WO2023076180A2 - Compositions and methods for therapeutic or vaccine delivery - Google Patents

Compositions and methods for therapeutic or vaccine delivery Download PDF

Info

Publication number
WO2023076180A2
WO2023076180A2 PCT/US2022/047599 US2022047599W WO2023076180A2 WO 2023076180 A2 WO2023076180 A2 WO 2023076180A2 US 2022047599 W US2022047599 W US 2022047599W WO 2023076180 A2 WO2023076180 A2 WO 2023076180A2
Authority
WO
WIPO (PCT)
Prior art keywords
retroviral vector
fragment
recombinant retroviral
polypeptide
vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/047599
Other languages
English (en)
French (fr)
Other versions
WO2023076180A3 (en
Inventor
Jacqueline FISCHER-LOUGHEED
Bradford H. STEELE
Cecilia Roh
Robert G. Johnson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genvivo Inc
Original Assignee
Genvivo Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genvivo Inc filed Critical Genvivo Inc
Priority to CA3235865A priority Critical patent/CA3235865A1/en
Priority to JP2024525024A priority patent/JP2024541940A/ja
Priority to CN202280085958.8A priority patent/CN118451188A/zh
Priority to EP22888014.2A priority patent/EP4423288A4/en
Priority to KR1020247017208A priority patent/KR20240099340A/ko
Priority to AU2022377374A priority patent/AU2022377374A1/en
Publication of WO2023076180A2 publication Critical patent/WO2023076180A2/en
Publication of WO2023076180A3 publication Critical patent/WO2023076180A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/13011Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/13011Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13041Use of virus, viral particle or viral elements as a vector
    • C12N2740/13043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/13011Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13051Methods of production or purification of viral material
    • C12N2740/13052Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/20011Coronaviridae
    • C12N2770/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • RNA-based vehicle can be complex and laborious. Additionally, RNA-based vehicles are prone to degradation and may exhibit a short half-life.
  • Other DNA-based vehicles e.g., non-viral DNA
  • DNA-based vehicles face challenges including efficiency of transporting and targeting the vehicle to target cells and induction of immune response or toxicity in the subject. Accordingly, there remains a need for a vehicle for delivering therapeutics.
  • a recombinant retroviral vector comprising a first nucleic acid sequence encoding a mutant integrase and a second nucleic acid sequence encoding at least one payload, said mutant integrase, when compared to a wild-type integrase, comprises at least one mutation in a Mg 2+ binding motif of a catalytic core domain; and said at least one payload comprises an antigen.
  • the mutant integrase is defective in retroviral integration activity.
  • the antigen comprises a pathogen polypeptide or fragment thereof or a cancer polypeptide or fragment thereof.
  • the cancer polypeptide or fragment thereof is associated with a cancer cell or a tumor microenvironment.
  • the pathogen polypeptide or fragment thereof comprises a virus polypeptide or fragment thereof.
  • the pathogen polypeptide or fragment thereof comprises a bacterium polypeptide or fragment thereof.
  • the pathogen polypeptide or fragment thereof comprises a fungus polypeptide or fragment thereof.
  • the pathogen polypeptide or fragment thereof comprises a protist polypeptide or fragment thereof.
  • the pathogen polypeptide or fragment thereof comprises a protozoa polypeptide or fragment thereof.
  • the viral polypeptide or fragment thereof comprises a coronavirus polypeptide or fragment thereof.
  • the coronavirus polypeptide or fragment thereof comprises a Severe Acute Respiratory Syndrome (SARS-CoV) polypeptide or fragment thereof, a SARS-CoV-2 polypeptide or fragment thereof, or a Middle East Respiratory Syndrome (MERS-CoV) polypeptide or fragment thereof.
  • the coronavirus polypeptide or fragment thereof comprises the SARS-CoV-2 polypeptide or fragment thereof.
  • the SARS-Cov-2 polypeptide or fragment thereof comprises a Spike protein or fragment thereof.
  • the Spike protein or fragment thereof is a full-length Spike protein.
  • the Spike protein or fragment thereof is a truncated Spike protein.
  • the truncated Spike protein comprises N-terminal domain of the Spike protein or S2 domain of the Spike protein. In some embodiments, the truncated Spike protein comprises N-terminal domain of the Spike protein and S2 domain of the Spike protein. In some embodiments, the Spike protein or fragment thereof is a recombinant Spike protein. In some embodiments, the Spike protein or fragment thereof comprises at least one modification. In some embodiments, the at least one modification comprises codon optimization. In some embodiments, the codon optimization optimizes or increases expression of the at least one payload in a human cell. In some embodiments, the at least one modification comprises at least one amino acid mutation.
  • the at least one amino acid mutation eliminates a cleavage site in the Spike protein.
  • the cleavage site is a furin cleavage site.
  • the furin cleavage site comprises amino acid residues 682-685, amino acid residues 679-682, or amino acid residue 811 in SEQ ID NO: 21 or SEQ ID NO: 22.
  • the cleavage site is a serine protease cleavage site.
  • the serine protease cleavage site comprises amino acid residues 986 and 987; or 983 and 984 in SEQ ID NO: 21 or SEQ ID NO: 22.
  • the at least one amino acid mutation comprises amino acid substitution at amino acid residue 814, 889, 896, 939, 682-685, 679-682, 811, 986, 987, 983, 984, or a combination thereof in SEQ ID NO: 21 or SEQ ID NO: 22. In some embodiments, the at least one amino acid mutation comprises amino acid substitution at amino acid residue 814, 889, 896, and 939 in SEQ ID NO: 21 or SEQ ID NO: 22. In some embodiments, the Spike protein or fragment thereof comprises a signal peptide. In some embodiments, the signal peptide is a secretory peptide.
  • the signal peptide comprises an amino acid sequence of SEQ ID NO: 13: MDAMKRGLCCVLLLCGAVFVSASQEIHARFRR.
  • the secretory peptide comprises an amino acid sequence that is at least 70% identical to IgE Fc receptor alpha.
  • the viral polypeptide or fragment thereof comprises an influenza polypeptide or fragment thereof.
  • the influenza polypeptide or fragment thereof comprises an influenza A polypeptide or fragment thereof, an influenza B polypeptide or fragment thereof, an influenza C polypeptide or fragment thereof, or an influenza D polypeptide or fragment thereof.
  • the influenza polypeptide or fragment thereof is the influenza A polypeptide or fragment thereof.
  • influenza A polypeptide or fragment thereof comprises neuraminidase (NA) or fragment thereof or hemagglutinin (HA) or fragment thereof. In some embodiments, the influenza A polypeptide or fragment thereof comprises the hemagglutinin (HA) or fragment thereof. In some embodiments, the hemagglutinin (HA) or fragment thereof is a full-length hemagglutinin (HA). In some embodiments, the hemagglutinin (HA) or fragment thereof is a truncated hemagglutinin (HA). In some embodiments, the truncated hemagglutinin (HA) comprises Stalk domain.
  • the hemagglutinin (HA) or fragment thereof is a recombinant hemagglutinin (HA).
  • the hemagglutinin (HA) or fragment thereof comprises at least one modification.
  • the at least one modification comprises codon optimization.
  • the codon optimization optimizes or increases expression of the at least one payload in a human cell.
  • the at least one modification comprises at least one amino acid mutation.
  • the at least one modification comprises the hemagglutinin (HA) or fragment thereof comprising an amino acid sequence of extracellular domain of M2 protein (M2e) of influenza A: SEQ ID NO: 14: MSLLTEVETPIRNEWGCRCNDSSD.
  • the recombinant retroviral vector encodes at least one envelope protein.
  • the at least one envelope protein comprises at least one alphavirus envelope protein.
  • the at least one alphavirus envelope protein comprises at least one Sindbis virus envelope protein.
  • the at least one Sindbis virus envelope protein comprises E3 protein, E2 protein, 6K protein, El protein, or a combination thereof.
  • the at least one Sindbis virus envelope protein comprises at least one mutation.
  • the at least one mutation increases binding affinity between the at least one Sindbis virus envelope protein and a human cell.
  • the human cell is a dendritic cell.
  • the at least one mutation is E160G of the E2 protein.
  • the recombinant retroviral vector comprises at least one modified untranslated region (UTR).
  • the at least one modified UTR comprises a 5 ’-UTR.
  • the at least one modified UTR comprises a 3 ’-UTR.
  • the at least one modified UTR comprises a 5 ’-UTR and a 3 ’-UTR.
  • a recombinant virus comprising a recombinant retroviral vector described herein.
  • the recombinant virus is a recombinant Sindbis virus.
  • the recombinant Sindbis virus comprises E160G mutation of the E2 protein.
  • a cell comprising a recombinant retroviral vector described herein or a recombinant virus of described herein.
  • the cell expresses the at least one payload.
  • the cell secretes the at least one payload.
  • the cell expresses and secretes the at least one payload.
  • the cell expresses the at least one payload for at least one day, at least three days, at least five days, or at least nine days.
  • the cell secretes the at least one payload for at least one day, at least three days, at least five days, or at least nine days.
  • the cell expresses and secretes the at least one payload for at least one day, at least three days, at least five days, or at least nine days.
  • a pharmaceutical composition comprising a recombinant retroviral vector described herein, a recombinant virus described herein, or a cell comprising a recombinant retroviral vector described herein or a recombinant virus described herein.
  • the pharmaceutical composition comprises at least one additional active ingredient.
  • the at least one additional active ingredient comprises an adjuvant.
  • the pharmaceutical composition comprises at least one pharmaceutically acceptable excipient.
  • Described herein, in some aspects, is a method of treating or preventing a disease or condition in a subject, comprising administering to the subject a recombinant retroviral vector described herein, a recombinant virus described herein, a cell comprising a recombinant retroviral vector described herein or a recombinant virus described herein, or a pharmaceutical composition described herein, wherein the at least one payload comprising the antigen induces immune response in the subject, thereby treating or preventing the disease or condition in the subject.
  • the immune response comprises induction of neutralizing antibody targeting the antigen, thereby generating immunity against the antigen in the subject.
  • the immune response comprises induction of immunoglobulin antibody targeting the antigen, thereby generating immunity against the antigen in the subject.
  • the immunoglobulin antibody comprises IgG antibody, IgM antibody, IgA antibody, IgD antibody, IgE antibody, or a combination thereof.
  • the immunoglobulin antibody comprises IgG antibody.
  • the at least one payload is expressed in the subject for at least one day, at least three days, at least five days, or at least nine days. In some embodiments, the at least one payload is secreted in the subject for at least one day, at least three days, at least five days, or at least nine days.
  • a duration of the immune response induced by the at least one payload is expressed for at least one day, at least three days, at least five days, or at least nine days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5-fold, at least 10-fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed for fewer than one day, three days, five days, or nine days.
  • a duration of the immune response induced by the at least one payload is secreted for at least one day, at least three days, at least five days, or at least nine days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5-fold, at least 10-fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed for fewer than one day, three days, five days, or nine days.
  • the immune response persists in the subject for at least three months, at least four months, at least five months, at least six months, at least 12 months, or longer
  • a recombinant retroviral vector comprising a nucleic acid construct comprising a polynucleotide sequence encoding a mutant integrase, wherein the mutant integrase, compared with a wild-type integrase, comprises a first mutation in Mg 2+ binding motif of catalytic core domain.
  • the first mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the amino acid is selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the amino acid comprises the phenylalanine (F).
  • the amino acid comprises the alanine (A).
  • the first mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain.
  • the amino acid comprises a histidine (H).
  • the first mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar side chain.
  • the amino acid comprises a serine (S).
  • the first mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C).
  • the first mutation comprises a D125A mutation.
  • the first mutation comprises a D184A mutation.
  • the first mutation comprises a E220A mutation.
  • the mutant integrase further comprises a second mutation in the Mg 2+ binding motif of the catalytic core domain.
  • the second mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the second mutation comprises an amino acid selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the second mutation comprises the phenylalanine (F).
  • the second mutation comprises the alanine (A).
  • the second mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain.
  • the second mutation comprises a histidine (H). In some embodiments, the second mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar charge side chain. In some embodiments, the second mutation comprises a serine (S). In some embodiments, the second mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C). In some embodiments, the first mutation comprises a D125A mutation and the second mutation comprises a D184A mutation. In some embodiments, the first mutation comprises a D184A mutation and the second mutation comprises a E220A mutation.
  • the first mutation comprises a D125A mutation and the second mutation comprises a E220A mutation.
  • the mutant integrase further comprises a third mutation in the Mg 2+ binding motif of the catalytic core domain.
  • the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the third mutation comprises an amino acid selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the third mutation comprises the phenylalanine (F).
  • the third mutation comprises the alanine (A). In some embodiments, the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain. In some embodiments, the third mutation comprises a histidine (H). In some embodiments, the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar charge side chain. In some embodiments, the third mutation comprises a serine (S). In some embodiments, the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C).
  • A alanine
  • the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain.
  • the third mutation comprises a histidine (H). In some embodiments, the third mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having
  • the first and second mutations each comprises changing an aspartic acid (D) to an amino acid having a hydrophobic side chain
  • the third mutation comprises changing a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the recombinant retroviral vector is murine leukemia virus (MLV), wherein the first mutation is selected from the group consisting of D125A, D184A, and E220A.
  • the mutant integrase further comprises a second mutation in the Mg 2+ binding motif of the catalytic core domain, wherein the second mutation is selected from the group consisting of D125A, D184A, and E220A.
  • the mutant integrase further comprises a third mutation in the Mg 2+ binding motif of the catalytic core domain, wherein the first mutation comprises D125A, the second mutation comprises E220A, and the third mutation comprises D184A. In some embodiments, the mutant integrase further comprises a third mutation in the Mg2+ binding motif of the catalytic core domain, wherein the first mutation comprises D125A and the second mutation comprises D184A.
  • a recombinant retroviral vector comprising a nucleic acid construct comprising a polynucleotide sequence encoding a mutant integrase, wherein the mutant integrase, compared with a wild-type integrase, consists of a single mutation in the Mg 2+ binding motif of the catalytic core domain.
  • the single mutation consists of changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the single mutation comprises an amino acid selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F). In some embodiments, the single mutation comprises the phenylalanine (F). In some embodiments, the single mutation comprises the alanine (A). In some embodiments, the single mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain. In some embodiments, the single mutation comprises a histidine (H).
  • the single mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar charge side chain.
  • the single mutation comprises a serine (S).
  • the single mutation comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C).
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 1.
  • the single mutation comprises a D125A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 2.
  • the single mutation comprises a D184A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 3
  • the single mutation comprises a E220A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 4.
  • a recombinant retroviral vector comprising a nucleic acid construct comprising a polynucleotide sequence encoding a mutant integrase, wherein the mutant integrase, compared with a wild-type integrase, consists of two mutations in the Mg 2+ binding motif of the catalytic core domain.
  • At least one of two mutations consists of changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the at least one of two mutations comprises an amino acid selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the at least one of two mutations comprises the phenylalanine (F).
  • the at least one of two mutations comprises the alanine (A).
  • At least one of two mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain.
  • the at least one of two mutations comprises a histidine (H).
  • the at least one of two mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar charge side chain.
  • the at least one of two mutations comprises a serine (S).
  • the at least one of two mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C).
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 1
  • the at least one of two mutations comprises a D125A mutation, a D184A mutation, or an E220A mutation.
  • the two mutations are comprised of a D125A mutation and an D184A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 5.
