WO2023069967A2 - Compositions useful in treatment of cdkl5 deficiency disorder (cdd) - Google Patents
Compositions useful in treatment of cdkl5 deficiency disorder (cdd) Download PDFInfo
- Publication number
- WO2023069967A2 WO2023069967A2 PCT/US2022/078327 US2022078327W WO2023069967A2 WO 2023069967 A2 WO2023069967 A2 WO 2023069967A2 US 2022078327 W US2022078327 W US 2022078327W WO 2023069967 A2 WO2023069967 A2 WO 2023069967A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cdkl5
- aav
- mice
- seq
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
- C12N15/864—Parvoviral vectors, e.g. parvovirus, densovirus
- C12N15/8645—Adeno-associated virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
- A61K48/0066—Manipulation of the nucleic acid to modify its expression pattern, e.g. enhance its duration of expression, achieved by the presence of particular introns in the delivered nucleic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0083—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the administration regime
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/52—Genes encoding for enzymes or proenzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/11022—Cyclin-dependent kinase (2.7.11.22)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/60—Vectors containing traps for, e.g. exons, promoters
Definitions
- CDKL5 Deficiency Disorder is a serious neurodevelopmental disorder affecting young children.
- the underlying cause is lack of CDKL5 protein expression due to mutations in the X-linked Cyclin- Dependent Kinase-Like 5 gene, CDKL5 (Mendelian Inheritance in Man, MIM: 300203; previously known as STK9), resulting in a range of phenotypes, including EIEE2 (MIM: 300672), a form of early infantile epileptic encephalopathy [Bahi-Buisson, N. et al. Key clinical features to identify girls with CDKL5 mutations.
- the phenotype may also include a number of other features, such as stereotypic hand movements, severe psychomotor retardation and general hypotonia.
- the early postnatal onset of symptoms indicates that CDKL5 plays a crucial role in brain development.
- CDKL5 is also expressed within the mature adult nervous system. CDKL5 is expressed throughout the cell, including the nucleus and the cytoplasm of the cell soma and dendrites.
- CDKL5 gene mutations are the cause of most cases of CDD, a progressive neurologic developmental disorder and one of the most common causes of cognitive disability in females. Males who have the genetic mutation that causes CDD are affected in devastating ways. Most of them die before birth or in early infancy. See, e.g., ninds.nih.gov/Disorders/Patient-Caregiver-Education/Fact-Sheets/Rett-Syndrome-Fact-Sheet and omim.org/entry/312750.
- a recombinant adeno-associated virus which is useful for treating CDKL5 Deficiency Disorder (CDD) in a subject in need thereof.
- the rAAV carries a vector genome comprising inverted terminal repeats (ITR) and a novel nucleic acid sequence encoding a functional human CDKL5 protein under the control of regulatory sequences which direct the hCDKL5 expression in a target cell.
- ITR inverted terminal repeats
- a recombinant adeno-associated virus useful for treating CDD.
- the rAAV comprises: (a) an AAVhu68 or AAVrh91 capsid; and(b) a vector genome in the AAV capsid of (a), wherein the vector genome comprises a 5 ’ AAV inverted terminal repeat (ITR), an expression cassette comprising a human CDKL5 sequence of nucleotides 1 to 2883 of SEQ ID NO: 22 operably linked to regulatory sequences which direct expression thereof and which further comprise four tandem miR183 targeting sequences, and a 3’ AAV ITR.
- the regulatory sequences further comprise a UbC promoter or a hSyn promoter.
- the UbC promoter has the sequence of SEQ ID NO: 52.
- the expression cassette comprises nucleic acid sequence of nucleotides 220 to 4609 of SEQ ID NO: 49 (or SEQ ID NO: 50), nucleic acid sequence of nucleotides 226 to 4608 of SEQ ID NO: 29 (or SEQ ID NO: 59) or the nucleic acid sequence of nt 224 to 4191 of SEQ ID NO: 31 (or SEQ ID NO: 60).
