WO2023077069A1 - Anti-ctla-4 antibody dosing regimens - Google Patents

Anti-ctla-4 antibody dosing regimens Download PDF

Info

Publication number
WO2023077069A1
WO2023077069A1 PCT/US2022/078875 US2022078875W WO2023077069A1 WO 2023077069 A1 WO2023077069 A1 WO 2023077069A1 US 2022078875 W US2022078875 W US 2022078875W WO 2023077069 A1 WO2023077069 A1 WO 2023077069A1
Authority
WO
WIPO (PCT)
Prior art keywords
ctla
cancer
seq
antibody
dose
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/078875
Other languages
English (en)
French (fr)
Inventor
Yang Liu
Pan Zheng
Martin DEVENPORT
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oncoc4 Inc
Original Assignee
Oncoc4 Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Oncoc4 Inc filed Critical Oncoc4 Inc
Priority to CN202280072636.XA priority Critical patent/CN118176021A/zh
Priority to KR1020247012748A priority patent/KR20240099187A/ko
Priority to CA3234351A priority patent/CA3234351A1/en
Priority to AU2022377644A priority patent/AU2022377644A1/en
Priority to EP22888534.9A priority patent/EP4422685A4/en
Priority to JP2024525557A priority patent/JP2024540152A/ja
Priority to MX2024004429A priority patent/MX2024004429A/es
Publication of WO2023077069A1 publication Critical patent/WO2023077069A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