  • the two mutations are comprised of a D 125 A mutation and an E220A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 6.
  • the two mutations comprises a D184A mutation and an E220A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 7.
  • a recombinant retroviral vector comprising a nucleic acid construct comprising a polynucleotide sequence encoding a mutant integrase, wherein the mutant integrase, compared with a wild-type integrase, consists of three mutations in the Mg 2+ binding motif of the catalytic core domain.
  • at least one of three mutations consists of changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a hydrophobic side chain.
  • the at least one of three mutations comprises an amino acid selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F). In some embodiments, the at least one of three mutations comprises the phenylalanine (F). In some embodiments, the at least one of three mutations comprises the alanine (A). In some embodiments, at least one of three mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a positive charge side chain. In some embodiments, the at least one of three mutations comprises a histidine (H).
  • At least one of three mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to an amino acid having a polar charge side chain. In some embodiments, the at least one of three mutations comprises a serine (S). In some embodiments, the at least one of three mutations comprises changing an aspartic acid (D) or a glutamic acid (E) to a cysteine (C).
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 1
  • the at least one of three mutations comprises a D125A mutation, a D184A mutation, or an E220A mutation.
  • the three mutations comprises a D125A mutation, a D184A mutation, or an E220A mutation.
  • the three mutations comprises a D125A mutation, a D184A mutation, and an E220A mutation.
  • the mutant integrase comprises a peptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 8
  • the nucleic acid construct further encodes a payload.
  • the payload comprises a cytokine.
  • the cytokine comprises an interleukin-7.
  • the cytokine comprises an interleukin-12.
  • the cytokine comprises an interferon.
  • the interferon comprises IFN-a.
  • the payload comprises a thymidine kinase.
  • the thymidine kinase comprises a mutant thymidine kinase.
  • the payload comprises an antigen.
  • the antigen comprises a viral protein.
  • the viral protein comprises a SARS-CoV-2 protein.
  • the viral protein comprises an influenza protein.
  • the antigen comprises a pathogen protein.
  • Described herein, in some aspects, is a method of treating a disease or condition in a subject, comprising administering a therapeutically effective amount of a pharmaceutical composition comprising the recombinant retroviral vector described herein to the subject.
  • Described herein, in some aspects, is a method of vaccinating a subject, comprising administering a pharmaceutical composition comprising the recombinant retroviral vector described herein to the subject.
  • Fig. 1 illustrates s schematic representation of MLV integrase highlighting the triad D125, D184, and E220 forming the Mg 2+ binding motif in the catalytic core domain.
  • HH-CC motif involves in Zinc binding domain.
  • the HH-CC motif is a specific type of Zn 2+ ion chelation site found in zinc finger protein.
  • Fig. 2 illustrates sequencing results of the DI 84 A mutant.
  • Fig. 3 illustrates sequencing results of the D125A/E220A mutant.
  • Fig. 4 illustrates physical titers of vectors generated with 7 different mutants.
  • Fig. 5 illustrates vTK/GCV cell kill activities with 7 different mutants.
  • FIG. 6A illustrates early vTK expression detected by Western blotting.
  • Fig. 6B illustrates exemplary Western blot expression analysis from days 2 to 14 for DI 84 A mutant.
  • Fig. 7 illustrates relative integration qPCR with 7 different mutants at Day 2, 4, and 7.
  • Fig. 8 illustrates relative Integration qPCR with 7 different mutants at Day 10, 14, and 21.
  • Fig. 9 illustrates vTK/GCV cell kill activities of retroviral vectors produced from integrase-defective gagpol cell lines.
  • Fig. 10 illustrates vTK/GCV cell kill activity of integrase-defective vector cell lines.
  • FIG. 11 illustrates viral vector titer and vTK/GCV cell kill of integrase-defective BC6 vector clones.
  • Fig. 12A-C illustrate vTK/GCV cell kill activities of various cancer cell lines between wtGP (Fig. 12A) and integrase-defective mutants (Fig. 12B).
  • Fig. 12C illustrates relative integration of the vector by qPCR between wtGP and integrase-defective mutants.
  • Fig. 13 illustrates exemplary schematic diagrams of the recombinant retroviral vectors comprising nucleic acid sequences encoding Spike protein or fragment thereof of SARS-CoV-2.
  • Top diagram of retroviral vector encoding SARS-CoV-2 full-length Spike protein (Wuhan sequence with modifications).
  • Middle diagram of retroviral vector encoding SARS-CoV-2 Spike protein fragment of N-terminal domain (NTD) and S2 domain (Wuhan sequence with modifications).
  • Bottom diagram of retroviral vector encoding SARS-CoV-2 full-length Spike protein (Omicron BA.2 sequence with modifications).
  • Fig. 14A illustrates presence of full-length spike transgene as a payload of a retroviral vector described herein or a lentivector.
  • Fig. 14B illustrates presence of NTD and S2 transgene as a payload of a retroviral vector described herein or a lentivector.
  • Fig. 14C illustrates presence Omicron BA.2 transgene (full-length spike) as a payload of a retroviral vector described herein or a lentivector.
  • Fig. 15 illustrates presence of an E160G mutation in a Sindbis virus envelope.
  • FIG. 16A illustrates Western blotting of secreted Spike proteins from retroviral vector transduced A375 cells.
  • IDRV1 denotes retroviral vector encoding a mutant integrase (integrase with D184A mutation). Each day presents accumulated proteins.
  • FIG. 16B illustrates Western blotting of secreted S2 proteins from retroviral vector transduced A375 cells.
  • IDRV1 denotes retroviral vector encoding a mutant integrase (integrase with D184A mutation). Each day presents accumulated proteins.
  • FIG. 16C illustrates Western blotting of secreted full-length Spike proteins and S2 proteins from retroviral vector transduced A375 cells. Retroviral vector also expressed a mutant integrase (IDRV2: DI 25 A mutation and DI 84 A mutation) described herein. Each day presents accumulated proteins.
  • IDRV2 DI 25 A mutation and DI 84 A mutation
  • FIG. 17A illustrates Western blotting of intracellular full-length Spike proteins from A375 cells transduced with retroviral vector expressing the Omicron variant sequence with modifications and wild-type integrase or IDRV2 (IDRV2: D125A mutation and D184A mutation).
  • FIG. 17B illustrates Western blotting of intracellular and secreted full-length Spike proteins from A375 cells transduced with retroviral vector produced from clonal manufacturing cell lines.
  • Fig. 18A illustrates expression of Omicron Spike proteins detected by Western blotting after testing cells were transduced with retroviral vector described herein.
  • Fig. 18B illustrates expression of Omicron Spike proteins detected by immunocytochemistry (ICC) staining. Bright spots showed nuclear staining, and gray color showed the specific perinuclear and plasma membrane staining of Omicron Spike protein.
  • Fig. 18C illustrates Western blotting of both reduced and non-reduced Spike proteins detected by anti-S2 antibody in the plasma membrane fraction. The Western blot for the same samples probing for the plasma membrane marker, Cadherin, is also shown.
  • Fig. 19 illustrates a diagram of a retroviral vector comprising a nucleic acid encoding with M2e and HA4900 (HA stalk with modifications) as an universal influenza vaccine.
  • Fig. 20 illustrates presence of M2e and HA4900 (Influenza) transgene as a payload of a retroviral vector described herein or a lentivector.
  • Fig. 21 A illustrates expression of HA protein detected by Western blotting after testing cells were transduced with a retroviral vector described herein.
  • Fig. 21B illustrates expression of HA protein detected by immunocytochemistry (ICC) staining. Bright spots showed nuclear staining, and gray color showed the specific staining of HA protein.
  • ICC immunocytochemistry
  • the vector comprising at least one amino acid mutation.
  • the vector is a recombinant retroviral vector (or a retrovector) comprising the at least one amino acid mutation, where the at least one amino acid mutation is in the integrase encoded by the recombinant retroviral vector, thus creating a mutant integrase.
  • the mutant integrase comprising the at least one amino acid mutation is dysfunctional and can no longer integrate the recombinant retroviral vector into genome of the host cell.
  • the vector comprises a nucleic acid construct comprising at least one polynucleotide sequence encoding a mutant reverse transcriptase.
  • the mutant reverse transcriptase comprises at least one amino acid mutation, where the mutant reverse transcriptase can no longer convert the vector into DNA for inserting into the genome of the host cell.
  • the vector comprises a nucleic acid construct comprising at least one polynucleotide sequence encoding both the mutant integrase and the mutant reverse transcriptase.
  • the recombinant retroviral vector comprising a nucleic acid construct comprising a polynucleotide sequence encoding a mutant integrase, wherein the mutant integrase, compared with a wild-type integrase, comprises the at least one amino acid mutation in Mg 2+ binding motif of catalytic core domain of the mutant integrase.
  • Fig. 1 illustrates an exemplary vector diagram showing the location of the at least one mutation in the Mg 2+ binding motif of catalytic core domain of the integrase.
  • the mutant integrase comprises one, two, three, or more amino acid mutations in the Mg 2+ binding motif of catalytic core domain of the mutant integrase.
  • the vector comprising the mutant integrase can also encode a payload.
  • the payload comprises a therapeutic.
  • the vector described herein comprises a recombinant retroviral vector comprising the payload encoding an antigen, where the antigen can stimulate innate immunity (e.g., as a vaccine).
  • the antigen comprises a pathogen polypeptide or fragment thereof or a cancer polypeptide or fragment thereof.
  • the cancer polypeptide or fragment thereof is associated with a cancer cell or a tumor microenvironment.
  • the pathogen polypeptide or fragment thereof comprises a virus polypeptide or fragment thereof.
  • the virus polypeptide or fragment thereof comprises a coronavirus polypeptide or fragment thereof.
  • the virus polypeptide or fragment thereof comprises an influenza polypeptide or fragment thereof.
  • the pathogen polypeptide or fragment thereof comprises a bacterium polypeptide or fragment thereof. In some embodiments, the pathogen polypeptide or fragment thereof comprises a fungus polypeptide or fragment thereof. In some embodiments, the pathogen polypeptide or fragment thereof comprises a protist polypeptide or fragment thereof. In some embodiments, the pathogen polypeptide or fragment thereof comprises a protozoa polypeptide or fragment thereof.
  • the payload comprises an antigen, where the antigen can elicit immune response, thus vaccinating a subject administered with the vector.
  • described herein is a method of treating a disease or condition in a subject by administering the vector (e.g., the recombinant retroviral vector described herein) to the subject, where the vector delivers a therapeutic as payload of the vector.
  • described herein is a method of vaccinating a subject by administering the vector (e.g., the recombinant retroviral vector described herein) to the subject, where the vector delivers an antigen as payload. The antigen can then trigger innate immune response against the antigen, thus vaccinating the subject.
  • a vector such as a recombinant retroviral vector comprising a nucleic acid construct comprising at least one polynucleotide sequence encoding a mutant integrase.
  • the vector comprises a nucleic acid construct comprising at least one polynucleotide sequence encoding a mutant reverse transcriptase.
  • the vector comprises a nucleic acid construct comprising at least one polynucleotide sequence encoding both the mutant integrase and the mutant reverse transcriptase.
  • the mutant integrase compared with a wild-type integrase comprising a polypeptide sequence of SEQ ID NO: 1, comprises at least one amino acid mutation.
  • the mutant integrase comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 1.
  • Fig. 2 and Fig. 3 illustrate alignment of polypeptide sequences of exemplary mutant integrase described herein against wild-type integrase polypeptide sequence.
  • Fig. 4 illustrates that the mutant integrases described herein, while dysfunctional for integrating the vector into the host genome, did not alter viral titer.
  • Fig. 5 and Fig. 9-12 illustrate that the vector comprising the mutant integrase could deliver a payload (a thymidine kinase described herein) for killing cells in the presence of a prodrug (GCV).
  • Fig. 6 illustrates that the expression of the payload (thymidine kinase, vTK) was not altered by the mutant integrase.
  • Fig. 7 and Fig. 8 illustrate the vector comprising the mutant integrase was not integrated into the host genome for at least 21 days after the host cell was contacted with the vector.
  • the mutant integrase comprises at least one, at least two, at least three, or more amino acid mutations. In some embodiments, the mutant integrase comprises one, two, three, or more amino acid mutations. In some embodiments, the mutant integrase comprises one amino acid mutation. In some embodiments, the mutant integrase comprises two amino acid mutations. In some embodiments, the mutant integrase comprises three amino acid mutations. In some embodiments, the mutant integrase comprises at least one, at least two, at least three, or more amino acid mutations in the Mg 2+ binding motif of catalytic core domain of the mutant integrase.
  • the mutant integrase comprises one, two, three, or more amino acid mutations in the Mg 2+ binding motif of catalytic core domain of the mutant integrase. In some embodiments, the mutant integrase comprises one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase. In some embodiments, the mutant integrase comprises two amino acid mutations in the Mg 2+ binding motif of catalytic core domain of the mutant integrase. In some embodiments, the mutant integrase comprises three amino acid mutations in the Mg 2+ binding motif of catalytic core domain of the mutant integrase.
  • the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a hydrophobic side chain.
  • the amino acid having a hydrophobic side chain is selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to a phenylalanine (F). In some embodiments, the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an alanine (A).
  • the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a positive charge side chain. In some embodiments, the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a positive charge side chain, where the positive charge side chain is a histidine (H).
  • H histidine
  • the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a polar charge side chain. In some embodiments, the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a polar charge side chain, where the positive charge side chain is a serine (S).
  • S serine
  • the mutant integrase comprises at least one amino acid mutation, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to cysteine (C).
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a hydrophobic side chain.
  • the amino acid having a hydrophobic side chain is selected from the group consisting of a valine (V), an alanine (A), a leucine (L), an isoleucine (I), and a phenylalanine (F).
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to a phenylalanine (F).
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an alanine (A).
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a positive charge side chain.
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a positive charge side chain, where the positive charge side chain is a histidine (H).
  • D aspartic acid
  • E glutamic acid
  • H histidine
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a polar charge side chain.
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to an amino acid having a polar charge side chain, where the positive charge side chain is a serine (S).
  • D aspartic acid
  • E glutamic acid
  • S serine
  • the mutant integrase comprises at least one amino acid mutation in the Mg 2+ binding motif of catalytic core domain of the mutant integrase, where the at least one amino acid mutation comprises changing an aspartic acid (D) or a glutamic acid (E) of the wild-type integrase to cysteine (C).
  • the mutant integrase comprises a single mutation. In some embodiments, the mutant integrase comprises a single mutation at position 125 of the wild-type integrase. In some embodiments, the mutant integrase comprises a single mutation comprising a substitution of an aspartic acid (D) to alanine (A) at position 125, a D125A mutation, of the wild-type integrase. In some embodiments, the mutant integrase comprising a single mutation comprising a substitution of the D125A mutation comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 2.
  • the mutant integrase comprising a single mutation comprising a substitution of the D125A mutation comprises a polypeptide sequence that is SEQ ID NO: 2. [0058] In some embodiments, the mutant integrase comprises a single mutation at position 184 of the wild-type integrase. In some embodiments, the mutant integrase comprises a single mutation comprising a substitution of an aspartic acid (D) to alanine (A) at position 184, a D184A mutation, of the wild-type integrase.
  • D aspartic acid
  • A alanine
  • the mutant integrase comprising a single mutation comprising a substitution of the D184A mutation comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 3 In some embodiments, the mutant integrase comprising a single mutation comprising a substitution of the D184A mutation comprises a polypeptide sequence that is SEQ ID NO: 3.
  • the mutant integrase comprises a single mutation at position 220 of the wild-type integrase. In some embodiments, the mutant integrase comprises a single mutation comprising a substitution of a glutamic acid (E) to alanine (A) at position 220, a E220A mutation, of the wild-type integrase.
  • the mutant integrase comprising a single mutation comprising a substitution of the E220A mutation comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 4 In some embodiments, the mutant integrase comprising a single mutation comprising a substitution of the E220A mutation comprises a polypeptide sequence that is SEQ ID NO: 4.
  • the mutant integrase comprises two mutations.
  • the mutant integrase comprises two mutations, where the first mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 125, a D125A mutation, of the wild-type integrase; and the second mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 184, a DI 84 A mutation, of the wild-type integrase.