- the AAV capsid is an AAVhu68 capsid.
- the vector genome comprises an AAV 5 ’ ITR, a UbC promoter, a Kozak sequence, the hCDKL5 coding sequence, four miR183 targeting sequences in the 3’ UTR of the hCDKL5 coding sequence, a rabbit globin polyA signal, and an AAV 3’ ITR.
- at least one the miR183 targeting sequences has the sequence of AGTGAATTCTACCAGTGCCATA (miR183, SEQ ID NO: 11).
- two, three or four of the miR183 targeting sequences has SEQ ID NO: 11.
- the four miR183 targeting sequences are located in tandem in the 3’ UTR and are separated by spacer sequences.
- composition comprising a stock of rAAV vector as described herein and an aqueous suspension media is provided.
- a method of treating CDD comprises administrating an effective amount of the rAAV described herein to a subject in need thereof.
- an rAAV production system useful for producing a vector as described herein is provided.
- composition comprising a rAAV or a vector as described herein and an aqueous suspension media.
- a method of treating a subject having CDD, or ameliorating symptoms of CDD, or delaying progression of CDD comprises administrating an effective amount of a rAAV or a vector as described herein to a subject in need thereof.
- the vector or rAAV is administrable to a patient via an intra-cistema magna injection (ICM).
- FIG 1A shows an AAV vector design for an AAV CDKL5 vector genome comprising a 5’ AAV inverted terminal repeat (ITR), an expression cassette comprising: the human synapsin neuronal promoter, an engineered human CDKL5 DNA coding sequence, an Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element (WPRE), and poly A, and an AAV 3’ ITR.
- ITR AAV inverted terminal repeat
- FIG IB shows an AAV vector design for an AAV CDKL5 vector genome comprising a 5 ’AAV ITR, and expression cassette comprising: human ubiquitin C (UbC) promoter, an engineered human CDKL5 DNA coding sequence, a drg-miRNA to reduce drg expression, polyA, and an AAV 3’ITR.
- FIG 1C shows an AAV vector design for an AAV CDKL5 vector genome comprising a 5 ’AAV ITR, and expression cassette comprising: a chicken beta-actin hybrid promoter (CBh), an engineered human CDKL5 DNA coding sequence, a miRNA sequence, polyA, and an AAV 3’ITR.
- CBh chicken beta-actin hybrid promoter
- FIGs 2A and 2B show analysis of mouse hippocampus, as assessed with anti-CDKL5 antibodies (S957D, University of Dundee, UK). Mice were treated with 5 x IO 10 GC AAV- hSyn-CDKL5-lco.WPRE via neonatal intracerebroventricular injection.
- FIG 2A shows CDKL5 expression by Western blotting, charting CDKL5/tubulin levels in wild-type mice with a PBS injection, KO mice with PBS injection, and treated KO mouse.
- FIG 2B shows CDKL5 activity as determined using the pS222EB2 (Baltussen et al, 2018 Chemical genetic identification of CDKL5 substrates reveals its role in neuronal microtubule dynamics, EMBO J, 37:e99763) levels in wild-type mice with a PBS injection, KO mice with PBS injection, and treated KO mice.
- FIG 3 provides a graph of mouse maturation and survival following injection of AAV-hSyn-hCDKL5-lco.WPRE in a ODD mouse model. All injected mice survived treatment, gained weight. They mice did not display any overt signs of adverse outcomes.
- FIG 4 provides results from a behavioral assessment in a CDD mice receiving AAV- hSyn-CDKL5-lco.WPRE.
- This figure charts results from the Elevated Zero Maze, which assesses the balance between risk taking, curiosity and anxiety.
- the first bar represents wt mice receiving PBS. Wt mice are curious but cautious and spend a limited time out in the open.
- the middle bar shows Cdkl5-ko mice receiving PBS only, which showed decreased anxiety and spend more time out in the open, they entered the open zone more frequently.
