578A1 (en) 2008-12-09 2010-07-08 Isis Pharmaceuticals, Inc. Bis-modified bicyclic nucleic acid analogs
US8927705B2 (en) 2008-12-18 2015-01-06 Dicerna Pharmaceuticals, Inc. Single stranded extended dicer substrate agents and methods for the specific inhibition of gene expression
US8513207B2 (en) 2008-12-18 2013-08-20 Dicerna Pharmaceuticals, Inc. Extended dicer substrate agents and methods for the specific inhibition of gene expression
US8927513B2 (en) 2009-07-07 2015-01-06 Alnylam Pharmaceuticals, Inc. 5′ phosphate mimics
WO2011017521A2 (en) 2009-08-06 2011-02-10 Isis Pharmaceuticals, Inc. Bicyclic cyclohexose nucleic acid analogs
WO2011133871A2 (en) 2010-04-22 2011-10-27 Alnylam Pharmaceuticals, Inc. 5'-end derivatives
WO2011156202A1 (en) 2010-06-08 2011-12-15 Isis Pharmaceuticals, Inc. Substituted 2 '-amino and 2 '-thio-bicyclic nucleosides and oligomeric compounds prepared therefrom
WO2012109395A1 (en) 2011-02-08 2012-08-16 Isis Pharmaceuticals, Inc. Oligomeric compounds comprising bicyclic nucleotides and uses thereof
EP2742135A1 (en) 2011-08-11 2014-06-18 Isis Pharmaceuticals, Inc. Linkage modified gapped oligomeric compounds and uses thereof
WO2013154798A1 (en) 2012-04-09 2013-10-17 Isis Pharmaceuticals, Inc. Tricyclic nucleic acid analogs
WO2014076195A1 (en) 2012-11-15 2014-05-22 Santaris Pharma A/S Oligonucleotide conjugates
WO2014088920A1 (en) 2012-12-06 2014-06-12 Merck Sharp & Dohme Corp. Disulfide masked prodrug compositions and methods
WO2014179627A2 (en) 2013-05-01 2014-11-06 Isis Pharmaceuticals, Inc. Compositions and methods for modulating hbv and ttr expression
WO2015173208A2 (en) 2014-05-15 2015-11-19 F. Hoffmann-La Roche Ag Oligomers and oligomer conjugates
WO2015188197A2 (en) 2014-06-06 2015-12-10 Solstice Biologics, Ltd. Polynucleotide constructs having bioreversible and non-bioreversible groups
WO2016055553A1 (en) 2014-10-11 2016-04-14 F. Hoffmann-La Roche Ag Compounds for use in the treatment of infectious diseases
WO2016077321A1 (en) 2014-11-10 2016-05-19 Alnylam Pharmaceuticals, Inc. Hepatitis b virus (hbv) irna compositions and methods of use thereof
WO2016091698A1 (en) 2014-12-08 2016-06-16 F. Hoffmann-La Roche Ag 3-substituted 5-amino-6h-thiazolo[4,5-d]pyrimidine-2,7-dione compounds for the treatment and prophylaxis of virus infection
WO2016100401A1 (en) 2014-12-15 2016-06-23 Dicerna Pharmaceuticals, Inc. Ligand-modified double-stranded nucleic acids
WO2017157899A1 (en) 2016-03-14 2017-09-21 F. Hoffmann-La Roche Ag Oligonucleotides for reduction of pd-l1 expression
WO2018098328A1 (en) 2016-11-23 2018-05-31 Alnylam Pharmaceuticals, Inc. Modified rna agents with reduced off-target effect
WO2019079781A2 (en) 2017-10-20 2019-04-25 Dicerna Pharmaceuticals, Inc METHODS OF TREATING HEPATITIS B TYPE INFECTIONS