  • the mutant integrase comprising two mutations comprising a substitution of the D125A mutation and a substitution of the D184A mutations comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 5
  • the mutant integrase comprising two mutations comprising a substitution of the D125A mutation and a substitution of the D184A mutations comprises a polypeptide sequence that is SEQ ID NO: 5.
  • the mutant integrase comprises two mutations, where the first mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 125, a D125A mutation, of the wild-type integrase; and the second mutation comprises a substitution of a glutamic acid (E) to alanine (A) at position 220, a E220A mutation, of the wild-type integrase.
  • the mutant integrase comprising two mutations comprising a substitution of the D125A mutation and a substitution of the E220A mutations comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 6. In some embodiments, the mutant integrase comprising two mutations comprising a substitution of the D125A mutation and a substitution of the E220A mutations comprises a polypeptide sequence that is SEQ ID NO: 6.
  • the mutant integrase comprises two mutations, where the first mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 184, a D184A mutation, of the wild-type integrase; and the second mutation comprises a substitution of a glutamic acid (E) to alanine (A) at position 220, a E220A mutation, of the wild-type integrase.
  • the mutant integrase comprising two mutations comprising a substitution of the D184A mutation and a substitution of the E220A mutations comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 7
  • the mutant integrase comprising two mutations comprising a substitution of the D184A mutation and a substitution of the E220A mutations comprises a polypeptide sequence that is SEQ ID NO: 7.
  • the mutant integrase comprises three mutations.
  • the mutant integrase comprises three mutations, where the first mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 125, a D125A mutation, of the wild-type integrase; the second mutation comprises a substitution of an aspartic acid (D) to alanine (A) at position 184, a DI 84 A mutation, of the wild-type integrase; and the third mutation comprises a substitution of an glutamic acid (E) to alanine (A) at position 220, a E220A mutation, of the wild-type integrase.
  • the mutant integrase comprising three mutations comprises a polypeptide sequence that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or more identical to SEQ ID NO: 8. In some embodiments, the mutant integrase comprising three mutations comprises a polypeptide sequence that is SEQ ID NO: 8.
  • the vector comprising the at least one amino acid mutation renders the integrase dysfunctional.
  • the mutant integrase can no longer introduce the vector (e.g., a recombinant retroviral vector) into genome of a host cell comprising the vector.
  • the vector comprising the mutant integrase encodes at least one therapeutic or at least one antigen.
  • the at least one therapeutic comprises a cytokine.
  • cytokine comprises an interleukin or an interferon.
  • the vector encodes at least one interleukin subunit.
  • the vector encodes at least two interleukin subunits, where the at least two interleukin subunits are the same or different. In some embodiments, the vector encodes one interleukin subunit. In some embodiments, the vector encodes two interleukin subunits. In some embodiments, the vector encodes two different interleukin subunits. In some embodiments, the vector encodes two or more different interleukin subunits. In some embodiments, the vector comprises at least one start codon for expressing the interleukin, the subunit of the interleukin, or a combination thereof.
  • the vector comprises at least two start codons for expressing two interleukins, two subunits of the interleukin, or a combination thereof. In some embodiments, the vector comprises two codons each for expressing an interleukin subunit.
  • Non-limiting example of the interleukin can include IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL- 8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL- 22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-34, IL-35, IL-36, IL-37, IL-38, IL-39, IL-40, or IL-41.
  • the interleukin comprises IL- 7.
  • the interleukin comprises IL-12.
  • the vector comprising the mutant integrase encodes a therapeutic comprising an interferon.
  • the interferon comprises IFNa, IFNP, IFNy, or a combination thereof.
  • the vector comprises at least one promoter for expressing the at least one polynucleotide.
  • the vector comprises a CMV promoter for expressing the at least one polynucleotide encoding the interleukin (e.g., the P40 subunit and the P35 subunit) described herein.
  • the promoter comprises a muscle specific promoter such as HSA (human skeletal a-actin promoter), a muscle creatine kinase (MCK)-gene based promoter such as CK6 or MHCK7 promoter; a Desmin gene promoter (DES); a constitutive human promoter EF-la (Elongation Factor la).
  • HSA human skeletal a-actin promoter
  • MCK muscle creatine kinase
  • DES Desmin gene promoter
  • EF-la Elongation Factor la
  • the promoter can include the retroviral LTR; the SV40 promoter; the Rous Sarcoma Virus (RSV) promoter; the histone promoter; the polIII promoter, the P-actin promoter; inducible promoters, such as the MMTV promoter, the metallothionein promoter; heat shock promoters; adenovirus promoters; the albumin promoter; the ApoAI promoter; B19 parvovirus promoters; human globin promoters; viral thymidine kinase promoters, such as the Herpes Simplex Virus thymidine kinase promoter; retroviral LTRs; human growth hormone promoters, and the MxIFN inducible promoter.
  • RSV Rous Sarcoma Virus
  • the promoter is a tissue-specific promoter.
  • a tissue specific promoter is chosen from the group including the tyrosinase related promoters (TRP-1 and TRP-2), DF3 enhancer (for breast cells), SLPI promoter (secretory leucoprotease inhibitor- expressed in many types of carcinomas), TRS (tissue specific regulatory sequences), a- fetoprotein promoters (specific for normal hepatocytes and transformed hepatocytes, respectively), the carcino-embryonic antigen promoter (for use in transformed cells of the gastrointestinal tract, lung, breast and other tissues), the tyrosine hydroxylase promoter (for melanocytes), choline acetyl transferase or neuron specific enolase promoters for use in neuroblastomas, the regulatory sequence for glial fibroblastomas, the tyrosine hydroxylase promoter, c-erb B-2 promoter, PGK promoter, PEPCK promoter
  • the promoter is a viral-specific promoter (e.g., retroviral promoters, as well as others such as HIV promoters), hepatitis, herpes (e.g., EBV).
  • the promoter is the native HSV-TK promoter.
  • the promoter is a bacterial, fungal or parasitic (e.g., malarial)-specific promoter utilized in order to target a specific cell or tissue which is infected with a virus, bacteria, fungus or parasite.
  • the vector comprises a nucleic acid sequence for encoding a tag such as His tag or a Flag tag for purification, imaging, or expression control purpose.
  • the vector (e.g., a recombinant retroviral vector described herein) comprises at least one modified untranslated region (UTR).
  • the at least one UTR is a 5’-UTR located at 5’ end of the nucleic acid sequence of the payload.
  • the at least one UTR is a 3 ’-UTR located at 3’ end of the nucleic acid sequence of the payload.
  • the at least one UTR comprises both a 5’-UTR and a 3’- UTR located at both 5’ end and 3’ end of the nucleic acid sequence of the payload.
  • the at least one modified UTR increases expression of the payload compared to if the payload is flanked by a wild-type UTR.
  • the vector is a viral vector such as a retroviral vector.
  • Viral vectors, and especially retroviral vectors have become the most widely used method for inserting genes into mammalian, e.g., human cells.
  • Other viral vectors in some embodiments, are derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses, adeno -associated viruses, or Sindbis viruses.
  • Non-limiting examples of viral vectors can include retroviral vectors, adenoviral vectors, adeno-associated viral vectors (AAVs), pox vectors, parvoviral vectors, baculovirus vectors, measles viral vectors, or herpes simplex virus vectors (HSVs).
  • the recombinant retroviral vectors include gamma-retroviral vectors such as vectors derived from the Moloney Murine Leukemia Virus (MoMLV, MMLV, MuLV, or MLV) or the Murine Stem cell Virus (MSCV) genome.
  • the recombinant retroviral vectors also include lentiviral vectors such as those derived from the human immunodeficiency virus (HIV) genome.
  • AAV vectors include AAV1, AAV2, AAV4, AAV5, AAV6, AAV7, AAV8, or AAV9 serotype.
  • viral vector is a chimeric viral vector, comprising viral portions from two or more viruses. In additional instances, the viral vector is a recombinant viral vector.
  • the recombinant retroviral vector comprises at least one modification, where the recombinant retroviral vector can encode at least one amino acid mutation for increasing targeting efficiency of the virus to a cell type.
  • a recombinant Sindbis retroviral vector can encode an E160G mutation in E2 protein of the Sindbis virus, where the E160G mutation increases targeting of the Sindbis virus to a dendritic cell.
  • the targeting of the dendritic can increase immune response and the efficacy of vaccination by contacting the dendritic cell with an antigen encoded by the recombinant retroviral vector.
  • a recombinant retroviral vector comprising a first nucleic acid sequence encoding a mutant integrase described herein and a second nucleic acid sequence encoding at least one payload.
  • the mutant integrase when compared to a wild-type integrase, comprises at least one mutation in Mg 2+ binding motif of a catalytic core domain.
  • the at least one mutation can include a DI 25 A mutation, a DI 84 A mutation, or a combination of both DI 25 and DI 84 A mutations.
  • the at least one payload comprises an antigen.
  • the antigen induces immune response in a cell.
  • the antigen comprises a pathogen polypeptide.
  • the pathogen polypeptide includes polypeptide derived from a bacterial pathogen, an alveolate pathogen, an amoebal pathogen, a fungal pathogen, a protozoan pathogen, a nematodal pathogen, a platyhelminthes pathogen, a viral pathogen, or a combination thereof.
  • Table 1 provides a non-limiting example list for such pathogen(s) as described above, which may serve as a basis for the design of nucleotide sequences encoding pathogen-derived polypeptides for incorporation into retroviral vector(s) for transduction and eventual expression as antigenic payloads by transduced cells.
  • Table 1 Exemplary list of pathogens for obtaining the antigen comprising the pathogen polypeptide Borrelia miyamotoi Proteus myxofaciens Deltavirus carense [HDV-6] China Rattus coronavirus HKU24 Herpes simplex virus 2 Ovine rinderpest
  • the antigen comprises a viral polypeptide.
  • the viral polypeptide comprises a coronavirus polypeptide described herein.
  • the coronavirus polypeptide comprises a SARS-CoV-2 polypeptide.
  • the SARS-Cov-2 polypeptide comprises a Spike protein or fragment thereof.
  • the Spike protein or fragment thereof is a full-length Spike protein.
  • the Spike protein or fragment thereof is a truncated Spike protein.
  • the truncated Spike protein comprises N-terminal domain of the Spike protein or S2 domain of the Spike protein.
  • the truncated Spike protein comprises N- terminal domain of the Spike protein and S2 domain of the Spike protein.
  • the Spike protein or fragment thereof is a recombinant Spike protein.
  • the Spike protein or fragment thereof comprises at least one modification.
  • the at least one modification comprises at least one amino acid mutation.
  • the at least one amino acid mutation eliminates a cleavage site such as a furin cleavage or serine protease cleavage site in the Spike protein.
  • the furin cleavage site comprises amino acid residues 682-685, amino acid residues 679-682, or amino acid residue 811 in SEQ ID NO: 21 (full-length Spike protein) or SEQ ID NO: 22 (Omicron mutant Spike protein).
  • the serine protease cleavage site comprises amino acid residues 986 and 987; or 983 and 984 in SEQ ID NO: 21 (full-length Spike protein) or SEQ ID NO: 22 (Omicron mutant Spike protein).
  • the at least one amino acid mutation comprises amino acid substitution at amino acid residue 814, 889, 896, 939, 682-685, 679-682, 811, 986, 987, 983, 984, or a combination thereof in SEQ ID NO: 21 (full-length Spike protein) or SEQ ID NO: 22 (Omicron mutant Spike protein).
  • the at least one amino acid mutation comprises amino acid substitution at amino acid residue 814, 889, 896, and 939 in SEQ ID NO: 21 (full-length Spike protein) or SEQ ID NO: 22 (Omicron mutant Spike protein).
  • the Spike protein or fragment thereof comprises a signal peptide.
  • the signal peptide comprises an amino acid sequence of SEQ ID NO: 13: MDAMKRGLCCVLLLCGAVFVSASQEIHARFRR.
  • the signal peptide is a secretory peptide comprising an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to IgE Fc receptor alpha.
  • the secretory peptide is IgE Fc receptor alpha.
  • the viral polypeptide comprises an influenza polypeptide.
  • the influenza polypeptide comprises an influenza A polypeptide, an influenza B polypeptide, an influenza C polypeptide, or an influenza D polypeptide.
  • the influenza polypeptide is the influenza A polypeptide.
  • influenza A polypeptide comprises neuraminidase (NA) or fragment thereof or hemagglutinin (HA) or fragment thereof. In some embodiments, the influenza A polypeptide comprises the hemagglutinin (HA) or fragment thereof. In some embodiments, the hemagglutinin (HA) or fragment thereof is a full-length hemagglutinin (HA). In some embodiments, the hemagglutinin (HA) or fragment thereof is a truncated hemagglutinin (HA). In some embodiments, the truncated hemagglutinin (HA) comprises a Stalk domain.
  • the hemagglutinin (HA) or fragment thereof is a recombinant hemagglutinin (HA) comprising at least one modification.
  • the at least one modification comprises at least one amino acid mutation.
  • the at least one modification comprises the hemagglutinin (HA) or fragment thereof comprising an amino acid sequence of extracellular domain of M2 protein (M2e) of influenza A: SEQ ID NO: 14: MSLLTEVETPIRNEWGCRCNDSSD.
  • the recombinant retroviral vector encodes at least one envelope protein.
  • the envelope encoded by the recombinant retroviral vector is an amphotropic envelope.
  • the recombinant retroviral vector encodes the at least one envelope protein for making the amphotropic envelope.
  • the at least one envelope protein comprises at least one alphavirus envelope protein.
  • at least one Sindbis virus envelope protein where the at least one Sindbis virus envelope protein comprises E3 protein, E2 protein, 6K protein, El protein, or a combination thereof.
  • the at least one Sindbis virus envelope protein comprises at least one mutation.
  • the at least one mutation increases binding affinity between the at least one Sindbis virus envelope protein and a human cell such as a dendritic cell.
  • the at least one mutation is E160G of the E2 protein.
  • the vector encodes a targeting moiety such as an antibody for targeting a cell surface marker (e.g., an antigen expressed on the cell surface of a cell associated with the disease or condition).
  • a cell surface marker e.g., an antigen expressed on the cell surface of a cell associated with the disease or condition.
  • the cell surface marker is a tumor- associated antigen such as Her2.
  • the targeting moiety comprises an antibody, a nanobody (e.g., a single-chain variable fragment or scFv), or a combination thereof.
  • the targeting moiety is expressed on the surface of the viral envelope, where the vector described herein is encapsulated in the viral envelope.
  • the targeting moiety increases the targeting or delivering of the vector to the cell or microenvironment associated with the disease or condition such as cancer or lesion.
  • the vector encodes a non-interleukin enzyme.
  • the vector encodes an enzyme that can convert a nucleoside agent into a cytotoxic drug for killing a cell associated with the disease or condition described herein.
  • the enzyme comprises a kinase with nucleic acid nucleotide as a substrate.
  • the kinase is a thymidine kinase, where the thymidine kinase is salvage pathway enzyme which phosphorylates natural nucleoside substrates as well as nucleoside analogues.
  • viral thymidine kinase can be exploited therapeutically by administration of a nucleoside analogue such as ganciclovir or acyclovir to a cell expressing viral thymidine kinase, wherein the viral thymidine kinase phosphorylates the nucleoside analogue, creating a toxic product capable of killing the cell.
  • a nucleoside analogue such as ganciclovir or acyclovir
  • a nucleoside analogue such as ganciclovir or acyclovir
  • the viral thymidine kinase mutant is derived from Herpesviridae thymidine kinase including, for example, both primate herpes viruses, and non-primate herpes viruses such as avian herpes viruses.
  • suitable herpes viruses include, for example, Herpes Simplex Virus (HSV) Type 1, Herpes Simplex Virus Type 2, Varicella zoster Virus, marmoset herpes virus, feline herpes virus type 1, pseudorabies virus, equine herpes virus type 1, bovine herpes virus type 1, turkey herpes virus, Marek's disease virus, herpesvirus saimiri, or Epstein-Barr virus.
  • HSV Herpes Simplex Virus
  • Type 2 Herpes Simplex Virus Type 2
  • Varicella zoster Virus Marmoset herpes virus
  • feline herpes virus type 1 pseudorabies virus
  • equine herpes virus type 1 bovine her
  • the thymidine kinase described herein can be a mutant thymidine kinase, where the mutant thymidine kinase comprises at least one amino acid mutation.
  • the mutant thymidine kinase is a mutant Herpes Simplex Virus type 1 thymidine kinase (HSV1-TK) comprising at least one amino acid mutation compared to wild-type amino acid sequence of HSV1-TK: MASYPGHQHASAFDQAARSRGHSNRRTALRPRRQQEATEVRPEQKMPTLLRVYIDGPH GMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGD AAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAA RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLA
  • HSV1-TK Herpe
  • the mutant HSV1-TK comprises an amino acid sequence that is at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more sequence identity to the HSV1-TK amino acid sequence (e.g., SEQ ID NO: 11).
  • the mutant HSV-l-TK comprises a nuclear export sequence (NES).
  • the NES comprises an amino acid sequence of LQKKLEELELDG (SEQ ID NO: 12)
  • Herpes viruses may be readily obtained from commercial sources such as the American Type Culture Collection (“ATCC”, Rockville, Md.). Herpes viruses may also be isolated from naturally occurring courses (e.g., an infected animal).
  • ATCC American Type Culture Collection
  • Herpes viruses may also be isolated from naturally occurring courses (e.g., an infected animal).
  • the mutant HSV1-TK comprises at least one amino acid mutation at amino acid residue 25, 26, 32, 33, 167, 168, or a combination thereof compared to the wildtype amino acid sequence of HSV1-TK (SEQ ID NO: 11).
  • the mutation comprises substituting a wild-type amino acid with a polar, non-polar, basic or acidic amino acid.