Definitions

  • the invention relates to dosing regimens for anti-CTLA-4 antibodies, including for treating cancer.
  • Cytotoxic T-lymphocyte-associated protein 4 also known as CD152 (cluster of differentiation 152), is a cell surface protein receptor that interacts with B7-1 (CD80) and B7- 2 (CD86) to ensure proper function of regulatory T cells and protects host against autoinflammatory diseases.
  • Anti-CTLA-4 monoclonal antibodies such as the approved antibody, ipilimumab (marketed as YERVOY® by Bristol Myers Squibb), have demonstrated strong and broad cancer immunotherapeutic effects (CITE) in a variety of preclinical models and are used clinically both as monotherapy and as part of combination therapy with nivolumab (anti-PD-1, marketed as OPDIVO® by Bristol Myers Squibb).
  • CITE cancer immunotherapeutic effects
  • CTLA-4 monotherapy has more immunotherapy-related adverse effects (irAEs) than anti-PD-l/PD-Ll therapy.
  • ONC-392 is a highly selective, humanized monoclonal IgGl-kappa isotype antibody against CTLA-4. Recently, it was demonstrated that ONC-392 dissociates from CTLA-4 under low pH to allow its escape from lysosomal degradation and recycling to the cell surface. There are several lines of evidence supporting the notion that a pH-sensitive antibody like ONC-392 is not only safer, but also more effective in Treg depletion and tumor rejection than ipilimumab, which is pH-insensitive. First, by preserving CTLA-4 on the cell surface, ONC-392 leaves a higher ligand density for better ADCC. Second, ONC-392 is more efficient in Treg depletion in the tumor microenvironment. And third, ONC-392 is significantly more potent in inducing rejection of large tumors. Yet, there is a need in the art for an appropriate dosing schedule to provide safe and effective treatments using ONC-392.
  • an anti-CTLA-4 antibody which may comprise administering one or more doses of the anti-CTLA-4 antibody to a subject.
  • the subject may have a cancer.
  • a method of treating a cancer in a subject in need thereof which may comprise administering one or more doses of an anti-CTLA-4 antibody to the subject.
  • an anti-CTLA-4 antibody for use in treating a cancer a composition comprising an anti-CTLA-4 antibody for treating a cancer, and use of an anti- CTLA-4 antibody in the manufacture of a medicament for treating a cancer.
  • the anti-CTLA-4 antibody may be used in combination with a second anti-cancer agent, which may be pembrolizumab.
  • Each dose of the anti-CTLA-4 antibody administered to the subject may independently be about 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 6 mg/kg, 10 mg/kg, 15 mg/kg, or 20 mg/kg.
  • the anti-CTLA-4 antibody may be administered once about every 1, 2, 3, 4, 5, or 6 weeks, particularly once about every 3 weeks.
  • Each dose of the anti-CTLA-4 antibody may be about 3 mg/kg, 6 mg/kg, or 10 mg/kg.
  • a first dose of about 10 mg/kg, a second dose of about 10 mg/kg, and one or more subsequent doses of about 1-6 mg/kg may be administered to the subject. Each subsequent dose may be about 6 mg/kg or 3 mg/kg.
  • the anti-CTLA-4 antibody may be administered to maintain a peak concentration (Cmax) of the antibody of about 200-300 pg/mL, particularly about 225-250 pg/mL, and more particularly 225 pg/mL or 250 pg/mL.
  • Cmax peak concentration
  • a dose of the anti-CTLA-4 antibody administered to the subject may be reduced as compared to an immediately preceding dose if (a) the Cmax of the anti- CTLA-4 antibody in a blood sample from the subject exceeds 225, 250 or 300 pg/mL; (b) the subject experiences a limiting toxicity; or, (c) the subject is being treated for a cancer and achieves partial or complete response to treatment with the anti-CTLA-4 antibody according to Response Evaluation Criteria in Solid Tumors (RECIST) 1.1 criteria.
  • the anti-CTLA-4 antibody may be administered intravenously, or the composition or medicament may be intended for intravenous administration.
  • the anti-CTLA-4 antibody may comprise (a) a light chain variable region comprising a complementarity determining region (CDR) 1 comprising the amino acid sequence set forth in SEQ ID NO: 1; a CDR2 comprising the amino acid sequence set forth in any one of SEQ ID NOs: 2-4; and, a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 5; and, (b) a heavy chain variable region comprising comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 6; a CDR2 comprising the amino acid sequence set forth in any one of SEQ ID NOs: 7-9; and, a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 10.
  • CDR complementarity determining region
  • the anti-CTLA-4 antibody may comprise a light chain variable region comprising a CDR2 comprising the sequence set forth in SEQ ID NO: 3 and heavy chain variable region comprising a CDR2 comprising the sequence set forth in SEQ ID NO: 9.
  • the anti-CTLA-4 antibody may comprise a light chain variable region comprising the sequence set forth in SEQ ID NO: 12 and a heavy chain variable region comprising the sequence set forth in SEQ ID NO: 16.
  • the anti-CTLA-4 antibody may comprise a light chain comprising the sequence set forth in SEQ ID NO: 23, and a heavy chain comprising the sequence set forth in SEQ ID NO: 21.
  • the anti-CTLA-4 antibody may be ONC-392.
  • the cancer may be a solid tumor.
  • the cancer may be advanced or metastatic.
  • the subject may have previously exhibited failure or intolerance to standard of care for the cancer.
  • the cancer may be refractory or resistant to anti-PD-l/PD-Ll treatment.
  • the cancer may be melanoma, metastatic melanoma, PD(L)-1 -refractory melanoma, non-small cell lung adenocarcinoma, metastatic NSCLC, NSCLC with driver mutations (for example, EGFR/ALK mutations or other targetable mutations), PD-1 -refractory NSCLC, head and neck cancer, adenoid cystic carcinoma (which may be R/M), squamous carcinoma, triple negative (basal-type) breast cancer, pancreatic cancer, renal cell carcinoma, cervical cancer, endometrial cancer, colon cancer, hepatocellular carcinoma, other solid tumors, or metastatic colorectal cancer (which may have microsatellite instability).
  • driver mutations for example, EGFR/ALK mutations or other targetable mutations
  • PD-1 -refractory NSCLC head and neck cancer
  • adenoid cystic carcinoma which may be R/M
  • squamous carcinoma triple negative (basal-type
  • FIG. 1 shows a diagram of Part A Phase IA of the ONC-392 monotherapy clinical trial.
  • DLT dose-limiting toxicity
  • Gr Grade
  • Q3W every 3 weeks
  • RECIST Response Evaluation Criteria in Solid Tumors
  • RP2D-M recommended Phase II dose for ONC-392 as monotherapy
  • TEAE treatment-emergent adverse event.
  • FIG. 2 shows a diagram of Part B Phase IA of the clinical trial of ONC-392 in combination with pembrolizumab.
  • DLT dose-limiting toxicity
  • NSCLC non-small cell lung cancer
  • PD-(L)l programmed cell death protein 1 or its ligand
  • Q3W every 3 weeks
  • RECIST Response Evaluation Criteria in Solid Tumors
  • RP2D-C Recommended Phase II dose for ONC-392 for combination therapy (ONC-392 plus pembrolizumab).