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
"Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems", 2004, LIPPINCOTT, WILLIAMS & WILKINS
ABE ET AL., J AM CHEM SOC, vol. 129, 2007, pages 15108 - 15109
ANSEL: "Pharmaceutical Dosage Forms and Drug Delivery Systems", 1995, pages: 196,1456 - 1457
ANTAO ET AL., NUCLEIC ACIDS RES., vol. 19, no. 21, 11 November 1991 (1991-11-11), pages 5901 - 5
BASTIN, ORGANIC PROCESS RESEARCH & DEVELOPMENT, vol. 4, 2000, pages 427 - 435
BERGSTROM, CURRENT PROTOCOLS IN NUCLEIC ACID CHEMISTRY, 2009
BRAMSEN ET AL., NUCLEIC ACIDS RES., vol. 35, no. 17, September 2007 (2007-09-01), pages 5886 - 5897
BRAMSEN ET AL., NUCLEIC ACIDS RES., vol. 37, 2009, pages 2867 - 2881
BRAMSENKJEMS, FRONTIERS IN GENETICS, vol. 3, 2012, pages 1 - 22
CHANG ET AL., MOL THER, vol. 17, no. 4, April 2009 (2009-04-01), pages 725 - 32
CHANG, SEMIN FETAL NEONATAL MED, vol. 12, 2007, pages 160 - 167
CHEONG ET AL., NATURE, vol. 346, no. 6285, 16 August 1990 (1990-08-16), pages 680 - 2
CORNISHBOWDEN, NUCL. ACIDS RES., vol. 13, 1985, pages 3021 - 3030
DAN YANG ET AL., CELLULAR & MOLECULAR IMMUNOLOGY, vol. 11, 2014, pages 71 - 78
DELEAVEYDAMHA, CHEMISTRY AND BIOLOGY, vol. 19, 2012, pages 937
DELLINGER ET AL., J. AM. CHEM. SOC., vol. 125, 2003, pages 940 - 950
ELSNER, NATURE BIOTECHNOLOGY, vol. 30, 2012, pages 1063
FREIERALTMANN, NUCL. ACID RES., vol. 25, 1997, pages 4429 - 4443
GENNARO, ALFONSO R. ET AL.: "Remington: The Science and Practice of Pharmacy", 2013, LIPPINCOTT, WILLIAMS & WILKINS
GUO ET AL., SCI REP, vol. 6, 2016, pages 2552
HAMILTON ET AL., EMBO J., vol. 21, no. 17, 2002, pages 4671 - 4679
HANSEN ET AL., CHEM. COMM., 1965, pages 36 - 38
HEPATITIS B FACT SHEET N°204, July 2014 (2014-07-01)
HEPATITIS B FAQS FOR THE PUBLIC - TRANSMISSION
HEUSPARDI, SCIENCE, vol. 253, no. 5016, 12 July 1991 (1991-07-12), pages 191 - 4
HIRAO ET AL., ACCOUNTS OF CHEMICAL RESEARCH, vol. 45, 2012, pages 2055
HOHJOH, FEBS LETTERS, vol. 557, January 2004 (2004-01-01), pages 193 - 198
HOLDGATE, DRUG DISCOV TODAY, 2005
HUCH ET AL., NATURE, vol. 494, no. 7436, 2013, pages 247 - 250
IMANISHIOBIKA: "Chem. Commun.", 2002, THE ROYAL SOCIETY OF CHEMISTRY, pages: 1653 - 1659
KAKUNI ET AL., INT. J. MOL. SCI., vol. 15, 2014, pages 58 - 74
KOSHKIN ET AL., TETRAHEDRON, vol. 54, 1998, pages 3607 - 3630
KRAYNACKBAKER, RNA, vol. 12, 2006, pages 163 - 176
LOAKES ET AL.: "3-Nitropyrrole and 5-nitroindole as universal bases in primers for DNA sequencing and PCR", NUCLEIC ACIDS RES., vol. 23, no. 13, 11 July 1995 (1995-07-11), pages 2361 - 6, XP002109690
LOAKESBROWN: "5-Nitroindole as an universal base analogue", NUCLEIC ACIDS RES., vol. 22, no. 20, 11 October 1994 (1994-10-11), pages 4039 - 43, XP000999195
MATSUI ET AL., MOLECULAR THERAPY, vol. 24, no. 5, May 2016 (2016-05-01), pages 946 - 955
MCTIGUE ET AL., BIOCHEMISTRY, vol. 43, 2004, pages 5388 - 5405
MEADE ET AL., NATURE BIOTECHNOLOGY, vol. 32, 2014, pages 1256 - 1263
MERGNYLACROIX, OLIGONUCLEOTIDES, vol. 13, 2003, pages 515 - 537
MITSUOKA ET AL., NUCLEIC ACIDS RESEARCH, vol. 37, no. 4, 2009, pages 1225 - 1238
MOORE ET AL., METHODS MOL. BIOL., vol. 629, 2010, pages 141 - 158
MORITA ET AL., BIOORGANIC & MED. CHEM. LETT., vol. 12, pages 73 - 76
NAKANO ET AL., BIOCHEMISTRY, vol. 41, no. 48, 2002, pages 14281 - 14292
PRAKASH ET AL., NUCLEIC ACIDS RES., vol. 43, no. 6, 2015, pages 2993 - 3011
PRAKASH ET AL., NUCLEIC ACIDS RES., vol. 43, no. 6, 31 March 2015 (2015-03-31), pages 2993 - 3011
RICHARD B. SILVERMAN: "Organic Chemistry of Drug Design and Drug Action", 2004, ACADEMIC PRESS, article "Prodrugs and Drug Delivery Systems", pages: 497 - 558
ROWE, RAYMOND C.: "Handbook of Pharmaceutical Excipients", 2005, PHARMACEUTICAL PRESS
SANTALUCIA, PROC NATL ACAD SCI USA., vol. 95, 1998, pages 1460 - 1465
SETH ET AL., J. ORG. CHEM., vol. 75, no. 5, 2010, pages 1569 - 81
SHINJI ET AL., NIPPON KAGAKKAI KOEN YOKOSHU, vol. 78, no. 2, 2000, pages 731
SNEAD ET AL., MOLECULAR THERAPY - NUCLEIC ACIDS, vol. 2, 2013, pages e103
SORIANO ET AL., EXPERT OPINION ON INVESTIGATIONAL DRUGS, vol. 26, 2017, pages 843
SUGIMOTO ET AL., BIOCHEMISTRY, vol. 34, 1995, pages 11211 - 11216
SUN ET AL., NAT. BIOTECHNOL., vol. 26, 2008, pages 1379 - 1382
UHLMANN, CURR. OPINION IN DRUG DEVELOPMENT, vol. 3, no. 2, 2000, pages 293 - 213
VAN AERSCHOT ET AL.: "An acyclic 5-nitroindazole nucleoside analogue as ambiguous nucleoside", NUCLEIC ACIDS RES., vol. 23, no. 21, 11 November 1995 (1995-11-11), pages 4363 - 70, XP001537631, DOI: 10.1093/nar/23.21.4363
WANSETH, J. MEDICAL CHEMISTRY, vol. 59, 2016, pages 9645 - 9667
WOESE ET AL., PROC NATL ACAD SCI USA., vol. 87, no. 21, November 1990 (1990-11-01), pages 8467 - 71
YAN ET AL., J HEPATOLOGY, vol. 66, no. 6, 2017, pages 1149 - 1157