  • the mutant HSV1-TK is mutated at amino acid residues 167, 168, or both.
  • the sequence is mutated at amino acid residue 167.
  • the sequence is mutated at amino acid residue 168.
  • the sequence is mutated at amino acid residues 167 and 168.
  • Amino acid residue 167 may be mutated to histidine, lysine, cysteine, serine, and phenylalanine.
  • Amino acid residue 168 may be mutated to histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residues 25 and/or 26. In amino acid residues 25 and/or 26 may be mutated to an amino acid chosen from the group consisting of: glycine, serine, and glutamate. In some embodiments, the mutant HSV1-TK is mutated at amino acid residues 32 and/or 33.
  • Amino acid residues 32 and/or 33 may be mutated to an amino acid chosen from the group consisting of: glycine, serine, cysteine, glutamic acid, and aspartic acid.
  • the mutant HSV1-TK is mutated at amino acid residues 25, 26, 32, and/or 33.
  • Amino acid residues 25, 26, 32, and/or 33 may be mutated to an amino acid chosen from the group consisting of: glycine, serine, cysteine, glutamic acid, and aspartic acid.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and/or 26; and 167, where the mutation at amino acid residue 25 and/or 26 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and/or 26; and 168, where the mutation at amino acid residue 25 and/or 26 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and/or 26; and 167 and/or 168, where the mutation at amino acid residue 25 and/or 26 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 and/or 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 32 and/or 33; and 167, where the mutation at amino acid residue 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 32 and/or 33; and 168, where the mutation at amino acid residue 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 32 and/or 33; and 167 and/or 168, where the mutation at amino acid residue 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 and/or 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25, 26, 32, and 33; and 167, where the mutation at amino acid residue 25, 26, 32, and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25, 26, 32, and 33; and 168, where the mutation at amino acid residue 25, 26, 32, and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25, 26, 32, and 33; and 167 and/or 168, where the mutation at amino acid residue 25, 26, 32, and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 and/or 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and 26 or 32 and 33; and 167, where the mutation at amino acid residue 25 and 26 or 32 and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and 26 or 32 and 33; and 168, where the mutation at amino acid residue 25 and 26 or 32 and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: 25 and 26 or 32 and 33; and 167 and/or 168, where the mutation at amino acid residue 25 and 26 or 32 and 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 and/or 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: any one or more of 25, 26, 32 and/or 33; and 167, where the mutation at amino acid residue any one or more of 25, 26, 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: any one or more of 25, 26, 32 and/or 33; and 168, where the mutation at amino acid residue any one or more of 25, 26, 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the mutant HSV1-TK is mutated at amino acid residue: any one or more of 25, 26, 32 and/or 33; and 167 and/or 168, where the mutation at amino acid residue any one or more of 25, 26, 32 and/or 33 comprises glycine, serine, cysteine, glutamic acid, or aspartic acid; and the mutation at amino acid residue 167 and/or 168 comprises histidine, lysine, cysteine, serine, or phenylalanine.
  • the vector in addition to encoding mutant HSV1-TK, can encode PiT-2, PiT-1, mCat-1 (murine cationic receptor- 1; target of ecotropic Moloney MLV), or other receptors used by gamma retroviruses.
  • the mutant HSV1-TK compared to wild-type HSV1-TK, comprises increased enzymatic activity of converting a nucleoside agent into a cytotoxic drug.
  • the mutant HSV1-TK increases enzymatic activity of converting a nucleoside agent into a cytotoxic drug by at least 0.1 fold, 0.2 fold, 0.3 fold, 0.4 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, or more compared to the enzymatic activity of a wild-type HSV1-TK converting the same nucleoside agent (e.g., a prodrug) into the cytotoxic drug.
  • the mutant HSV1-TK increases bystander effect of cells capable of this phenomenon for killing the cell associated with the disease or condition.
  • the “bystander effect” refers to the phenomenon by which a HSV1-TK positive cell (e.g., cell contacted with vector described herein) exerts a kill effect on neighboring HSV1-TK negative cells following induction of HSV1-TK expression in the HSV1-TK positive cells.
  • the mutant HSV1-TK increases the bystander effect by at least 0.1 fold, 0.2 fold, 0.3 fold, 0.4 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, or more compared to the bystander effect induced by a wild-type HSV1-TK positive cell.
  • a vector e.g., a recombinant viral vector
  • the mutant integrase prevents the insertion of the vector into the genome of the host cell comprising the vector.
  • the vector comprises a mutant reverse transcriptase, wherein the mutant reverse transcriptase prevents converting of the vector into DNA for insertion into the genome of the cell.
  • the vector comprises both the mutant integrase and the mutant reverse transcriptase.
  • Such vectors comprising mutant integrase and/or mutant reverse transcriptase can be particularly useful for vaccinating a subject in need thereof, where an antigen encoded by the vector can be expressed into the subject for a prolonged period of time.
  • the prolonged expression of the antigen can induce sufficient immune response against the antigen, thus vaccinating the subject against a disease or condition.
  • the expression of the antigen can be inducible, where the antigen is only expressed (thereby vaccinating the subject) when needed.
  • the expression of the antigen can be induced when the immunity against the antigen is waning, creating a booster vaccination.
  • the antigen can include a polypeptide sequence of a viral protein.
  • the antigen may be a viral protein of a coronavirus.
  • the coronavirus may be severe acute respiratory syndrome-related virus (SARS-CoV).
  • SARS-CoV severe acute respiratory syndrome-related virus
  • the SARS-CoV is SARS-CoV-2.
  • the epitope may be a viral protein selected from ORF la, ORF lab, Spike protein (S protein), 3a, 3b, envelope protein (E protein), matrix protein (M protein), p6, 7a, 7b, 8b, 9b, nucleocapsid protein (N protein), ORF14, Nspl (leader protein), Nsp2, Nsp3, Nsp4, Nsp5 (3C-like proteinase), Nsp6, Nsp7, Nsp8, Nsp9, NsplO (growth-factor-like protein), Nspl2 (RNA-dep endent RNA polymerase, or RdRp), Nspl3 (RNA 5'-triphosphatase), Nspl4 (3'-to-5' exonuclease), Nspl5 (endoRNAse), and Nspl6 (2'-O-ribose methyltransferase), a portion thereof, or combinations thereof.
  • S protein Spike protein
  • E protein
  • the antigen can include a polypeptide sequence of a viral protein of an influenza virus.
  • the influenza virus is selected from the genera consisting of Influenza virus A, Influenza virus B, Influenza virus C and Influenza virus D.
  • the influenza A virus is of the subtype H1N1, H2N2, H3N2, H5N1, H7N7, H1N2, H9N2, H7N2, H7N3, H10N7, H7N9, or H6N1.
  • the influenza virus comprises influenza B virus of the B/Yamagata/16/88-like lineage or the B/Victoria/2/87-like lineage.
  • influenza virus comprises influenza A virus of the A/California/04/2009-like lineage or the A/Brisbane/59/2007-like lineage.
  • influenza may be any strain of the influenza virus or any serotypes within a stain of influenza virus.
  • influenza virus comprises any combination viral surface glycoproteins haemagglutinin (H or HA) and neuraminidase (N or NA).
  • the antigen comprises modified influenza protein comprising hemagglutinin (HA) Stalk (conserved region) domain.
  • the HA stalk comprises at least one modification.
  • Non-limiting examples of the HA stalk modification can include head removal; glycine linker loop; intra-Cys bridge; transmembrane removal; loop fusion peptide; GCN4 position; or inter-Cys bridge.
  • the antigen comprises Extracellular domain of the M2 protein (M2e) of influenza A has an amino acid sequence of: MSLLTEVETPIRNEWGCRCNDSSD (SEQ ID NO: 14).
  • the antigen can include a polypeptide sequence of a pathogen protein such as other viral protein, bacterial protein, parasite protein, fungus protein, or a combination thereof.
  • the antigen can include a tumor antigen such as Her2, where the subject is subsequently immunized against cancer.
  • the method comprises treating a disease or condition in a subject in need thereof by administering a vector or pharmaceutical composition comprising the vector described herein to the subject.
  • the method comprises contacting a cell with the vector and subsequently administering the cell to the subject.
  • the cell contacted with the vector is an autologous cell.
  • the cell can be first isolated from the subject and optionally cultured or expanded prior to being contacted with the vector.
  • expression of the interleukin e.g., P40 or P35 of IL-12, IL-7, or interferon
  • HSV1-TK encoded by the vector can be verified in the cell prior to administering the cell to the subject.
  • the method comprises administering two or more vectors to the subject, where a first of the two or more vectors encode an interleukin (e.g., P40 or P35 of IL- 12, IL-7, or interferon) described herein and a second of the two or more vectors encode a thymidine kinase (e.g., the mutated HSV1-TK) described herein.
  • the method comprises first contacting a cell with the two or more vectors and subsequently administering the cell of the subject.
  • the interleukin e.g., P40 or P35 of IL-12, IL-7, or interferon
  • the thymidine kinase e.g., the mutated HSV1-TK
  • administration is by any suitable mode of administration, including systemic administration (e.g., intravenous, inhalation, etc.).
  • the subject is human.
  • the disease or condition is cancer or lesion. In some embodiments, the disease or condition is metabolic disease.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivers an interleukin to a cell or microenvironment associated with the disease or condition.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivering the interleukin decreases toxicity (e.g., as determined by decreased cell death of cells not associated with the disease or condition or decreased expression of hot tumor genes) in the subject compared to direct administration of interleukin to the subject.
  • the toxicity of delivering the interleukin by the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition described herein is decreased by at least 0.1 fold, 0.2 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, 50.0 fold, or more compared to toxicity induced by directly administering the interleukin to the subject.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivers an IL- 12 to a cell or microenvironment associated with the disease or condition.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivering the IL- 12 decreases toxicity (e.g., as determined by decreased cell death of cells not associated with the disease or condition or decreased expression of hot tumor genes) in the subject compared to direct administration of IL-12 to the subject.
  • the toxicity of delivering the IL-12 by the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition described herein is decreased by at least 0.1 fold, 0.2 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, 50.0 fold, or more compared to toxicity induced by directly administering the IL-12 to the subject.
  • the IL-12 encoded by the vector is expressed or secreted by the cell.
  • the IL- 12 expressed or secreted by the cell can stimulate innate immune signaling or response in the subject.
  • the method comprises stimulating the production of endogenous cytokines (e.g., IFN-y) with the expressed or secreted interleukin (e.g., P40 or P35 of IL-12) for treating the disease or condition.
  • Hot tumor gene expression can refer to expression of gene products such as the cytokines described herein that triggers endogenous immune response. As such, the expression of the hot tumor gene can lead to killing of the cell (e.g., a cancer or a tumor cell) associated with the disease or condition by the endogenous immune response.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivering the interleukin increases efficacy for treating the disease or condition (e.g., as determined by increased cell death of tumor cells or increased expression of hot tumor genes) in the subject compared to direct administration of interleukin to the subject.
  • the efficacy for treating the disease or condition by delivering the interleukin by the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition described herein is decreased by at least 0.1 fold, 0.2 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, 50.0 fold, or more compared to efficacy for treating the disease or condition by directly administering the interleukin to the subject.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition delivering the IL- 12 increases efficacy for treating the disease or condition (e.g., as determined by increased cell death of tumor cells or increased expression of hot tumor genes) in the subject compared to direct administration of IL-12 to the subject.
  • the efficacy for treating the disease or condition by delivering the IL- 12 by the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition described herein is decreased by at least 0.1 fold, 0.2 fold, 0.5 fold, 1.0 fold, 2.0 fold, 5.0 fold, 10.0 fold, 50.0 fold, or more compared to efficacy for treating the disease or condition by directly administering the IL-12 to the subject.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered at least once during a period of time (e.g., every 2 days, twice a week, once a week, every week, three times per month, two times per month, one time per month, every 2 months, every 3 months, every 4 months, every 5 months, every 6 months, every 7 months, every 8 months, every 9 months, every 10 months, every 11 months, once a year).
  • the composition is administered two or more times (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60,70, 80, 90, 100 times) during a period of time.
  • Described herein, in some aspects, is a method of treating or preventing a disease or condition in a subject by vaccinating the subject, the method comprising administering to the subject a recombinant retroviral vector described herein, a recombinant virus encoded by the retroviral vector described herein, the cell transduced by the retroviral vector described herein, or the pharmaceutical composition described herein.
  • the at least one payload encoded by the retroviral vector comprises an antigen that induces immune response in the subject, thereby treating or preventing the disease or condition in the subject by vaccinating the subject.
  • the immune response comprises induction of neutralizing antibody targeting the antigen, thereby generating immunity against the antigen in the subject. In some embodiments, the immune response comprises induction of immunoglobulin antibody targeting the antigen, thereby generating immunity against the antigen in the subject. In some embodiments, the immunoglobulin antibody comprises IgG antibody, IgM antibody, IgA antibody, IgD antibody, IgE antibody, or a combination thereof. In some embodiments, the immunoglobulin antibody comprises IgG antibody.
  • the at least one payload is expressed and secreted in the subject for at least 12 hours, at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, at least eight days, at least nine days, at least 10 days, at least 11 days, at least 12 days, or for a longer duration.
  • the at least one payload is expressed or secreted in the subject for at least 12 hours, at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, at least eight days, at least nine days, at least 10 days, at least 11 days, at least 12 days, or for a longer duration.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least 12 hours is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than 12 hours.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least one day is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than one day.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least two days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than two days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least three days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than three days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least four days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than four days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least five days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than five days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least five days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than six days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least seven days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than seven days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least eight days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than eight days.
  • a duration of the immune response induced by the at least one payload expressed or secreted for at least eight days is increased by at least 10%, at least 20%, at least 50%, at least 100%, at least 5 fold, at least 10 fold, or more compared to a duration of an immune response induced by a comparable payload that is expressed or secreted for fewer than nine days.
  • the immune response persists in the subject for at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least 12 months, at least two years, at least three years or longer.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered in a therapeutically- effective amount by various forms and routes including, for example, oral, or topical administration.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition may be administered by bronchial lavage, sublingual, intratumoral, parenteral, intravenous, subcutaneous, intramuscular, intradermal, intraperitoneal, intracerebral, subarachnoid, intraocular, intrasternal, ophthalmic, endothelial, local, intranasal, intrapulmonary, rectal, intraarterial, intrathecal, inhalation, intralesional, intradermal, epidural, intracapsular, subcapsular, intracardiac, transtracheal, subcuticular, or intraspinal administration, e.g., injection or infusion.
  • a composition may be administered by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa administration).
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is delivered via multiple administration routes.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered by intravenous infusion.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition comprising the vector is administered by slow continuous infusion over a long period, such as more than 24 hours.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition can be administered in a local manner, for example, via injection of the agent directly into an organ, optionally in a depot or sustained release formulation or implant.