  • FIG. 3 shows a diagram of Part C Phase IB expansion of the trial of ONC-392 in monotherapy (upper) or in combination with pembrolizumab (lower).
  • ALK anaplastic lymphoma kinase
  • ECOG Eastern Cooperative Oncology Group
  • EGFR epidermal growth factor receptor
  • IO immunotherapy
  • IV intravenous
  • Mel melanoma
  • mu mutation
  • NSCLC non-small cell lung cancer
  • TNBC triple negative breast cancer
  • Q3W every 3 weeks
  • RECIST vl.l Response Evaluation Criteria in Solid Tumors version 1.1.
  • FIG. 4 shows the best overall response to ONC-392 monotherapy in Part A Phase IA of the clinical trial.
  • FIG. 5 shows the results of tumor tissue biomarker analysis of patients treated in Part A of an ONC-392 monotherapy clinical trial.
  • the top panel shows the results in a NSCLC patient dosed at 3 mg/kg ONC-392 for 7 cycles, where CD8 (red), CD4 (green), Foxp3 (purple), and tumor cells (blue) are marked.
  • the bottom left panel shows the pre-treatment results in an ovarian cancer patient, and the bottom right panel shows the results in an ovarian cancer patient treated with 10 mg/kg ONC-392 for 4 cycles, where CD8 (red), CD4 (green) Foxp3 (purple), and tumor cells (blue) are marked.
  • FIG. 6 shows goodness of fit for a final model.
  • FIG. 7 shows visual predictive check (VPC) Results.
  • FIG. 8 shows simulated PK profile at different dosing regimens: #1 : 6 mg/kg, Q3W; #2: 10 mg/kg Q3W; #3: 10 mg/kg Q4W; #4 two loading doses of 10 mg/kg + 6 mg/kg maintenance dose, Q3W.
  • FIG. 8A shows logarithmic scale
  • FIG. 8B shows normal scale. Solid line is the median pk profile; shaded area represents 90% prediction interval.
  • FIG. 9A-B shows model -predicted probability of ORR versus ONC-392 steady-state exposure using the highest dose in patients receiving ONC-392 monotherapy.
  • FIG. 10A-B shows model -predicted probability of Grade 3 or 4 TRAEs versus ONC-392 steady state Cmin (FIG. 10 A, top), Cmax (FIG. 10 A, bottom) and AUC (FIG. 10B) in patients receiving ONC-392 monotherapy.
  • FIG. 11A-B shows model -predicted probability of ORR versus ONC-392 steady-state exposure using the highest dose in patients with NSCLC (monotherapy).
  • FIG. 12A-B shows model-predicted probability of ORR and Grade >3 TRAEs versus ONC-392 steady-state exposure in patients with NSCLC.
  • the anti-CTLA-4 antibody dosing regimens described herein provide intrinsic lower toxicity and higher efficacy as compared to ipilimumab. Because of the improved safety the inventors have further determined that the clinical data on these regimens support prolonged dosing and clinical activity among cancer patients, including those with stage IV solid tumors.
  • the anti-CTLA-4 antibodies that can be used in the dosing regimens disclosed herein are pH-sensitive forms that preserve CTLA-4 recycling and avoid lysosomal degradation, such as ONC-392.
  • each intervening number there between with the same degree of precision is explicitly contemplated.
  • the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6,9, and 7.0 are explicitly contemplated.
  • anti-CTLA-4 antibody dosing regimens which may be suitable for anti-CTLA-4 antibodies that exhibit pH-sensitive binding to CTLA-4 and avoid lysosomal degradation.
  • the anti-CTLA-4 antibodies that may be used include pH-sensitive anti-CTLA-4 antibodies described in U.S. Patent No. 10,618,960, the contents of which are incorporated herein by reference. a. Anti-CTLA-4 Antibody
  • the anti-CTLA-4 antibody may comprise a light chain variable region comprising a complementarity determining region (CDR) 1 comprising the amino acid sequence RASENIYSNLA (SEQ ID NO: 1); a CDR2 comprising the amino acid sequence AATNLQS (SEQ ID NO: 2) (LC1), AATNLQD (SEQ ID NO: 3) (LC2), or AATSLQS (SEQ ID NO: 4) (LC3); and, a CDR3 comprising the amino acid sequence QHLWGTPYT (SEQ ID NO: 5).
  • the light chain variable region comprising LC1-LC3 may also comprise one of the following sequences, respectively:
  • the light chain comprising LC1-LC3 may comprise one of the following amino acid sequences, respectively:
  • LC2 [0038] DIQMTQSPSSLSASVGDRVTITCRASENIYSNLAWYQQKQGKAPKLLLYAATNL QDGVPSRFSGSGSGTDYTLTISSLQPEDFATYFCQHLWGTPYTFGQGTKLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTY SLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (SEQ ID NO: 23) [0039] LC3
  • the anti-CTLA-4 antibody may comprise a heavy chain variable region comprising a CDR1 comprising the amino acid sequence GFSLTSYGLS (SEQ ID NO: 6); a CDR2 comprising the amino acid sequence YIWYDGNTNFHPSLKSR (SEQ ID NO: 7) (HC1), YIWYDGNTNFHSSLKSR (SEQ ID NO: 8) (HC2); or, YIWYDGNTNFHSPLKSR (SEQ ID NO: 9) (HC3); and, a CDR3 comprising the amino acid sequence TEGHYYGSNYGYYALDY (SEQ ID NO: 10).
  • the heavy chain variable regions comprising HC1-HC3 may comprise one of the following amino acid sequences, respectively:
  • the anti-CTLA-4 antibody may comprise a heavy chain constant region comprising the amino acid sequence: [0050] ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQS SGL YSLS S VVTVPS S SLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCP AP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSPG (SEQ ID NO: 17)
  • the heavy chain constant region may also comprise one or more mutations. Relative to the sequence set forth in SEQ ID NO: 17, the one or more mutations may be selected from M135Y, S137T, T139E, S181A, E216A, and K217A, and a combination thereof In one example, the heavy chain constant region of the antibody comprises all six mutations.
  • the mutant heavy chain constant region may comprise the amino acid sequence:
  • the heavy chain of the anti-CTLA-4 antibody comprising heavy chain variable regions HC1-HC3 may comprise one of the following amino acid sequences, respectively:
  • HC2 [0057] QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGLSWIRQPPGKGLEWIGYIWYDG NTNFHSSLKSRVTISKDTSKSQVSLKLSSVTAADTAVYYCAKTEGHYYGSNYGYYALD YWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNATYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIAATISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
  • the anti-CTLA-4 antibody comprises a light chain variable region comprising a CDR1 comprising the sequence set forth in SEQ ID NO: 1, a CDR2 comprising the sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the sequence set forth in SEQ ID NO: 5.
  • the heavy chain variable region comprises a CDR1 comprising the sequence set forth in SEQ ID NO: 6, a CDR2 comprising the sequence set forth in SEQ ID NO: 9, and a CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the light chain variable region may comprise the sequence set forth in SEQ ID NO: 12 and the heavy chain variable region may comprise the sequence set forth in SEQ ID NO: 16. More particularly, the light chain may comprise the sequence set forth in SEQ ID NO: 23, and the heavy chain may comprise the sequence set forth in SEQ ID NO: 21.
  • This antibody may be referred to as ONC- 392.
  • the anti-CTLA-4 antibody comprises a light chain variable region comprising a CDR1 comprising the sequence set forth in SEQ ID NO: 1, a CDR2 comprising the sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the sequence set forth in SEQ ID NO: 5.