- AAV-CDKL5 treatment behavior of Cdkl5-ko mice reverts to wt behavior (for time in open zone and for entries from closed into open zone).
- FIGs 5A and 5B provide results from a behavioral assessment in a CDD mice receiving AAV-hSyn-CDKL5-lco.WPRE.
- FIG 5A shows exploratory activity of mice in an Open Field Arena, plotted as beam breaks/bin versus time (min).
- the dotted line shows wt mice, which are curious but within 10 min have explored the arena and calm down.
- the line with long dashes shows that Cdkl5-ko spend a longer time exploring but eventually calm down.
- the line with dashes and dots show that after AAV-CDKL5 treatment, activity of Cdkl5-ko mice is reduced, and their overall activity levels resemble wt mice.
- FIG 5B shows cumulative activity data of total beam breaks taken by mice, which confirms results in FIG 5A.
- FIG 6 shows a graph of measured latency to fall (sec) in a motor activity and agility assessment (rotarod) in mice over three consecutive days.
- the wild-type mice are observed to increase performance while learning over time.
- the Cdkl5-ko mice show improved performance, compared to wt mice, likely due to the previously observed initial hyperactivity.
- behavior of Cdkl5-ko mice is close to WT mice, and matches WT mice performance after 2 days of learning.
- FIGs 7A and 7B show results of hippocampal learning and memory (Y-maze).
- FIG 7A shows the percentage of spontaneous alterations for the test group and the two control groups.
- FIG 7B shows the distance moved (m) for the test group and the two control groups.
- the wt mice show a strong tendency to explore the maze arm that they have not visited recently (spontaneous alteration behavior), whereas Cdkl5-ko mice have a lower propensity for this memory-dependent behavior. After gene therapy, performance shows a trend for improvement.
- FIGs 8A to 8D illustrate CDKL5 expression levels or activity levels for AAV.CDLK5 vector constructs for the expression isoform 1, isoform 2, isoform 3 or isoform 4.
- FIG 8A shows quantified expression levels of CDKL5 isoforms 1, 2, 3, and 4 in knock-out mice injected with AAV vectors (5 x IO 10 GC, neonatal ICV), as compared to a wild-type mouse injected with vehicle and a knock-out mouse injected with vehicle.
- FIG 8B shows CDKL5 activity as determined from quantified signal of pS222EB2 from western blot analysis of tissue from treated a wild-type mouse (injected with vehicle (PBS)), a knock-out mouse (injected with vehicle, or the AAV.CDKL5-lco).
- FIG 8C shows CDKL5 activity as determined from quantified signal of pS222EB2 from western blot analysis of tissue from treated a wild-type mouse (injected with vehicle (PBS)), a knock-out mouse (injected with vehicle, or the AAV. CDKL5 -isoform 1, 2, 3 or 4 (from FIG 8A)).
- FIG 8D shows quantified CDKL5 expression levels of isoform 1 in KO mice (from FIG 8B).
- FIGs 9A to 9F show therapeutic efficacy of the AAV.CDKL5 gene therapy in a mouse study comparing different vector doses (5 x IO 10 GC, 2.5 x IO 10 GC, 1 x IO 10 GC, and 6 x 10 9 GC) in knock out and wild type mice.
- FIG 9A show body weight gain (g) over a period of 10 weeks for mice treated with AAV.CDKL5 at a dose of 5 x IO 10 GC or PBS.
- FIG 9B show body weight gain (g) over a period of 10 weeks for mice treated with AAV.CDKL5 at a dose of 2.5 x IO 10 GC or PBS.
- FIG 9C shows a dose-dependent results of the hindlimb clasping test for AAV.CDKL5-treated group at a dose of 5 x IO 10 GC compared to untreated Cdkl5-ko mice.
- FIG 9D shows a dose-dependent results of the hindlimb clasping test for AAV.CDKL5-treated group at a dose of a dose of 2.5 x IO 10 GC compared to untreated Cdkl5-ko mice.