  • the method comprises monitoring expression of interleukin such as IL-12 in the subject after the subject has been treated. In some aspects, the method comprises monitoring the expression level of IL-12, where, if the IL-12 expression reaches a predetermined threshold in the subject, an interleukin inhibitor can be administered to the subject.
  • interleukin such as IL-12
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition provided herein can be administered in conjunction with at least one additional therapeutic, for example, an antiviral therapy, a chemotherapy, an antibiotic, a cell therapy, a cytokine therapy, or an anti-inflammatory agent.
  • the at least one additional therapeutic comprises a nucleoside agent (e.g., a prodrug).
  • Non-limiting example of the prodrug can include FHBG (9-[4-fluoro-3- (hydroxymethyl)butyl]guanine), FHPG (9-([3 -fluoro- 1 -hydroxy -2 -propoxy]methyl)guanine), FGCV (fluoroganciclovir), FPCV (fluoropenciclovir), FIAU (l-(2'-deoxy-2'-fluoro-l-P-D- arabinofuranosyl)-5-iodouracil), FEAU (fluoro-5-ethyl-l-beta-D-arabinofuranosyluracil), FMAU (fluoro-5-methyl-l-beta-D-arabinofuranosyluracil), FHOMP (6-((l-fluoro-3- hydroxypropan-2-yloxy)methyl)-5-methylpryrimidine-2,4(lH,3H)-dione), ganciclovir, valganciclovir
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition provided herein can be administered before, during, or after occurrence of the disease or condition.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition can be used as a prophylactic and may be administered continuously to subjects.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition can be administered to a subject before the onset of the symptoms associated with the disease or condition.
  • an agent of the disclosure e.g., the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition
  • an agent of the disclosure can be varied so as to obtain an amount of the agent to achieve the desired therapeutic response for a particular subject, composition, and mode of administration, without being toxic to the subject (e.g., the subject for immunization or the subject for treatment).
  • the selected dosage level may depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic and/or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects (e.g., the subjects for immunization or the subjects for treatment); each unit contains a predetermined quantity of active agent calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • a dose may be determined by reference to a plasma concentration or a local concentration of the circular polyribonucleotide or antibody or antigen-binding fragment thereof.
  • a dose may be determined by reference to a plasma concentration or a local concentration of the linear polyribonucleotide or antibody or antigen-binding fragment thereof.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition described herein can be in a unit dosage form suitable for a single administration of a precise dosage.
  • the formulation may be divided into unit doses containing appropriate quantities of the compositions.
  • the formulation may be divided into unit doses containing appropriate quantities of one or more linear polyribonucleotides, antibodies or the antigenbinding fragments thereof, and/or therapeutic agents.
  • the unit dosage may be in the form of a package containing discrete quantities of the formulation. Non-limiting examples are packaged injectables, vials, and ampoules.
  • An aqueous suspension composition disclosed herein may be packaged in a single-dose non-reclosable container. Multiple-dose reclosable containers may be used, for example, in combination with or without a preservative.
  • a formulation for injection disclosed herein may be present in a unit dosage form, for example, in ampoules, or in multi dose containers with a preservative.
  • the dosage of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • a therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal infection or a half-maximal inhibition) as determined in cell culture. Such information can be used to determine useful doses more accurately in humans.
  • Levels in plasma may be measured, for example, by RT-qPCR or ddPCR methods.
  • an effective amount or therapeutically effective of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition disclosed herein to be administered to a subject in need of treatment may be determined in a variety of ways.
  • the amount may be based on viral titer or efficacy in an animal model.
  • the dosing regimens used in clinical trials may be used as general guidelines.
  • the daily dose may be administered in a single dose or in portions at various hours of the day.
  • a higher dosage may be required and may be reduced over time when the optimal initial response is obtained.
  • treatment may be continuous for days, weeks, or years, or may be at intervals with intervening rest periods.
  • the dosage is modified in accordance with other treatments the individual may be receiving.
  • the method of treatment is in no way limited to a particular concentration or range of the retroviral particle and may be varied for each individual being treated and for each derivative used. Individualization of dosage may be required to achieve the maximum effect for a given individual.
  • the dosage administered to an individual being treated varies depending on the individual's age, severity or stage of the disease and response to the course of treatment.
  • clinical parameters for determining dosage include, but are not limited to, tumor size, alteration in the level of tumor markers used in clinical testing for particular malignancies.
  • the treating physician determines the therapeutically effective amount to be used for a given individual.
  • the therapies disclosed herein are administered as often as necessary and for the period of time judged necessary by the treating physician.
  • multiple therapeutic courses are administered to a subject in need of treatment.
  • the first and/or second therapeutic course is administered intravenously.
  • the first and/or second therapeutic course is administered via intra-arterial infusion, including but not limited to infusion through the hepatic artery, cerebral artery, coronary artery, pulmonary artery, iliac artery, celiac trunk, gastric artery, splenic artery, renal artery, gonadal artery, subclavian artery, vertebral artery, axillary artery, brachial artery, radial artery, ulnar artery, carotid artery, femoral artery, inferior mesenteric artery and/or superior mesenteric artery.
  • Intra-arterial infusion may be accomplished using endovascular procedures, percutaneous procedures or open surgical approaches.
  • the first and second therapeutic course may be administered sequentially.
  • the first and second therapeutic course may be administered simultaneously.
  • the optional third therapeutic course may be administered sequentially or simultaneously with the first and second therapeutic courses.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition disclosed herein may be administered in conjunction with a sequential or concurrently administered therapeutic course(s) in high doses on a cumulative basis.
  • a patient in need thereof may be systemically administered, e.g., intravenously administered, with a therapeutic course on a cumulative basis.
  • a first therapeutic course may be systemically administered.
  • the first therapeutic course may be administered in a localized manner, e.g., intra-arterially, for example a patient in need thereof may be administered via intra-arterial infusion on a cumulative basis.
  • a subject in need thereof may receive a combination, either sequentially or concurrently, of systemic and intra-arterial infusions administration of high doses of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition.
  • a patient in need thereof may be first systemically administered with the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition on a cumulative basis, followed by an additional therapeutic course of intra-arterial infusion, e.g., hepatic arterial infusion, administered delivery on a cumulative basis.
  • a subject in need of treatment may also be administered, either systemically or localized (for example intra-arterial infusion, such as hepatic arterial infusion) a therapeutic course of delivering the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition for a defined period of time.
  • systemically or localized for example intra-arterial infusion, such as hepatic arterial infusion
  • the period of time may be at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least 2 months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least ten months, at least eleven months, at least one year, at least two years, at least three years, at least four years, or at least five years.
  • Administration could also take place in a chronic manner, i.e., for an undefined or indefinite period of time.
  • Administration of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition may also occur in a periodic manner, e.g., at least once a day, at least twice a day, at least three times a day, at least four times a day, at least five times a day.
  • Periodic administration of the delivery of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition may be dependent upon the time of delivery as well as the mode of administration.
  • parenteral administration may take place only once a day over an extended period of time
  • oral administration of the delivery of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition may take place more than once a day wherein administration of the delivery of the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition takes place over a shorter period of time.
  • the subject is allowed to rest 1 to 2 days between the first therapeutic course and second therapeutic course. In some embodiments, the subject is allowed to rest 2 to 4 days between the first therapeutic course and second therapeutic course. In other embodiments, the subject is allowed to rest at least 2 days between the first and second therapeutic course. In yet other embodiments, the subject is allowed to rest at least 4 days between the first and second therapeutic course. In still other embodiments, the subject is allowed to rest at least 6 days between the first and second therapeutic course. In some embodiments, the subject is allowed to rest at least 1 week between the first and second therapeutic course. In yet other embodiments, the subject is allowed to rest at least 2 weeks between the first and second therapeutic course.
  • the subject is allowed to rest at least one month between the first and second therapeutic course. In some embodiments, the subject is allowed to rest at least 1-7 days between the second therapeutic course and the optional third therapeutic course. In yet other embodiments, the subject is allowed to rest at least 1-2 weeks between the second therapeutic course and the optional third therapeutic course.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered to increase local concentration of an interleukin (e.g., P40 or P35 of IL-12) and a thymidine kinase (e.g., the mutated HSV1-TK) in the cell or the microenvironment associated with the disease or condition (e.g., cancer or lesion) described herein.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered via intra-arterial infusion, which increases local concentration of the therapeutic vector to a specific organ system.
  • the vector, the cell comprising the vector, the recombinant virus encoded by the vector, or the pharmaceutical composition is administered intratumorally.
  • catheterization of the hepatic artery is followed by infusion into the pancreaticoduodenal, right hepatic, and middle hepatic artery, respectively, in order to locally target hepatic lesions.
  • localized distribution to other organ systems, including the lung, gastrointestinal, brain, reproductive, splenic or other defined organ system, of the polypeptide or delivery vector is accomplished via catheterization or other localized delivery system.
  • intra-arterial infusions are accomplished via any other available arterial source, including but not limited to infusion through the hepatic artery, cerebral artery, coronary artery, pulmonary artery, iliac artery, celiac trunk, gastric artery, splenic artery, renal artery, gonadal artery, subclavian artery, vertebral artery, axillary artery, brachial artery, radial artery, ulnar artery, carotid artery, femoral artery, inferior mesenteric artery and/or superior mesenteric artery.
  • intra-arterial infusion is accomplished using endovascular procedures, percutaneous procedures or open surgical approaches.
  • a pharmaceutical composition comprising a therapeutic agent (e.g., the vector or the cell comprising the vector described herein) or an antigen for vaccinating a subject.
  • a therapeutic agent e.g., the vector or the cell comprising the vector described herein
  • the cell contacted with the vector described herein expresses an interleukin (e.g., P40 or P35 of IL-12), a thymidine kinase (e.g., the mutated HSV1-TK), or an antigen described herein in vivo or in vitro.
  • the cell is: obtained from a subject; expanded in an in vitro environment; and administer back to the subject for treating the disease or condition in the subject or vaccinating the subject.
  • At least one vector or cell contacted with the at least one vector described herein can be formulated into a vaccine.
  • the at least one vector described herein is formulated into an RNA vaccine.
  • the at least one vector described is formulated into a mRNA vaccine, where the antigen is encoded by mRNA as the payload of the vector.
  • the pharmaceutical composition comprises a recombinant virus encoded by a vector described herein.
  • the pharmaceutical composition can comprise a modified Sindbis virus for targeting dendritic cells.
  • the vaccine comprises at least two vectors described herein, where the at least two vectors can encode different payloads.
  • the vector comprises the mutant integrase described herein, where the vector can no longer be inserted into the genome of the cell.
  • the vector comprises the mutant reverse transcriptase, where the nucleic acid (e.g., RNA) of the vector can no longer be converted into DNA and subsequently inserted into the genome of the cell.
  • the vector comprises both the mutant integrase and the mutant reverse transcriptase.
  • the cell is obtained from a source that is not from the subject.
  • the cell is obtained from a cell line.
  • the cell is formulated into the pharmaceutical composition.
  • the pharmaceutical composition comprises a nucleoside agent described herein.
  • the pharmaceutical composition comprises a pharmaceutically acceptable: carrier, excipient, or diluent.
  • the pharmaceutical composition described herein includes at least one additional active agent other than the cell described herein.
  • the at least one additional active agent is a chemotherapeutic agent, cytotoxic agent, cytokine, growth-inhibitory agent, anti-hormonal agent, anti -angiogenic agent, or checkpoint inhibitor.
  • the pharmaceutical composition comprises an adjuvant for augmenting immune response for vaccinating the subject in need thereof.
  • the adjuvant can comprise analgesic adjuvants.
  • the adjuvant can comprise inorganic compounds such as alum, aluminum hydroxide, aluminum phosphate, or calcium phosphate hydroxide.
  • the adjuvant can comprise mineral oil or paraffin oil.
  • the adjuvant can comprise bacterial products such as inactivated Bordetella pertussis, Mycobacterium bovis, tor oxoids.
  • the adjuvant can comprise nonbacterial organics like squalene.
  • the adjuvant can comprise the use of delivery systems such as detergents (Quil A).
  • the adjuvant can comprise plant saponins such as saponin derived from Quillaja, soybean, or Polygala senega.
  • the adjuvant can comprise Freund's complete adjuvant or Freund's incomplete adjuvant.
  • the adjuvant can comprise food-based oil like peanut oil.
  • therapeutically effective amount of pharmaceutical composition described herein is administered to a mammal having a disease or condition to be treated, e.g., cancer or lesion.
  • the mammal is a human.
  • a therapeutically effective amount may vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the therapeutic agent used and other factors.
  • the therapeutic agents, and in some cases, compositions described herein may be used singly or in combination with one or more therapeutic agents as components of mixtures.
  • composition described herein may be administered to a subject by appropriate administration routes, including but not limited to bronchial lavage, sublingual, intravenous, intraarterial, oral, parenteral, buccal, topical, transdermal, rectal, intramuscular, subcutaneous, intraosseous, transmucosal, inhalation, or intraperitoneal administration routes.
  • appropriate administration routes including but not limited to bronchial lavage, sublingual, intravenous, intraarterial, oral, parenteral, buccal, topical, transdermal, rectal, intramuscular, subcutaneous, intraosseous, transmucosal, inhalation, or intraperitoneal administration routes.
  • composition described herein may include, but not limited to, aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations.
  • the pharmaceutical composition including a therapeutic agent may be manufactured in a conventional manner, such as, by way of example only, by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or compression processes.
  • the pharmaceutical composition may include at least an exogenous therapeutic agent as an active ingredient in free-acid or free-base form, or in a pharmaceutically acceptable salt form.
  • the methods and compositions described herein include the use of N-oxides (if appropriate), crystalline forms, amorphous phases, as well as active metabolites of these compounds having the same type of activity.
  • therapeutic agents exist in unsolvated form or in solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like. The solvated forms of the therapeutic agents are also considered to be disclosed herein.
  • the pharmaceutical composition provided herein includes one or more preservatives to inhibit microbial activity.
  • Suitable preservatives include mercury - containing substances such as phenylmercuric borate and thiomersal; stabilized chlorine dioxide; and quaternary ammonium compounds such as benzalkonium chloride, cetyltrimethylammonium bromide and cetylpyridinium chloride.
  • composition described herein benefits from antioxidants, metal chelating agents, thiol containing compounds and other general stabilizing agents.
  • stabilizing agents include, but are not limited to: (a) about 0.5% to about 2% w/v glycerol, (b) about 0.1% to about 1% w/v methionine, (c) about 0.1% to about 2% w/v monothioglycerol, (d) about 1 mM to about 10 mM EDTA, I about 0.01% to about 2% w/v ascorbic acid, (f) 0.003% to about 0.02% w/v polysorbate 80, (g) 0.001% to about 0.05% w/v.
  • polysorbate 20 (h) arginine, (i) heparin, (j) dextran sulfate, (k) cyclodextrins, (1) pentosan polysulfate and other heparinoids, (m) divalent cations such as magnesium and zinc; or (n) combinations thereof.