  • the heavy chain variable region comprises a CDR1 comprising the sequence set forth in SEQ ID NO: 6, a CDR2 comprising the sequence set forth in SEQ ID NO: 7, and a CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the light chain variable region may comprise the sequence set forth in SEQ ID NO: 13 and the heavy chain variable region may comprise the sequence set forth in SEQ ID NO: 14. More particularly, the light chain may comprise the sequence set forth in SEQ ID NO: 23, and the heavy chain may comprise the sequence set forth in SEQ ID NO: 19.
  • the anti-CTLA-4 antibody comprises a light chain variable region comprising a CDR1 comprising the sequence set forth in SEQ ID NO: 1, a CDR2 comprising the sequence set forth in SEQ ID NO: 4, and a CDR3 comprising the sequence set forth in SEQ ID NO: 5.
  • the heavy chain variable region comprises a CDR1 comprising the sequence set forth in SEQ ID NO: 6, a CDR2 comprising the sequence set forth in SEQ ID NO: 9, and a CDR3 comprising the sequence set forth in SEQ ID NO: 10.
  • the light chain variable region may comprise the sequence set forth in SEQ ID NO: 12 and the heavy chain variable region may comprise the sequence set forth in SEQ ID NO: 16. More particularly, the light chain may comprise the sequence set forth in SEQ ID NO: 24, and the heavy chain may comprise the sequence set forth in SEQ ID NO: 21.
  • the anti-CTLA-4 antibody may be administered to a subject, which may be a human.
  • the administration may be to treat a cancer, as described further herein.
  • the anti-CTLA-4 antibody may be administered systemically, which may be via injection or intravenous administration.
  • the antibody may be administered as a monotherapy, or as a combination therapy.
  • the dosing regimen may comprise administering one or more doses of the anti-CTLA-4 antibody.
  • each dose may be about 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 5, mg/kg, 6 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 50 mg/kg, or 100 mg/kg, or an amount in a range of two of these amounts.
  • the dosing regimen may comprise periodic dosing, in which one of the foregoing doses is administered to the subject. At each cycle of dosing, the dose may be different from a previous dose. The dosing may involve escalating doses.
  • the anti-CTLA-4 antibody is administered about every 1, 2, 3, 4, 5, or 6 weeks. In particular, the antibody is administered about every 3 weeks.
  • “about” may mean ⁇ 1, 2, or 3 days.
  • the dose of the anti-CTLA-4 antibody may be about 1, 3, 6, or 10 mg/kg, or an amount in a range of two of these amounts.
  • the dosing regimen may also comprise 10 mg/kg for two doses, followed by 1-6 mg/kg of extended dosing (that is, each subsequent dose is 1-6 mg/kg).
  • the extended dosing may comprise administering a dose of 3 mg/kg or 6 mg/kg.
  • each administration is once about every 3 weeks.
  • the dosing may take place over a period of 3, 6, 9, 12, 15, 18, 21, 24, 27, 30, 33, 36, 39, 42, 45, 48 or 51 weeks.
  • the anti-CTLA-4 antibody is used as a monotherapy and the dose is 10 mg/kg administered every 4 weeks.
  • the anti-CTLA-4 antibody is used in combination with pembrolizumab and the anti-CTLA-4 antibody dose is 3 or 6 mg/kg administered every 3 weeks, which may be coincident with the pembrolizumab dose schedule.
  • the pharmacokinetics of the anti-CTLA-4 antibody is monitored, and the dosing is adjusted adaptively to maintain a Cmax of about 200-300 pg/mL.
  • the Cmax may be maintained for 6-52 weeks.
  • the concentration may be measured from a subject’s blood sample, which may be serum or plasma sample.
  • the dosing is adjusted adaptively to maintain a Cmax of about 200-300 pg/mL, about 225-250 pg/mL, about 225 pg/mL, or about 250 pg/mL.
  • the dosing may be adjusted to avoid an excessively high Cmax, which may be 200, 225, 250, or 300 pg/mL, particularly 250 pg/mL or 300 pg/mL.
  • a deescalating dose level is administered to the subject if the Cmax is excessively high, if the subject experiences one or more limiting toxi cities, or if the subject has cancer and the subject achieves partial or complete response by Response Evaluation Criteria in Solid Tumors (RECIST) 1.1 criteria.
  • RECIST Response Evaluation Criteria in Solid Tumors
  • the anti-CTLA-4 antibody may be administered in combination, either separately or mixed with, a second therapeutic agent.
  • the therapeutic agent may be an anti-cancer agent.
  • the anti-cancer agent is administered on the same day as the anti-CTLA-4 antibody.
  • the anti-cancer agent may be an anti-PD-1 or anti-PD-Ll antibody.
  • the anti -cancer agent is pembrolizumab (KEYTRUDA).
  • pembrolizumab is administered at 200 mg/cycle, every 21 days (3 weeks).
  • the second therapeutic agent is administered on the same day as the anti-CTLA-4 antibody.
  • the anti-CTLA-4 antibody may be formulated at a dose described herein.
  • the formulation comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 50, or 100 mg/mL of the anti-CTLA-4 antibody, or an amount in a range thereof. In one example, the amount is 5 mg/mL.
  • the formulation may comprise 5, 10, 15, 20, 25, 30, 35, or 40 mM histidine buffer, or an amount in a range of two of these amounts. In one example, the amount is 20 mM.
  • the formulation may also comprise 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9.0, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, or 10.0% (w/v) a, a-trehalose dihydrate, or an amount in a range of two of these amounts. In one example, the amount is 8.8%.
  • the formulation may comprise 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, or 0.10 (w/v) polysorbate 80, or an amount in a range of two of these amounts. In one example, the amount is 0.06%.
  • the formulation may of a pH of 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, or 6.5, or a pH in a range thereof.
  • Equivalent ingredients to histidine buffer, a, a-trehalose dihydrate, and polysorbate 80 for formulating antibodies are known in the art, and may also be used as substitutes.
  • compositions and dosing regimens therefor may be used to treat cancer.
  • a method of treating cancer in a subject in need thereof may comprise administering an anti-CTLA-4 antibody described herein to the subject.
  • the anti-CTLA-4 antibody for use in treating cancer and use of the anti-CTLA-4 antibody in the manufacture of a medicament for treating cancer.
  • the method, use, or medicament may comprise administering the anti-CTLA-4 antibody or medicament using a dosing regimen described herein.
  • the cancer may be a solid tumor.
  • the cancer may be one of progressive locally advanced and metastatic cancer.
  • the cancer may be stage IV cancer.
  • the subject may exhibit failure or intolerance to standard of care guidelines, which may be National Comprehensive Cancer Network Clinical Practice Guidelines in Oncology (NCCN Guidelines).
  • NCCN Guidelines National Comprehensive Cancer Network Clinical Practice Guidelines in Oncology
  • the cancer may be refractory or resistant to anti-PD-l/PD-Ll treatment.