- FIG 9E shows a dose-dependent results of the hindlimb clasping test for AAV.CDKL5-treated group at a dose of 1 x IO 10 GC compared to untreated Cdkl5-ko mice.
- FIG 9F shows a dose-dependent results of the hindlimb clasping test for AAV.CDKL5- treated group at a dose of 6 x 10 9 GC compared to untreated Cdkl5-ko mice.
- WT mice showed no clasping, while KO mice showed pronounced clasping.
- FIGs 10A to 10E show therapeutic efficacy of the AAV.CDL5 gene therapy in the CDD ko mouse study.
- FIGs 10A shows results in nest building (nest quality /score) for the AAV.CDKL5-treated group at a dose of 5 x IO 10 GC, compared to untreated Cdkl5-ko mice.
- FIG 10B shows results from a marble burying tasks with a trend to normalization in the AAV.CDLK5-treated group at a dose of 5 x IO 10 GC, compared to WT and Cdkl5-ko mice.
- FIG 10C shows results in nest building (nest quality/score) for the AAV.
- FIG. 10D shows results from a marble burying tasks with a trend to normalization in the AAV.CDLK5- treated group at a dose of 2.5 x IO 10 GC, compared to WT and Cdkl5-ko mice.
- FIG 10E shows results in nest building (nest quality/score) for the AAV.CDKL5-treated group at a dose of 1 x IO 10 GC compared to untreated Cdkl5-ko mice.
- FIG. 10F shows results of the nest building test in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent weight of original nestlet weight intact.
- FIGs 11A to 1 IF shows correction of hyperactivity in the ko mice receiving the AAV.CDKL5 treatment as assessed in the open field activity test.
- FIG 11A shows ambulatory activity/bin vs. time (5-minute intervals to 30 min) in AAV. CDKL5 -treated ko mice at a dose of 5 x IO 10 GC.
- FIG 1 IB shows total activity in AAV. CDKL5 -treated ko mice at a dose of 5 x IO 10 GC.
- FIG 11C shows ambulatory activity/bin vs. time (5-minute intervals to 30 min) in AAV.CDKL5-treated ko mice at a dose of 2.5 x IO 10 GC.
- FIG 1 ID shows total activity in AAV.CDKL5-treated ko mice at a dose of 2.5 x IO 10 GC.
- FIG 1 IE shows ambulatory activity/bin vs. time (5-minute intervals to 30 min) in AAV. CDKL5 -treated ko mice at a dose of 6 x 10 9 GC.
- FIG 1 IF shows total activity in AAV.CDKL5-treated ko mice at a dose of 6 x 10 9 GC. Normalization of increase risk-taking was observed in the elevated zero maze and normalization of hippocampal learning deficits are seen in the Y-maze in the AAV. CDKL5 -treated ko mice.
- FIG 12 illustrates that the expression of CDKL5 isoforms 2-4 provide significant correction of the hindlimb clasping phenotype when assessed at dose of 5 x 10 10 GC in ko mouse.
- FIGs 13A to 13D illustrate a strong trend for correction in KO mice treated with AAV.CDKL5-isoform 1.
- FIG 13A show activity in elevated in KO mice treated with AAV. CDKL5 -isoform 1 at a dose of 5 x 10 10 GC.
- FIG 13B show activity in elevated in KO mice treated with AAV. CDKL5 -isoform 1 at a dose of 2.5 x 10 10 GC.
- FIG 13C show activity in Y-Maze in KO mice treated with AAV.CDKL5-isoform 1 at a dose of 5 x 10 10 GC.
- FIG 13D show activity in Y-Maze in KO mice treated with AAV.CDKL5-isoform 1 at a dose of 2.5 x IO 10 GC.
- FIGs 14A to 14C show gender specific results in hindlimb clasping following treating of knock-out mice with the AAV.CDKL5-isoform 1.