  • the pharmaceutical composition described herein can be formulated into any suitable dosage form, including but not limited to, aqueous oral dispersions, liquids, gels, syrups, elixirs, slurries, suspensions, solid oral dosage forms, aerosols, controlled release formulations, fast melt formulations, effervescent formulations, lyophilized formulations, tablets, powders, pills, dragees, capsules, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate release and controlled release formulations.
  • a therapeutic agent as discussed herein e.g., therapeutic agent is formulated into a pharmaceutical composition suitable for intramuscular, subcutaneous, or intravenous injection.
  • formulations suitable for intramuscular, subcutaneous, or intravenous injection include physiologically acceptable sterile aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, and sterile powders for rehydration into sterile injectable solutions or dispersions.
  • suitable aqueous and non-aqueous carriers, diluents, solvents, or vehicles include water, ethanol, polyols (propyleneglycol, polyethyleneglycol, glycerol, cremophor and the like), suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate.
  • Proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
  • formulations suitable for subcutaneous injection also contain additives such as preserving, wetting, emulsifying, and dispensing agents. Prevention of the growth of microorganisms may be ensured by various antibacterial and antifungal agents, such as parabens, chlorobutanol, phenol, sorbic acid, and the like. In some cases, it is desirable to include isotonic agents, such as sugars, sodium chloride, and the like.
  • Prolonged absorption of the injectable pharmaceutical form may be brought about by the use of agents delaying absorption, such as aluminum monostearate and gelatin.
  • agents delaying absorption such as aluminum monostearate and gelatin.
  • a pharmaceutical composition described herein is formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank’s solution, Ringer’s solution, or physiological saline buffer.
  • physiologically compatible buffers such as Hank’s solution, Ringer’s solution, or physiological saline buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • appropriate formulations include aqueous or nonaqueous solutions, preferably with physiologically compatible buffers or excipients.
  • Parenteral injections may involve bolus injection or continuous infusion.
  • Pharmaceutical composition for injection may be presented in unit dosage form, e.g., in ampoules or in multi dose containers, with an added preservative.
  • the pharmaceutical composition described herein may be in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient is in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • a therapeutic agent is formulated for use as an aerosol, a mist or a powder.
  • Pharmaceutical compositions described herein are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or nebulizers, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, di chlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, di chlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges of, such as, by way of example only, gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the therapeutic agent described herein and a suitable powder base such as lactose or starch.
  • a suitable powder base such as lactose or starch.
  • Formulations that include a composition are prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, fluorocarbons, and/or other solubilizing or dispersing agents known in the art.
  • these compositions and formulations are prepared with suitable nontoxic pharmaceutically acceptable ingredients.
  • suitable carriers is dependent upon the exact nature of the nasal dosage form desired, e.g., solutions, suspensions, ointments, or gels.
  • Nasal dosage forms generally contain large amounts of water in addition to the active ingredient. Minor amounts of other ingredients such as pH adjusters, emulsifiers or dispersing agents, preservatives, surfactants, gelling agents, or buffering and other stabilizing and solubilizing agents are optionally present.
  • the nasal dosage form should be isotonic with nasal secretions.
  • dosage forms include microencapsulated formulations. In some aspects, one or more other compatible materials are present in the microencapsulation material.
  • Non-limiting example of materials includes pH modifiers, erosion facilitators, anti-foaming agents, antioxidants, flavoring agents, and carrier materials such as binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, and diluents.
  • carrier materials such as binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, and diluents.
  • Liquid formulation dosage forms for oral administration are optionally aqueous suspensions selected from the group including, but not limited to, pharmaceutically acceptable aqueous oral dispersions, emulsions, solutions, elixirs, gels, and syrups.
  • the liquid dosage forms optionally include additives, such as: (a) disintegrating agents; (b) dispersing agents; (c) wetting agents; (d) at least one preservative, (e) viscosity enhancing agents, (f) at least one sweetening agent, and (g) at least one flavoring agent.
  • the aqueous dispersions further include a crystal-forming inhibitor.
  • the pharmaceutical composition described herein can be selfemulsifying drug delivery systems (SEDDS).
  • SEDDS selfemulsifying drug delivery systems
  • Emulsions are dispersions of one immiscible phase in another, usually in the form of droplets.
  • emulsions are created by vigorous mechanical dispersion.
  • SEDDS as opposed to emulsions or microemulsions, spontaneously form emulsions when added to an excess of water without any external mechanical dispersion or agitation.
  • An advantage of SEDDS is that only gentle mixing is required to distribute the droplets throughout the solution.
  • water or the aqueous phase is optionally added just prior to administration, which ensures stability of an unstable or hydrophobic active ingredient.
  • the SEDDS provides an effective delivery system for oral and parenteral delivery of hydrophobic active ingredients.
  • SEDDS provides improvements in the bioavailability of hydrophobic active ingredients.
  • buccal formulations are administered using a variety of formulations known in the art.
  • the buccal dosage forms described herein may further include a bioerodible (hydrolysable) polymeric carrier that also serves to adhere the dosage form to the buccal mucosa.
  • the compositions may take the form of tablets, lozenges, or gels formulated in a conventional manner.
  • a pharmaceutical composition is optionally formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank’s solution, Ringer’s solution, or physiological saline buffer.
  • physiologically compatible buffers such as Hank’s solution, Ringer’s solution, or physiological saline buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • appropriate formulations include aqueous or nonaqueous solutions, preferably with physiologically compatible buffers or excipients.
  • Parenteral injections optionally involve bolus injection or continuous infusion.
  • Formulations for injection are optionally presented in unit dosage form, e.g., in ampoules or in multi dose containers, with an added preservative.
  • a composition described herein is in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the compositions for parenteral administration include aqueous solutions of an agent that modulates the activity of a carotid body in water soluble form. Additionally, suspensions of an agent that modulates the activity of a carotid body are optionally prepared as appropriate, e.g., oily injection suspensions.
  • Conventional formulation techniques include, e.g., one or a combination of methods: (1) dry mixing, (2) direct compression, (3) milling, (4) dry or non-aqueous granulation, (5) wet granulation, or (6) fusion.
  • Other methods include, e.g., spray drying, pan coating, melt granulation, granulation, fluidized bed spray drying or coating (e.g., Wurster coating), tangential coating, top spraying, tableting, extruding and the like.
  • the pharmaceutical composition can be provided that include particles of a therapeutic agent and at least one dispersing agent or suspending agent for oral administration to a subject.
  • the formulations may be a powder and/or granule for suspension, and upon admixture with water, a substantially uniform suspension is obtained.
  • the pharmaceutical composition may include agent that facilitates vector binding and/or entry into a cell for either in vivo or ex vivo application.
  • Certain pharmaceutical composition can comprise poly-cationic agent, either for co-admini strati on or for pre-formulation with the vector described herein prior to administration to a patient, a subject, or to a cell derived from a patient or a subject.
  • poly-cationic agents may include, but are not limited to, polybrene, protamine sulfate, or recombinant human fibronectin.
  • the pharmaceutical composition optionally includes one or more pH adjusting agents or buffering agents, including acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids; bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane; and buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride.
  • acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids
  • bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane
  • buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride.
  • acids, bases and buffers are included in an amount required to maintain pH of the composition in an acceptable range.
  • the pharmaceutical composition optionally includes one or more salts in an amount required to bring osmolality of the pharmaceutical composition into an acceptable range.
  • salts include those having sodium, potassium or ammonium cations and chloride, citrate, ascorbate, borate, phosphate, bicarbonate, sulfate, thiosulfate or bisulfite anions; suitable salts include sodium chloride, potassium chloride, sodium thiosulfate, sodium bisulfite, and ammonium sulfate.
  • the aqueous suspensions and dispersions described herein remain in a homogenous state for at least 4 hours.
  • an aqueous suspension is resuspended into a homogenous suspension by physical agitation lasting less than 1 minute. In still another embodiment, no agitation is necessary to maintain a homogeneous aqueous dispersion.
  • An aerosol formulation for nasal administration is generally an aqueous solution designed to be administered to the nasal passages in drops or sprays. Nasal solutions may be similar to nasal secretions in that they are generally isotonic and slightly buffered to maintain a pH of about 5.5 to about 6.5, although pH values outside of this range may additionally be used. Antimicrobial agents or preservatives may also be included in the formulation.
  • An aerosol formulation for inhalations and inhalants may be designed so that the agent or combination of agents is carried into the respiratory tree of the subject when administered by the nasal or oral respiratory route.
  • Inhalation solutions may be administered, for example, by a nebulizer.
  • Inhalations or insufflations, comprising finely powdered or liquid drugs, may be delivered to the respiratory system as a pharmaceutical aerosol of a solution or suspension of the agent or combination of agents in a propellant, e.g., to aid in disbursement.
  • Propellants may be liquefied gases, including halocarbons, for example, fluorocarbons such as fluorinated chlorinated hydrocarbons, hydrochlorofluorocarbons, and hydrochlorocarbons, as well as hydrocarbons and hydrocarbon ethers.
  • Aerosol formulations may also include other components, for example, ethanol, isopropanol, propylene glycol, as well as surfactants or other components such as oils and detergents. These components may serve to stabilize the formulation and/or lubricate valve components.
  • kits for using the vector described herein can be used to treat a disease or condition in a subject.
  • the kit can be used to vaccinate a subject.
  • the kit comprises an assemblage of materials or components apart from the vector or a cell comprising the vector.
  • the kit comprises the components for assaying the number of units of a biomolecule (e.g., a therapeutic agent including the vector, the cell, IL-12, the mutant HSV1- TK, the antigen such as Spike protein or HA protein or a combination thereof) synthesized, and/or released or expressed by the cell described herein.
  • a biomolecule e.g., a therapeutic agent including the vector, the cell, IL-12, the mutant HSV1- TK, the antigen such as Spike protein or HA protein or a combination thereof
  • kits for performing assays such as enzyme-linked immunosorbent assay (ELISA), single-molecular array (Simoa), PCR, and qPCR.
  • ELISA enzyme-linked immunosorbent assay
  • Simoa single-molecular array
  • PCR PCR
  • qPCR qPCR
  • kits can be configured for the purpose of treating a disease or condition disclosed herein (e.g., cancer or lesion) in a subject.
  • the kit is configured particularly for the purpose of treating mammalian subjects.
  • the kit is configured particularly for the purpose of treating human subjects.
  • the kit is configured particularly for the purpose of vaccinating mammalian subjects.
  • the kit is configured particularly for the purpose of vaccinating human subjects.
  • kit comprises instructions for administering the vector, the cell, or the pharmaceutical composition described herein to a subject in need thereof.
  • the kit comprises instructions for further engineering the vector or cell to express a biomolecule (e.g., a therapeutic agent including the IL-12 the mutant HSV1-TK, or the antigen).
  • kit comprises instructions thawing or otherwise restoring biological activity of the cell, which may have been preserved during storage or transportation.
  • the kit comprises instructions for measure viability of the preserved cell, to ensure efficacy for its intended purpose (e.g., therapeutic efficacy if used for treating a subject).
  • the kit also contains other useful components, such as, diluents, buffers, pharmaceutically acceptable carriers, syringes, catheters, applicators, pipetting or measuring tools, bandaging materials or other useful paraphernalia.
  • useful components such as, diluents, buffers, pharmaceutically acceptable carriers, syringes, catheters, applicators, pipetting or measuring tools, bandaging materials or other useful paraphernalia.
  • the materials or components assembled in the kit may be provided to the practitioner stored in any convenient and suitable ways that preserve their operability and utility.
  • the components may be in dissolved, dehydrated, or lyophilized form; they may be provided at room, refrigerated or frozen temperatures.
  • the components are typically contained in suitable packaging material.
  • each of the expressions “at least one of A, B and C”, “at least one of A, B, or C”, “one or more of A, B, and C”, “one or more of A, B, or C” and “A, B, and/or C” means A alone, B alone, C alone, A and B together, A and C together, B and C together, or A, B and C together.
  • “or” may refer to “and”, “or,” or “and/or” and may be used both exclusively and inclusively.
  • a or B may refer to “A or B”, “A but not B”, “B but not A”, and “A and B”.
  • context may dictate a particular meaning.
  • Any systems, methods, software, and platforms described herein are modular. Accordingly, terms such as “first” and “second” do not necessarily imply priority, order of importance, or order of acts.
  • the terms “increased”, “increasing”, or “increase” are used herein to generally mean an increase by a statically significant amount.
  • the terms “increased,” or “increase,” mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 10%, at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, standard, or control.
  • Other examples of “increase” include an increase of at least 2-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 100-fold, at least 1000-fold or more as compared to a reference level.
  • “decreased”, “decreasing”, or “decrease” are used herein generally to mean a decrease by a statistically significant amount.
  • “decreased” or “decrease” means a reduction by at least 10% as compared to a reference level, for example a decrease by at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% decrease (e.g., absent level or non-detectable level as compared to a reference level), or any decrease between 10-100% as compared to a reference level.
  • a marker or symptom by these terms is meant a statistically significant decrease in such level.
  • the decrease can be, for example, at least 10%, at least 20%, at least 30%, at least 40% or more, and is preferably down to a level accepted as within the range of normal for an individual without a given disease.
  • nucleic acid refers to a polynucleotide containing at least two covalently linked nucleotide or nucleotide analog subunits.
  • a nucleic acid is generally a deoxyribonucleic acid (DNA), a ribonucleic acid (RNA), or an analog of DNA or RNA.
  • the nucleic acid is generally single-stranded, double-stranded, or a mixture thereof. For purposes herein, unless specified otherwise, the nucleic acid is double-stranded, or it is apparent from the context.
  • DNA is meant to include all types and sizes of DNA molecules including cDNA, plasmids and DNA including modified nucleotides and nucleotide analogs.
  • nucleotides include nucleoside mono-, di-, and triphosphates. Nucleotides also include modified nucleotides, such as, but are not limited to, phosphorothioate nucleotides and deazapurine nucleotides and other nucleotide analogs.
  • polynucleotide as used herein means a polymeric form of nucleotide of any length, and includes ribonucleotides and deoxyribonucleotides. Such term also includes single- and double-stranded DNA, as well as single- and double-stranded RNA. The term also includes modified polynucleotides such as methylated or capped polynucleotides.
  • the term “subject” refers to animals, plants, insects, and birds into which the large DNA molecules are introduced. Included are higher organisms, such as mammals and birds, including humans, primates, rodents, cattle, pigs, rabbits, goats, sheep, mice, rats, guinea pigs, cats, dogs, horses, chicken and others. Subject may or may not have a disease or condition.
  • administering to a subject is a procedure by which one or more delivery agents and/or large nucleic acid molecules, together or separately, are introduced into or applied onto a subject such that target cells which are present in the subject are eventually contacted with the agent and/or the large nucleic acid molecules.
  • delivery vector or “delivery vehicle” or “therapeutic vector” or “therapeutic system” refers to both viral and non-viral particles that harbor and transport exogenous nucleic acid molecules to a target cell or tissue.
  • Viral vehicles include, but are not limited to, retroviruses, adenoviruses, lentiviruses, herpes viruses and adeno -associated viruses.
  • Non-viral vehicles include, but are not limited to, microparticles, nanoparticles, virosomes and liposomes.
  • “Targeted,” as used herein, refers to the use of ligands that are associated with the delivery vehicle and target the vehicle to a cell or tissue.
  • Ligands include, but are not limited to, antibodies, receptors and collagen-binding domains.