  • the resistance may be primary resistance or acquired resistance with disease progression after immunotherapy.
  • the primary PD-1 resistance may be defined as disease progression within 24 weeks of initiation of anti-PD-(L)l therapy.
  • the acquired PD-1 resistance may be defined as 24 weeks or more of disease control (CR, PR or SD) after initiation of anti-PD-(L)l therapy and has subsequently progressed after 24 weeks.
  • the cancer may be immunotherapy naive, and may be PD-L1 positive, such as by having PD-L1 Tumor Proportion Score >1%.
  • the cancer may be non-small cell lung cancer.
  • the cancer is ovarian, cervical, gastroesophageal, lung, or ovarian cancer.
  • the subject may be 18 years of age or older.
  • the subject may have metastatic disease or locally advanced disease not amenable to local therapy.
  • the subject may also have failed established standard medical anti-cancer therapies, which may be other than pembrolizumab for a given tumor type, or may have been intolerant to such therapy.
  • the subject may have an Eastern Cooperative Oncology Group performance status of ⁇ 2.
  • the cancer may be a neoplasm or tumor resulting from abnormal uncontrolled growth of cells.
  • the cancer may be a leukemia or lymphoma.
  • the cancer may also involve cells that have the potential to metastasize to distal sites.
  • the cancer may be one of the following: a carcinoma, such as that of the bladder, breast, colon, kidney, liver, lung, ovary, pancreas, stomach, cervix, thyroid or skin; squamous cell carcinoma; a hematopoietic tumor of lymphoid lineage, such as a leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, or Berkitt’s lymphoma; a hematopoietic tumor of myeloid lineage, such as acute and chronic myelogenous leukemia or promyelocytic leukemia; a tumor of mesenchymal origin, such as fibrosarcoma or rhabdomyoscarcoma; a tumor such as melanoma, seminoma, tetratocarcinoma, neuroblastoma, or glioma; a tumor of the central and peripheral nervous system,
  • the subject who has cancer may have a histologically or cytologically confirmed diagnosis of solid tumors and progressive locally advanced or metastatic disease, and may have failure or intolerance to established standard medical anti-cancer therapies per standard of care guidelines, which may be NCCN Guidelines.
  • the tumors may be of a type for which pembrolizumab has been approved as standard of care treatment.
  • the subject who has cancer may have advanced or metastatic cancer, and may have disease progression after prior systemic cancer treatments.
  • the cancer is pancreatic cancer, triple negative breast cancer, non-small cell lung cancer (NSCLC) with Epidermal Growth Factor mutation or other targetable mutations, PD-1 -refractory NSCLC, head and neck cancer, and ovarian cancer.
  • NSCLC non-small cell lung cancer
  • the subject with cancer may have advanced/metastatic cancer, and may be treatment naive, immunotherapy (IO) naive, or refractory/resistant (R/R) to anti -programmed cell death protein 1 or its ligand (anti-PD-(L)l.
  • the cancer may be NSCLC IO naive, PD-L1 -positive with a Tumor Proportion Score (TPS) >1%, NSCLC IO R/R, melanoma IO naive, or melanoma IO R/R.
  • TPS Tumor Proportion Score
  • the cancer may be recurrent and/or metastatic (R/M) adenoid cystic carcinoma, which may not be amenable to curative intent surgery or radiation.
  • the cancer may be a melanoma, metastatic melanoma, PD(L)-1 -refractory melanoma, non-small cell lung adenocarcinoma, metastatic NSCLC, NSCLC with driver mutations (for example, EGFR/ALK mutations or other targetable mutations), PD-1 -refractory NSCLC, head and neck cancer, adenoid cystic carcinoma (which may be R/M), squamous carcinoma, triple negative (basal-type) breast cancer, pancreatic cancer, renal cell carcinoma, cervical cancer, endometrial cancer, colon cancer, hepatocellular carcinoma, other solid tumors, or metastatic colorectal cancer (which may have microsatellite instability).
  • driver mutations for example, EGFR/ALK mutations or other targetable mutations
  • PD-1 -refractory NSCLC head and neck cancer
  • adenoid cystic carcinoma which may be R/M
  • squamous carcinoma triple negative (basal
  • the cancer may be caused by aberrations in apoptosis.
  • the cancer may be a follicular lymphomas, a carcinoma with one or more p53 mutations, a hormone-dependent tumor of the breast, prostate or ovary, a precancerous lesion such as familial adenomatous polyposis, or a myelodysplastic syndrome.
  • the cancer may be a malignancy or dysproliferative change (such as metaplasia or dysplasia), or a hyperproliferative disorders, and may be in the ovary, bladder, breast, colon, lung, skin, pancreas, or uterus.
  • the cancer may also be sarcoma, melanoma, or leukemia.
  • This example demonstrates safety and efficacy of the anti-CTLA-4 antibody ONC-392 for treating cancer, particularly advanced solid tumors and non-small cell lung cancer (NSCLC).
  • NSCLC non-small cell lung cancer
  • Phase IA ONC-392 monotherapy dose-finding cohorts patients with a histologically or cytologically confirmed diagnosis of solid tumors who have progressive locally advanced or metastatic disease after failure of or intolerance to established standard medical anticancer therapies, as per standard of care guidelines, such as NCCN guidelines, will be enrolled.
  • Phase IA combination dose finding cohorts patients with a histologically or cytologically confirmed diagnosis of solid tumors who have progressive locally advanced or metastatic disease, and the tumor types are cancers that pembrolizumab has been approved as standard of care treatment, will be enrolled.
  • Treatment naive, or checkpoint inhibitor immunotherapy naive or refractory/resistant patients can be enrolled.
  • pancreatic cancer pancreatic cancer
  • TNBC triple negative breast cancer
  • NSCLC non-small cell lung cancer with EGFR (Epidermal Growth Factor Receptor) mutation or other targetable mutations
  • PD-1 refractory NSCLC Arm I
  • head and neck cancers Arm K
  • ovarian cancer Arm L
  • solid tumors that are not eligible to or other tumor types than those specified in Arm A, B, C, I, K, and L
  • Part A is a dose-finding rapid titration study of ONC-392 as a single agent in patients with advanced solid tumors of various histology. The aim of this trial is to define the recommended Phase II dose for ONC-392 monotherapy (RP2D-M).
  • Part B is a dose-finding study of ONC-392 in combination with a standard dose of 200 mg Pembrolizumab to define the recommended Phase II dose for ONC 392 in combination with Pembrolizumab (RP2D-C) in patients with advanced solid tumors of various histology for which Pembrolizumab is approved as standard of care (SOC).
  • Part C Figure 3) Phase IB expansion cohorts of ONC-392 in monotherapy and in combination therapy with Pembrolizumab to determine safety and initial efficacy. Additional arms may be included in future protocol amendments. Arms A, B, C, I, K, L, M monotherapy expansion cohorts can be initiated after the RP2D-M is determined. Arms D - G expansion cohorts with combination therapy can be initiated after the RP2D-C is determined.