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12565651B2 (en) 2022-01-10 2026-03-03 Ausperbio Therapeutics Inc. Oligonucleotides comprising segmented gap structures
WO2025031302A1 (zh) * 2023-08-04 2025-02-13 正大天晴药业集团股份有限公司 靶向pd-l1的双链核糖核酸
WO2025242158A1 (en) * 2024-05-22 2025-11-27 Ausperbio Therapeutics Inc. Combination treatments

Also Published As

Publication number Publication date
CN118284695A (zh) 2024-07-02
KR20240101580A (ko) 2024-07-02
WO2023083906A3 (en) 2023-07-13
IL312635A (en) 2024-07-01
KR20240101580A9 (ko) 2025-12-10
US20250263705A2 (en) 2025-08-21
CA3234478A1 (en) 2023-05-19
AU2022384619A1 (en) 2024-04-11
JP2024544532A (ja) 2024-12-03
US20240425859A1 (en) 2024-12-26
MX2024005399A (es) 2024-05-23
EP4430184A2 (en) 2024-09-18

Similar Documents

Publication Publication Date Title
TWI881004B (zh) 用於治療hbv之靶向hbv的治療性寡核苷酸及tlr7促效劑之醫藥組合
US12303525B2 (en) Nucleic acid molecule for reduction of PAPD5 and PAPD7 mRNA for treating hepatitis B infection
US20240425859A1 (en) Pharmaceutical combinations for treatment of hbv
WO2019079781A2 (en) METHODS OF TREATING HEPATITIS B TYPE INFECTIONS
US20230123601A1 (en) Pharmaceutical combination of antiviral agents targeting hbv and/or an immune modulator for treatment of hbv
HK40110728A (zh) 用於治疗hbv的药物组合
HK40078455A (en) Pharmaceutical combination of a therapeutic oligonucleotide targeting hbv and a tlr7 agonist for treatment of hbv
HK40078460A (en) Pharmaceutical combination of antiviral agents targeting hbv and/or an immune modulator for treatment of hbv
WO2025067544A1 (zh) 用于抑制乙型肝炎病毒的siRNA及其用途
HK1233957A1 (en) Oligomers and oligomer conjugates

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22817176

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2022384619

Country of ref document: AU

Ref document number: AU2022384619

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 3234478

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022384619

Country of ref document: AU

Date of ref document: 20221109

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280074145.9

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 2024527533

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024009303

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2024115590

Country of ref document: RU

Ref document number: 2022817176

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2022817176

Country of ref document: EP

Effective date: 20240611

ENP Entry into the national phase

Ref document number: 112024009303

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240510

WWW Wipo information: withdrawn in national office

Ref document number: 312635

Country of ref document: IL