  • delivery which is used interchangeably with “transduction,” refers to the process by which exogenous nucleic acid molecules are transferred into a cell such that they are located inside the cell. Delivery of nucleic acids is a distinct process from expression of nucleic acids.
  • expression refers to the process by which nucleic acid is translated into polypeptide or is transcribed into RNA, which, for example, can be translated into polypeptide or protein. If the nucleic acid is derived from genomic DNA, expression includes, if an appropriate eukaryotic host cell or organism is selected, splicing of the mRNA. For heterologous nucleic acid to be expressed in a host cell, it must initially be delivered into the cell and then, once in the cell, ultimately reside in the nucleus. In some aspects, the expression occurs independent of gene integration.
  • a “therapeutic course” refers to the periodic or timed administration of the vectors disclosed herein within a defined period of time. Such a period of time is at least one day, at least two days, at least three days, at least five days, at least one week, at least two weeks, at least three weeks, at least one month, at least two months, or at least six months. Administration could also take place in a chronic manner, i.e., for an undefined period of time.
  • the periodic or timed administration includes once a day, twice a day, three times a day or other set timed administration.
  • the terms “co-administration,” “administered in combination with” and their grammatical equivalents or the like are meant to encompass administration of the selected therapeutic agents to a single patient, and are intended to include treatment regimens in which the agents are administered by the same or different route of administration or at the same or different times.
  • a therapeutic agent as disclosed in the present application will be co-administered with other agents.
  • These terms encompass administration of two or more agents to an animal so that both agents and/or their metabolites are present in the animal at the same time. They include simultaneous administration in separate compositions, administration at different times in separate compositions, and/or administration in a composition in which both agents are present.
  • a therapeutic agent and the other agent(s) are administered in a single composition.
  • a therapeutic agent and the other agent(s) are admixed in the composition.
  • a therapeutic agent and the other agent(s) are administered at separate times in separate doses.
  • mutant thymidine kinase refers to not only the specific protein described herein (as well as the nucleic acid sequences which encode these proteins), but derivatives thereof which may include various structural forms of the primary protein which retain biological activity.
  • mutated or “replaced by another nucleotide” means a nucleotide at a certain position is replaced at that position by a nucleotide other than that which occurs in the unmutated or previously mutated sequence. That is, in some instances, specific modifications may be made in different nucleotides. In some embodiments, the replacements are made such that the relevant splice donor and/or acceptor sites are no longer present in a gene.
  • a “polar amino acid” refers to amino acid residues Asn (N), Cys (C), Gin (Q), Gly (G), Ser (S), Thr (T) or Tyr (Y).
  • non-polar amino acid refers to amino acid residues Ala (A), He (I), Leu (L), Met (M), Phe (F), Pro (P), Trp (W), or Vai (V).
  • a “basic amino acid” refers to amino acid residues Arg (R), His (H), or Lys (K).
  • an “acidic amino acid” refers to amino acid residues Asp (D) or Glu (E).
  • An “adjuvant” as described herein refers to a substance that in combination with an antigen promotes an adaptive immune response to the antigen.
  • An “immune stimulatory compound” refers to a substance that specifically interacts with the innate immune system to initiate a "danger signal” that ultimately leads to the development of the adaptive components of the immune response (e.g., B cell, T cells).
  • Immune stimulatory compounds include pathogen- associated molecular patterns (PAMPs) such as dsRNA, lipopolysaccharide, and CpG DNA, either naturally occurring or synthetic.
  • Immune stimulatory compounds are agonists of various innate immune receptors including Toll-like receptors (TLRs), NOD-like receptors, RIG-1 or MDA-5 receptors, C-type lectin receptors, or the STING pathway.
  • RT reverse transcriptase
  • Integrase is the key enzyme that carries the viral DNA and catalyzes its integration into the host genome.
  • the integrase is part of the gagpol gene which is translated into a polyprotein sequence that gets processed by the viral protease to yield 7 proteins.
  • the integrase (INT) is a 408 aa protein at the C-Terminal of Gag- Pol (Table 2).
  • Fig. 1 illustrates the D, D, and E amino acid triad that forms the Mg2+ binding motif that is critical to integrase function.
  • RT reverse transcriptase
  • aPBS artificial Primer Binding site
  • Table 4 illustrates polypeptide sequences of integrase fragment spanning amino acid position 106 to amino acid position of 287 of wild-type integrase (SEQ ID NO: 1) and the seven mutant integrases (SEQ ID NO: 2-8). The last two bases of the codon were changed, from GAT to GCC (point mutations at & near base 4541 of the gagpol gene). Single point mutations were used in the mutations DI 84 A and E220A, converting GAC to GCC and GAG to GCG, respectively.
  • Viral supernatants were produced with each integrase-defective vector (using triple transfection of 293T cells with envelope plasmid and a payload/reporter plasmid) and properties were compared to particles made with wtGP vector. Similar titers were obtained (Fig. 4), demonstrating that integrase mutations do not interfere with other functions of Gag-pol needed to generate viral particles.
  • Routine target cell line A375 (human melanoma) were transduced with the viral vector supernatants. Expression of payloads were analyzed visually (GFP payload), by FACS (for vTK), or payload activity (Luciferase reporter gene in payload) or vTK activity (GCV-induced cell kill assay). The results demonstrated that the mutation did not interfere with viral envelope production. Level of payload protein expression demonstrated that integrase mutations did not interfere with payload level of expression (examined by cell kill, reflecting payload vTK expression and activity; as well as by Western blotting for vTK protein; Fig. 5 and Fig. 6).
  • gagpol sequence with the integrase mutation selected were cloned into gagpol vector constructs and sequenced.
  • the envelope expressing 293 T packaging cell line was transformed with the integrase-defective gagpol retroviral vectors and tested.
  • the integrase-defective packaging lines were compared with wtGP by transfecting all three packaging cell lines with a vector described herein. Titers obtained were in similar range (Table 5).
  • the viral vector supernatants were used to transduce routine target cell line A375 with 2e7 vector genomes/mL in order to follow vTK expression and observe non-integration from the integrase-defective particles.
  • the expression of vTK is reflected by cell kill assays in which cells were exposed to GCV at given time post transduction. At Day 3 post transduction, the cell kill percentages were 79%, 59% and 69% for wtGP, mutGP-D184A and mutGP- D125A/D184A, respectively. At Day 7, there is approximately 80% less cell kill activities in cells transduced with the integrase-defective particles which reached nearly zero by Day 23.
  • Envelope and integrase-defective gagpol expressing 293T packaging cell line was transformed with the payload vectors described herein to generate the integrase-defective vector manufacturing cell line(s), followed by single cell cloning, as the payload sequence bears no drug selection marker.
  • clone BC6 was selected for second round of cloning. Second clones BC6-C3 and BC6-E12 were selected out of 18 tested (Fig. 11) based on titer and cell kill level of transduced A375 cells. The clone BC6-C3 was expanded and adapted to suspension.
  • Integrase-defective DI 84 A Vector line with murine GMCSF
  • Integrase-defective vectors elicit expression of payload in various cancer cell lines tested [00190] A range of cancer cell lines were tested with integrase-defective vectors. When the cells were successfully transduced with the integrase-defective retroviral vector, the expression of payload disappeared between D7-D14 for most lines tested, as demonstrated by WB, GCV-Cell kill assays, and Relative Integration qPCR.
  • Fig. 12A-C illustrate vTK/GCV cell kill activities of various cancer cell lines, from wtGP vector (Fig. 12A) and integrase-defective mutant vector (Fig. 12B).
  • Fig. 12C illustrates relative integration of the vector payload by qPCR in cells treated with wtGP vector and integrase-defective mutant vector.
  • the integrase-defective retroviral vector can be generated with the integrasedefective Gagpol and any payload gene of interest.
  • Such transient protein expression of the IDRV system provides a potential vaccine use.
  • Three SARS-CoV-2 vaccine payloads were designed and generated. Testing was performed with transient transfection of three plasmids: vaccine payload, IDRV1 (D184A), or IDRV2 (D125A/D184A) Gagpol, and amphotropic envelope or a modified Sindbis Envelope which was targeted to antigen presenting dendritic cells.
  • FIG. 13 illustrates exemplary schematic diagrams of the recombinant retroviral vectors comprising nucleic acid sequences encoding Spike protein or fragment thereof of SARS-CoV-2.
  • Top diagram of retroviral vector encoding SARS-CoV-2 full-length Spike protein (Wuhan sequence with modifications).
  • Middle diagram of retroviral vector encoding SARS-CoV-2 Spike protein fragment of N-terminal domain (NTD) and S2 domain (Wuhan sequence with modifications).
  • Bottom diagram of retroviral vector encoding SARS-CoV-2 full-length Spike protein (Omicron BA.2 sequence with modifications).
  • the first vaccine was a retroviral vector comprising a nucleic acid sequence encoding full-length Spike protein based on Wuhan strain with modifications.
  • the nucleic acid sequence was codon optimized for expression in a human cell.
  • the secretory leader sequence (IgEpsylon Fc Receptor alpha) was added at the N-terminus.
  • the furin cleavage site at residue 682 to 685 was modified from RRAR to SRAG which could stabilize the Spike protein.
  • the serine protease cleavage site was modified to proline at residue 986 and 987, which stabilized the Spike structure’s prefusion shape.
  • the second vaccine was a retroviral vector comprising a nucleic acid sequence encoding N-terminal domain and S2 protein based on SARS-CoV-2 Wuhan strain with modifications.
  • the nucleic acid sequence was codon optimized for expression in a human cell.
  • the secretory leader sequence (IgEpsylon Fc Receptor alpha) was added at the N-terminus of the S2.
  • Furin cleavage site at residue 682 to 685 was modified from RRAR to SRAG to stabilize the spike peptide.
  • Serine protease cleavage site was modified to proline at residue K986 and V987 to stabilize the structure’s prefusion shape.
  • the third vaccine was a retroviral vector comprising a nucleic acid sequence encoding Spike protein of the Omicron BA.2 strain with modifications.
  • the nucleic acid sequence was codon optimized for human.
  • Furin cleavage site at residue 679 to 682 was modified from RRAR to SRAG to stabilize the Spike peptide. Additional furin cleavage site was removed at K811 A.
  • Serine protease cleavage site was modified to proline at residue K983 and V984 to stabilize Spike structure’s prefusion shape. Additional four more residues were modified to proline at residue F814, A889, A896, and A939.
  • the signal peptide was added to the N-terminus, where the signal peptide was a propeptide of tissue Plasminogen Activator (SEQ ID NO: 13: MDAMKRGLCCVLLLCGAVFVSASQEIHARFRR).
  • the vaccine composition can be packaged and expressed by Sindbis virus.
  • Sindbis virus can be a modified Sindbis virus.
  • Sindbis envelope In one of the alphavirus species, Sindbis virus (SB), the envelope gene encodes four components E3, E2, 6K, and El (from N-terminal to C-terminal). They are proteolytically separated and form a homotrimer.
  • SB envelope A unique characteristic of SB envelope is that these four subunits have their own functions. E3 is dissociated upon the maturation of E2 domain; E2 domain serves as a binding molecule; and fusion is regulated by El whereas the function of 6K is unclear.
  • Binding and fusion of the virus particle are in two separate actions which made modifications of E2 possible without affecting the El structure and function.
  • the residue 160 at E2 was mutated to target to human dendritic cells by pseudotyping a retroviral vector comprising a payload described herein.
  • Modified Sindbis envelop comprising the E160G mutation was confirmed by Sanger sequencing at Laragen (Culver City, CA).
  • E160G mutation would target the recombinant retroviral vector to antigen presenting cells (e.g., a dendritic cell) at the injection site (Fig. 15).
  • All transgenes were designed as described above and synthesized at Genscript (Piscataway, NJ). Sequences were confirmed by Sanger sequencing at Genscript.
  • the plasmids expressing transgenes were digested with appropriate restriction enzymes and inserted into a payload retroviral vector and lentivector described herein (e.g., Figs. 14A-14C). All final plasmids were sequenced at Primordium Labs (Arcadia, CA).
  • Retroviral vector was generated by calcium/phosphate transient transfection methods with wild-type gagpol or IDRV1 (D184A) gagpol with amphotropic envelope and the full-length spike payload or NTD-S2 payload.
  • A375 cells were transduced with retroviral vector, at 1E+08 vector genomes/mL, and their culture supernatants were examined by Western blotting.
  • the results (Fig. 16A and Fig. 16B) demonstrated stable expression of secreted Spike proteins with IDRV1 although levels of expression were lower than with wild-type gagpol. Similar results were shown with the NTD-S2 payload.
  • IDRV2 D125AD184A gagpol
  • Retroviral vectors were also generated by transient transfection methods with the Omicron mutant of Spike protein, and wild-type gagpol or IDRV2 gagpol. Intracellular Spike proteins from retroviral vector transduced A375 cells were examined by Western blotting and the results demonstrated the high level of full-length Spike protein expression as shown in Fig. 17A.
  • the full-length Spike payload lentivector was used to generate the manufacturing cell line with fully codon optimized amphotropic envelope and wild-type gagpol, and the cell line was cloned.
  • Table 8 shows the physical titer of the cell line clones, which was measured by RT- qPCR (reverse-transcriptase quantitative PCR) for the Psi sequence in extracted vector RNA. The results demonstrated acceptable titer of the manufacturing cell line at 9.6E+07 vector genomes/mL.
  • Retroviral vector (RV) titer vector genomes/mL) of the manufacturing cell line
  • the recombinant retroviral vector produced from the cell line clones were tested on A375 melanoma cells. After transduction, cells and supernatants were examined by Western blotting for expression of Spike protein, S2 region. The results proved that full-length Spike proteins were generated in transduced cells and secreted out of the cell as shown in Fig 17B.
  • Recombinant retroviral vector with a payload encoding the Omicron mutant Spike protein was obtained by transiently co-transfecting 293 T with wtGP and amphotropic envelope. The titer was 4.81E+07 vector genomes/mL, as determined by RT-qPCR.
  • Omicron retroviral vector transduced A375 cells were fractionated by simple centrifugation methods, and the plasma membrane fraction and nonmembrane soluble proteins were subjected to Western blotting (Fig. 18C). Spike proteins were distinctively present in the plasma membrane fraction along with the plasma membrane marker, Cadherin.
  • Sindbis E160G expressing retroviral vector may be examined with dendrite cells (Fig. 15).
  • the payloads of vaccine of interest can be generated as retroviral vectors in a large scale, such as in CS10 flasks, and then be column-purified. Two types of animal studies can be conducted.
  • the purified retroviral vector can be examined in regular BALB/c and C57BL/6J mice by 4 different routes (intramuscular, sublingual, intranasal, and intradermal) for antibody generation. Both IgM and IgG generation can be tested.
  • the purified retroviral vector can be examined in animals challenged with the real viruses.
  • animals challenged with the real viruses For example, hamsters which normally express ACE receptors can be challenged with COVID viruses and treated with the Omicron mutant retroviral vectors.
  • transgenes were designed as described above and synthesized at Genscript. The sequences were confirmed by Sanger sequencing at Genscript. The plasmids expressing transgenes were digested with appropriate restriction enzymes and inserted into payload retroviral vector described herein (e.g., Figs. 14A-14C). All final plasmids were sequenced at Primordium Labs (Arcadia, CA). Payload, wild-type gagpol or IDRV, and envelope were transiently transfected into 293T cells.
  • a packaging 293T cell line platform expressing full- length amphotropic envelope with modifications and fully cloned (clone G8) and stably expressing wild-type gagpol was used to generate the full-length Spike manufacturing cell line.
  • the cell line was further singly cloned.
  • A375 cells were transduced with retroviral vector at appropriate dilutions with 8 pg/mL polybrene for 3 days. The samples were run on 4-20% TGX (Bio-Rad) gel at 135V for 75 minutes.
  • Fig. 19 illustrates a retroviral vector describe herein comprising a payload for encoding M2e with Hemagglutinin (HA) Stalk (conserved region) domain with modifications.
  • the nucleic acid sequence was codon optimized for human.
  • Extracellular domain of the M2 protein (M2e) of influenza A has an amino acid sequence of MSLLTEVETPIRNEWGCRCNDSSD (SEQ ID NO: 14). Additional HA stalk with modifications included: head removal; glycine linker loop; intra-Cys bridge; transmembrane removal; loop fusion peptide; GCN4 position; and inter-Cys bridge.
  • Fig. 20 illustrates presence of M2e and HA4900 (influenza) transgene as a payload of a retroviral vector described herein or a lentivector.
  • the recombinant retroviral vector with a payload encoding M2e and HA4900 was produced by 293 T transiently co-transfected with wtGP and amphotropic envelope, and vector titer was measured by RT-qPCR.
  • the influenza antigen encoding retroviral vector exhibited 1.56E+08 vector genomes/mL.
  • Influenza antigen vector particle titer measured by RT-qPCR produced from manufacturing clonal cell lines was measured in two exemplary clones to 1.94E+08 vector genomes/mL and 1.74E+07 vector genomes/mL. The manufacturing cell lines expressed IDRV2 and amphotropic envelope.
  • HA protein Hemagglutinin
  • Fig. 21A Western Blotting
  • Fig. 21B Immunocytochemistry staining for the HA protein demonstrated expression of HA protein and localization in the perinuclear region of testing cells