  • Arm A Pancreatic Cancer Cohort, ONC-392 monotherapy, will enroll advanced/metastatic pancreatic cancer patients, including ampullary cancer, who have progressive disease after first and second lines of systemic treatment.
  • Arm B TNBC Cohort, ONC-392 monotherapy, will enroll advanced/metastatic TNBC patients who have progressive disease after prior systemic treatments, including checkpoint inhibitor immunotherapy.
  • Arm C NSCLC Mono Cohort 1, ONC-392 monotherapy, will enroll advanced/metastatic NSCLC patients with EGFR or ALK mutations or other targetable mutations who have progressive disease after prior systemic treatments, including targeted therapy or checkpoint inhibitors.
  • Arm D NSCLC IO Naive Cohort, ONC-392/Pembrolizumab combination therapy, will enroll advanced/metastatic NSCLC cancer patients who are treatment naive, or anti PD (L)l immunotherapy naive and PD-L1 -positive (PD LI TPS > 1%).
  • Arm E NSCLC IO R/R Cohort, ONC-392/Pembrolizumab combination therapy, will enroll advanced/metastatic NSCLC cancer patients who are R/R to prior anti-PD-(L)l immunotherapy regardless of PD-L1 status.
  • Arm F Melanoma IO Naive Cohort, ONC-392/Pembrolizumab combination therapy, will enroll advanced/metastatic Melanoma patients who are treatment naive, or checkpoint inhibitor immunotherapy naive. Prior systemic chemotherapy or targeted therapy are allowed.
  • Arm G Melanoma IO R/R Cohort, ONC-392/Pembrolizumab combination therapy, will enroll advanced/metastatic melanoma patients who are R/R to anti-PD-(L)l immunotherapy.
  • Arm I NSCLC Mono Cohort 2, ONC-392 monotherapy, will enroll advanced/metastatic NSCLC patients without EGFR or ALK mutations or other targetable mutations who have progressive disease after prior systemic treatments, including chemotherapy or checkpoint inhibitors. Patient must have anti-PD-(L)l treatment, either alone or in combination, as last treatment before enrollment. Prior anti-CTLA-4 treatment is allowed.
  • Arm K Head and Neck Cancer, ONC-392 monotherapy, will enroll advanced/metastatic Squamous Cell Carcinoma (HNSCC) and other histology types except adenoid cystic carcinoma, with or without positive HPV, who have progressive disease after prior systemic treatments, including chemotherapy or checkpoint inhibitors, or immunotherapy.
  • HNSCC Advanced Cell Carcinoma
  • Arm L Ovarian Cancer, ONC-392 monotherapy, will enroll patients with advanced/metastatic ovarian cancer, including primary peritoneal cancer and fallopian tube cancer, who have progressive disease after prior systemic treatments, including chemotherapy, targeted therapy or checkpoint inhibitors.
  • Arm M Solid Tumors, ONC-392 monotherapy, will enroll patients with advanced/metastatic solid tumors who are not eligible for above mentioned monotherapy arms, who have progressive disease after prior systemic treatments, including chemotherapy, targeted therapy or checkpoint inhibitors.
  • ONC-392 For dose escalation in monotherapy, five dose levels of ONC-392 will be evaluated: 0.1 mg/kg, 0.3 mg/kg, 1.0 mg/kg, 3.0 mg/kg and 10 mg/kg. ONC-392 will be administered as an IV infusion over a minimum of 30 minutes for dose levels of 0.1, 0.3, and 1.0 mg/kg and a minimum of 60 minutes for the 3.0 mg/kg dose level. At the 10 mg/kg dose level, a minimum of 90 minutes of infusion time is required for the first dose, and a minimum of 60 minutes for subsequent doses. The ONC-392 dosing interval will be 21 days (every 3 weeks [Q3W]). Intrapatient dose escalation up to 3 mg/kg is allowed.
  • ONC-392 will be administered first as an IV infusion over a minimum of 60 minutes except that the first dose of ONC-392 10 mg/kg should be administrated over a minimum of 90 minutes.
  • the IV infusion should be given over 60 minutes.
  • Pembrolizumab will then be administered IV over a minimum of 30 minutes at a fixed 200 mg/dose. There will be a gap of at least 30 minutes between the end of the ONC-392 infusion and the start of the Pembrolizumab infusion.
  • ONC-392 and Pembrolizumab should not be mixed during administration. ONC-392 and Pembrolizumab will both be given Q3W.
  • Study treatment may be continued for 4 additional cycles (optional) after a patient has confirmed progressive disease (PD) based on immune Response Evaluation Criteria in Solid Tumors (iRECIST) if the patient tolerates the treatment.
  • PD progressive disease
  • iRECIST immune Response Evaluation Criteria in Solid Tumors
  • Study treatment should be stopped for unacceptable toxicity, voluntary withdrawal by the patient, or at 1 year (13- or 17 cycles), whichever occurs first (refer to Section 5.7 for options after 1 year).
  • Part A ONC-392, 5 dose levels (0.1 mg/kg, 0.3 mg/kg, 1.0 mg/kg, 3.0 mg/kg, and 10.0 mg/kg) by IV infusion Q3W. Intrapatient dose escalation allowed to 3.0 mg/kg. Dose finding until RP2D-M. Up to a total of 17 doses in 12 months.
  • Part C Arms A-C and Arms I, K, L, M. ONC-392 at the RP2D-M by IV infusion according to following dosing schedule.
  • the treatment period will be up to one year.
  • Part C Arms D-G. ONC-392 at RP2D-C + Pembrolizumab at 200 mg by IV infusion Q3W. Up to a total of 17 cycles in 12 months.
  • the ONC-392 RP2D-C has been determined to be 6 mg/kg.
  • Part A A minimum of 10 and a maximum of 30 patients will be enrolled in ONC-392 monotherapy to identify the RP2D-M.
  • Part B A minimum of 6 and a maximum of 36 patients will be enrolled in ONC-392 and Pembrolizumab combination therapy to identify the RP2D-C. Dose de-escalation will stop if more than 2 DLTs out of 6 patients at 1 mg/kg.
  • Part C The expansion cohort study will be carried out with an adaptive trial design. For each cohort, a futility stopping rule will apply. A minimum of 15 and a maximum of 30 patients will be enrolled in each expansion arm except for arm A, which a maximum of 30 efficacy evaluable patients will be enrolled.
  • the Part A Phase IA trial was tested up to five predefined dose levels: 0.1 mg/kg, 0.3 mg/kg, 1 mg/kg, 3 mg/kg and 10 mg/kg of ONC-392 as monotherapy through IV infusion every 21 days (Q3W).
  • the trial used an accelerated titration design.
  • Intra-patient dose escalation was tested in the first patient receiving 0.1 mg/kg, 0.3 mg/kg, 1.0 mg/kg without any AE. This patient was escalated to 3.0 mg/kg and received 3 cycles at this dose without any AE.
  • the second patient started at 0.3 mg/kg without any AE.
  • the enrollment was then converted to a 3+3 design at 3.0 mg/kg and 10.0 mg/kg levels in the protocol below.
  • Part B Combination of ONC-392 and Pembrolizumab in NSCLC
  • Part B was designed as a Phase IA dose escalation/de-escalation study followed by a Phase IB expansion component at the RP2D-C for the combination of ONC-392 with pembrolizumab in two cohorts of patients with NSCLC.
  • the dose for pembrolizumab was fixed at 200 mg/cycle dosed every 21 days (Q3W).
  • the Phase IA study was started at the dose one level below the RP2D-M dose for ONC- 392 with 200 mg of pembrolizumab and was to initially enroll 6 patients.
  • the ONC-392 dose was to be adjusted according to following scenario:
  • the Part B Phase IB expansion cohorts were both designed for patients with advanced NSCLC and included an immunotherapy naive cohort and a refractory/resistant cohort.
  • One of the aims of the expansion cohorts was to arrive at a more comprehensive safety profile for the combination of ONC-392 at the RP2D-C plus pembrolizumab.
  • FIG. 4 shows the results of tumor tissue biomarker analysis.
  • the top panel shows the results in a NSCLC patient dosed at 3 mg/kg ONC-392 for 7 cycles, where CD8, CD4, Foxp3, and tumor cells are marked respectively by red, green, magenta, and cyan colors.
  • the bottom left panel shows the pre-treatment results in an ovarian cancer patient
  • the bottom right panel shows the results in an ovarian cancer patient treated with 10 mg/kg ONC-392 for 4 cycles, where CD8, CD4, Foxp3, and tumor cells are marked respectively by red, green, magenta, and cyan colors.
  • beneficial activity was observed in 6/10 patients.
  • Two of 6 patients treated at 10 mg/kg ONC-392 exhibited complete response, two of 6 patients treated at 10 mg/kg ONC- 392 had stable disease with a significant reduction of tumor burden or a biomarker of enhanced T cell activation in the tumor, and two out of 4 patients treated at 3 mg/kg had stable disease (SD) at greater than 7 months.
  • Stable disease was observed in 7 out of 10 patients, and partial response was observed in 1 out of 10 patients in the first tumor assessment.
  • clinical improvements were observed among three PD-(L)1 refractory/resistant patients with NSCLC (one with complete response; one with disease control at greater than 24 weeks who became eligible for surgery; and, one with stable disease at 8 weeks with continued treatment).
  • ONC-392 was generally safe and well tolerated. Treatment-related AEs could be managed. And the maximum tolerable dose was not reached at the 10 mg/kg dose. ONC-392 also demonstrated therapeutic anti-tumor activities. As the first pH-sensitive monoclonal antibody that preserves CTLA-4 recycling and avoids lysosomal degradation, ONC-392 may fundamentally change the risk/benefit ratio of CTLA-4 targeting by conferring improved efficacy and reduced toxicity.
  • This example demonstrates safety and efficacy of ONC-392 administered at 10 mg/kg Q3W for two cycles, followed by 6 mg/kg Q3W for up to 12 months. This regimen is selected based on the efficacy and safety information, PK, and exposure-response analyses of an ongoing ONC-392 study.
  • regimen #4 (10 mg/kg Q3W x 2, followed by 6 mg/kg Q3W) had lowest incidence of grade >3 TRAEs (12%), treatment-related SAEs (12%), and TRAEs leading to study treatment discontinuation (6%).
  • a population PK model was constructed with 420 measurable PK observations from 70 patients, including 57 patients receiving monotherapy of ONC-392 and 13 patients receiving combination therapy with pembrolizumab.
  • the PK data of ONC-392 covered doses ranging from 0.1 to 10 mg/kg administered by the intravenous (IV) route.
  • the dataset contains 446 PK samples from 71 patients with various cancer types. Twenty-six PK samples were excluded from the analysis due to one of the following reasons: 1) outlier, 2) pre-dose samples with negative time since first dose, 3) missing or potentially incorrect sampling time records or dosing information (Subject 001-130).
  • a population PK model was constructed with 420 measurable PK observations from 70 patients, including 57 patients receiving monotherapy of ONC-392 and 13 patients receiving combination therapy with pembrolizumab.
  • Nonlinear Mixed Effects Modeling software (NONMEM® version 7.4; ICON, Hanover, MD, US), a software package for nonlinear mixed-effects analysis, was used for population PK modeling and simulations to derive exposure metrics for the subsequent E-R analysis.
  • R version 4.0.1 was used for diagnostic plots and visual check of all plots.
  • Nonlinear mixed-effects models were fitted to the concentration-time data of ONC-392 as a function of dose, time and other subject-level covariates.
  • One or two compartment structure model; linear or empirical target mediated drug disposition (TMDD) models were tested.
  • PK of ONC-392 are best described by a 2-compartment model with first-order elimination.
  • the systemic clearance (CL) of ONC-392 was estimated to be 182 mL/day (Table 8), and the terminal ti/2 was estimated to be 25.7 days.
  • Baseline albumin was identified as a significant covariate for CL; increased albumin level is associated with decreased CL.
  • Body weight was identified as a significant covariate for volume terms, including central volume (VI) and peripheral volume (V2); increased body weight is associated with increased VI and V2. No effects of age, sex, race, AST, bilirubin, creatinine clearance, or cancer type on ONC-392 PK were detected. None of these covariates were considered clinically significant relevant. Of note, concurrent chemotherapy with PD-1 was not a significant PK covariate.
  • the final population PK model of ONC-392 was used to predict concentration-time profiles based on posterior Bayesian estimates.
  • the model-simulated steady-state exposure was used as PK metrics to assess the preliminary relationship between exposure and efficacy/safety outcomes.
  • regimen #4 is based on clinical data and PK.
  • Regimen 2 at 10 mg/kg Q3W, which gives the highest exposure, had clinical activities but also highest toxi cities relative to other dose/regimens.
  • 50% (3/6) of the patients in Part A (dose escalation) and 39% (16/41) of the patients in Part C dose expansion of the study developed grade 3 or 4 TRAE.
  • 2/2 PD(L)1 -resistant NSCLC patients who were treated with this regimen developed Grade 3 TRAE.
  • regimen was not chosen for safety concerns.
  • regimen #3 10 mg/kg Q4W, and regimen #4, with loading dose 10 mg/kg Q3W x 2, followed by 6 mg/kg Q3W maintenance, higher Cmax is achieved earlier in the regimen #4 but more sustained exposure is delivered by regimen 3.
  • Both regimens showed comparable clinical activities (ORR 13-14%) among all cancer types.
  • regimen 4 yielded an ORR of 30% and DCR of 70% among 10 evaluable patients at the first and second tumor assessments in patients with PD(L)-1 -resistant NSCLC.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Oncology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2022/078875 2021-10-29 2022-10-28 Anti-ctla-4 antibody dosing regimens Ceased WO2023077069A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CN202280072636.XA CN118176021A (zh) 2021-10-29 2022-10-28 抗ctla-4抗体给药方案
KR1020247012748A KR20240099187A (ko) 2021-10-29 2022-10-28 항-ctla-4 항체 투여 요법
CA3234351A CA3234351A1 (en) 2021-10-29 2022-10-28 Anti-ctla-4 antibody dosing regimens
AU2022377644A AU2022377644A1 (en) 2021-10-29 2022-10-28 Anti-ctla-4 antibody dosing regimens
EP22888534.9A EP4422685A4 (en) 2021-10-29 2022-10-28 ANTI-CTLA-4 ANTIBODY DOSING SCHEMES
JP2024525557A JP2024540152A (ja) 2021-10-29 2022-10-28 抗ctla-4抗体投与レジメン
MX2024004429A MX2024004429A (es) 2021-10-29 2022-10-28 Regimenes de dosificacion del anticuerpo anti-ctla-4.