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Immunology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Pulmonology (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
PCT/US2022/047599 2021-10-25 2022-10-24 Compositions and methods for therapeutic or vaccine delivery Ceased WO2023076180A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
CA3235865A CA3235865A1 (en) 2021-10-25 2022-10-24 Compositions and methods for therapeutic or vaccine delivery
JP2024525024A JP2024541940A (ja) 2021-10-25 2022-10-24 治療剤またはワクチン送達のための組成物および方法
CN202280085958.8A CN118451188A (zh) 2021-10-25 2022-10-24 用于治疗剂或疫苗递送的组合物及方法
EP22888014.2A EP4423288A4 (en) 2021-10-25 2022-10-24 COMPOSITIONS AND METHODS OF THERAPEUTIC OR VACCINAL ADMINISTRATION
KR1020247017208A KR20240099340A (ko) 2021-10-25 2022-10-24 치료제 또는 백신 전달을 위한 조성물 및 방법
AU2022377374A AU2022377374A1 (en) 2021-10-25 2022-10-24 Compositions and methods for therapeutic or vaccine delivery

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163271675P 2021-10-25 2021-10-25
US63/271,675 2021-10-25
US202263413188P 2022-10-04 2022-10-04
US63/413,188 2022-10-04

Publications (2)

Publication Number Publication Date
WO2023076180A2 true WO2023076180A2 (en) 2023-05-04
WO2023076180A3 WO2023076180A3 (en) 2023-08-17

Family

ID=86158440

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/047599 Ceased WO2023076180A2 (en) 2021-10-25 2022-10-24 Compositions and methods for therapeutic or vaccine delivery

Country Status (8)

Country Link
US (3) US11992524B2 (https=)
EP (1) EP4423288A4 (https=)
JP (1) JP2024541940A (https=)
KR (1) KR20240099340A (https=)
AU (1) AU2022377374A1 (https=)
CA (1) CA3235865A1 (https=)
TW (1) TW202334435A (https=)
WO (1) WO2023076180A2 (https=)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11992524B2 (en) 2021-10-25 2024-05-28 Genvivo, Inc. Compositions and methods for therapeutic or vaccine delivery

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116334009B (zh) * 2023-03-21 2026-04-24 广西大学 表达乙型脑炎病毒e蛋白的重组盖他病毒及其构建方法和疫苗应用
WO2025106748A1 (en) * 2023-11-15 2025-05-22 Genvivo, Inc. Compositions and methods for therapeutic delivery

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2452517A1 (en) * 2001-07-11 2003-01-23 University Of Miami Recombinant vsv for the treatment of tumor cells
EP2055316A1 (en) 2003-09-09 2009-05-06 VIRxSYS Corporation Lentivirus vector-based approaches for generating an immune response to HIV in humans
WO2006031996A2 (en) * 2004-09-14 2006-03-23 University Of Pittsburgh Of The Commonwealth System Of Higher Education Targeting viruses using a modified sindbis glycoprotein
US8329162B2 (en) * 2006-07-21 2012-12-11 California Institute Of Technology Targeted gene delivery for dendritic cell vaccination
RU2012140691A (ru) * 2009-03-13 2014-03-27 Лентиген Корпорейшен Вакцины на основе неинтегрирующегося ретровирусного вектора
RS53257B2 (sr) * 2009-07-24 2018-06-29 Immune Design Corp Lentiviralni vektori pseudotipizirani sa omotačem od glikobelančevine iz sindbis-virusa
WO2015040063A1 (en) * 2013-09-17 2015-03-26 Inserm (Institut National De La Sante Et De La Recherche Medicale) Lentiviral vectors having a mutated integrase protein and uses thereof
EP2878674A1 (en) 2013-11-28 2015-06-03 Fundación Centro Nacional de Investigaciones Cardiovasculares Carlos III (CNIC) Stable episomes based on non-integrative lentiviral vectors
WO2021062419A1 (en) * 2019-09-29 2021-04-01 Burke John Douglas Novel vectors and uses thereof
US11992542B2 (en) 2019-12-13 2024-05-28 Kristina Kitsos Device and system for providing customized skin color matching sunscreen
KR20240099340A (ko) 2021-10-25 2024-06-28 젠비보, 인크. 치료제 또는 백신 전달을 위한 조성물 및 방법

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11992524B2 (en) 2021-10-25 2024-05-28 Genvivo, Inc. Compositions and methods for therapeutic or vaccine delivery
US12350327B2 (en) 2021-10-25 2025-07-08 Genvivo, Inc. Compositions and methods for therapeutic or vaccine delivery

Also Published As

Publication number Publication date
CA3235865A1 (en) 2023-05-04
US20230277647A1 (en) 2023-09-07
TW202334435A (zh) 2023-09-01
JP2024541940A (ja) 2024-11-13
AU2022377374A1 (en) 2024-05-02
US11992524B2 (en) 2024-05-28
EP4423288A2 (en) 2024-09-04
US20250345409A1 (en) 2025-11-13
EP4423288A4 (en) 2025-09-10
WO2023076180A3 (en) 2023-08-17
US20240366746A1 (en) 2024-11-07
KR20240099340A (ko) 2024-06-28
US12350327B2 (en) 2025-07-08

Similar Documents

Publication Publication Date Title
US20220401581A1 (en) Thymidine kinase gene
US20250345409A1 (en) Compositions and methods for therapeutic or vaccine delivery
US20250115930A1 (en) Compositions and methods for therapeutic delivery
CN118451188A (zh) 用于治疗剂或疫苗递送的组合物及方法
WO2024226784A2 (en) Compositions and methods for therapeutic or vaccine delivery
WO2002083840A2 (en) Compositions and methods for transepithelial transport of membrane-bounded vesicles and virions
CN118556129A (zh) 用于治疗剂递送的组合物和方法
EP4736848A1 (en) Pharmaceutical composition containing cationic lipid and use thereof
CN121219021A (zh) 合成启动子
CN117377464A (zh) 用于递送核酸的组合物和方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22888014

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: AU2022377374

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 3235865

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2024525024

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022377374

Country of ref document: AU

Date of ref document: 20221024

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022888014

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022888014

Country of ref document: EP

Effective date: 20240527

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22888014

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 202280085958.8

Country of ref document: CN