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163273660P 2021-10-29 2021-10-29
US63/273,660 2021-10-29

Publications (1)

Publication Number Publication Date
WO2023077069A1 true WO2023077069A1 (en) 2023-05-04

Family

ID=86158833

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/078875 Ceased WO2023077069A1 (en) 2021-10-29 2022-10-28 Anti-ctla-4 antibody dosing regimens

Country Status (9)

Country Link
EP (1) EP4422685A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024540152A (cg-RX-API-DMAC7.html)
KR (1) KR20240099187A (cg-RX-API-DMAC7.html)
CN (1) CN118176021A (cg-RX-API-DMAC7.html)
AU (1) AU2022377644A1 (cg-RX-API-DMAC7.html)
CA (1) CA3234351A1 (cg-RX-API-DMAC7.html)
MX (1) MX2024004429A (cg-RX-API-DMAC7.html)
TW (1) TW202325738A (cg-RX-API-DMAC7.html)
WO (1) WO2023077069A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024238912A1 (en) * 2023-05-17 2024-11-21 OncoC4, Inc. Ph-sensitive anti-ctla-4 antibodies and uses thereof
WO2026041780A3 (en) * 2024-08-23 2026-04-02 BioNTech SE Combination therapy comprising anti-ctla4 antibodies and chemotherapy for cancer treatment

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070160619A1 (en) * 2005-12-07 2007-07-12 Nichol Geoffrey M CTLA-4 Antibody Dosage Escalation Regimens
US20150283234A1 (en) * 2012-10-23 2015-10-08 Bristol-Myers Squibb Company Combination of anti-kir and anti-ctla-4 antibodies to treat cancer
US10232040B2 (en) * 2014-05-13 2019-03-19 Medimmune, Llc Anti-B7 H1 and anti-CTLA-4 antibodies for treating non-small cell lung cancer
US10618960B2 (en) 2015-12-15 2020-04-14 Oncoimmune, Inc. Chimeric and humanized anti-human CTLA4 monoclonal antibodies and uses thereof
US20210047409A1 (en) * 2018-02-13 2021-02-18 Merck Sharp & Dohme Corp. Methods for treating cancer with anti pd-1 antibodies and anti ctla4 antibodies

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI799432B (zh) * 2017-07-27 2023-04-21 美商再生元醫藥公司 抗ctla-4抗體及其用途

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070160619A1 (en) * 2005-12-07 2007-07-12 Nichol Geoffrey M CTLA-4 Antibody Dosage Escalation Regimens
US20150283234A1 (en) * 2012-10-23 2015-10-08 Bristol-Myers Squibb Company Combination of anti-kir and anti-ctla-4 antibodies to treat cancer
US10232040B2 (en) * 2014-05-13 2019-03-19 Medimmune, Llc Anti-B7 H1 and anti-CTLA-4 antibodies for treating non-small cell lung cancer
US10618960B2 (en) 2015-12-15 2020-04-14 Oncoimmune, Inc. Chimeric and humanized anti-human CTLA4 monoclonal antibodies and uses thereof
US20210047409A1 (en) * 2018-02-13 2021-02-18 Merck Sharp & Dohme Corp. Methods for treating cancer with anti pd-1 antibodies and anti ctla4 antibodies

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
HUNG-YEN CHOU, TIANHONG LI, KAREN KELLY, ANTHONY MARTINEZ, STACY JOO, MEI TANG, MARTIN DEVENPORT, YANG LIU AND PAN ZHENG: "471 Pharmacokinetics of first and repeated dosing of non-irAE-inducing anti-CTLA-4 monoclonal antibody ONC-392 in advanced cancer patients", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 9, no. Suppl. 2, 31 October 2021 (2021-10-31), GB , pages A500, XP009546310, ISSN: 2051-1426 *
See also references of EP4422685A4

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024238912A1 (en) * 2023-05-17 2024-11-21 OncoC4, Inc. Ph-sensitive anti-ctla-4 antibodies and uses thereof
WO2026041780A3 (en) * 2024-08-23 2026-04-02 BioNTech SE Combination therapy comprising anti-ctla4 antibodies and chemotherapy for cancer treatment

Also Published As

Publication number Publication date
MX2024004429A (es) 2024-05-06
EP4422685A1 (en) 2024-09-04
CA3234351A1 (en) 2023-05-04
EP4422685A4 (en) 2025-12-03
AU2022377644A1 (en) 2024-05-16
KR20240099187A (ko) 2024-06-28
CN118176021A (zh) 2024-06-11
JP2024540152A (ja) 2024-10-31
TW202325738A (zh) 2023-07-01

Similar Documents

Publication Publication Date Title
US20230115328A1 (en) Anti-B7-H1 and Anti-CTLA-4 Antibodies for Treating Non-Small Cell Lung Cancer
US12565528B2 (en) LAG-3 antagonist therapy for lung cancer
US20240239893A1 (en) Methods and combinations for the treatment of cancer using immune checkpoint inhibitor antibodies
EP4422685A1 (en) Anti-ctla-4 antibody dosing regimens
EP4469477A1 (en) Combination therapy for hepatocellular carcinoma
US20260092112A1 (en) Use of anti-ctla-4 antibodies for treating adenoid cystic carcinoma
JP2019517507A (ja) 特定の癌の治療のためのラムシルマブとペンブロリズマブとの組み合わせ
JP2023011902A (ja) Pd-1阻害剤を投与することにより子宮頸がんを処置する方法
WO2024137776A1 (en) Combination therapy for lung cancer
HK40106641A (zh) 抗ctla-4抗体给药方案
TW202517679A (zh) 以抗ilt2抗體治療癌症
HK40013014A (en) Anti-b7-h1 and anti-ctla-4 antibodies for treating non-small cell lung cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22888534

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3234351

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/004429

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2024525557

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280072636.X

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: AU2022377644

Country of ref document: AU

Ref document number: 18705924

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024008119

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022377644

Country of ref document: AU

Date of ref document: 20221028

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022888534

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022888534

Country of ref document: EP

Effective date: 20240529

ENP Entry into the national phase

Ref document number: 112024008119

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240425