- FIG 14A shows hindlimb clasping following treating of male knock-out mice with the AAV.CDKL5-isoform 1.
- FIG 14B shows hindlimb clasping following treating of female knock-out mice with the AAV. CDKL5 -isoform 1.
- Both hemizygous males and heterozygous females displayed hindlimb clasping in Cdkl5-ko mice, which was significantly reduced after treatment. None of the WT groups showed clasping.
- FIG 14C shows an ambulatory activity at high dose (5 x IO 10 GC, neonatal ICV) with significant improvement in female heterozygous mice.
- FIGs. 15A to 15F show results of the open field test in Male Cdkl5 K0/Y Mice and Female Cdkl5 K0/x Mice following ICV administration of an AAV vector expressing human CDKL5.
- FIG. 15 A shows results of the horizontal activity open field test in males, plotted as X/Y-Axis beam breaks.
- FIG. 15B shows results of the horizontal activity open field test in females, plotted as X/Y-Axis beam breaks.
- FIG. 15C shows results of the rearing open field test in males, plotted as Z-axis beam breaks.
- FIG. 15D shows results of the rearing open field test in females, plotted as Z-axis beam breaks.
- FIG. 15E shows results of the center activity open field test in males, plotted as percent center beam breaks.
- FIG. 15F shows results of the center activity open field test in females, plotted as percent center beam breaks.
- FIGs 16A and 16B show gender differences in ko mice treated with the AAV.CDKL5-isoform 1 vector.
- FIG 16A shows results in open field - ambulatory activity in an elevated zero maze assessment in males (KO) mouse treated with AAV.CDKL5- isoform 1, plotted as time spent (s) in an open zone.
- FIG 16B shows results in open field - ambulatory activity in an in an elevated zero maze assessment in females (ht) mouse treated with AAV.CDKL5-isoform 1, plotted as time spent (s) in an open zone. Risk-prone behavior is corrected, with a size effect being more pronounced in males.
- FIG 17 provides vector distribution in various tissue samples from the NHP study (representative for the 1 x 10 14 GC dose).
- the graph provides rAAV.CDKL5 in gc/diploid genome for various non-neuronal tissue, spinal track, and brain tissue. Strong transduction of dorsal root ganglia (DRG) is observed. Moderate to low transduction of brain tissues is observed, with some leakage into non-neuronal tissues.
- FIG 18 provides results quantified hCDKL5 expression (measured by RT-qPCR) in the NHP study shown in cerebellum, frontal cortex, occipital cortex, parietal cortex, and temporal cortex.
- FIGs 19A and 19B show results of a dose escalation studies measuring behavioral changes following CDKL5 gene therapy administration to WT mice.
- FIG 19A shows no significant hindlimb clasp severity score changes in WT mice injected at 7.5 x 10 10 GC and 1 x 10 11 GC of AAV, as compared with control mice treated with PBS.
- FIG 19B shows no significant ambulatory activity changes in WT mice injected at 7.5 x IO 10 GC and 1 x 10 11 GC of AAV, as compared with control mice treated with PBS.
- FIG 20 shows CDKL5 expression as measured qualitatively by Western blotting, at 14 days following administration of either AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 via neonatal ICV at a dose of 3 x IO 10 GC.
- FIG 21 A shows CDKL5 expression as measured qualitatively by Western blotting, at 4 months of age, wherein mice which were administered AAVrh91.UbC.CDKL5- lco.miR183 at doses 3 x IO 10 , 6 x IO 10 GC via neonatal ICV.
- FIG 21B shows CDKL5 expression as measured qualitatively by Western blotting, at 4 months of age, wherein mice which were administered AAVrh91.CBh.CDKL5- lco.miR183at doses 3 x IO 10 , 1 x IO 10 GC via neonatal ICV.
- FIG. 21C shows CDKL5 expression quantified from Western blotting analysis, charted as CDKL5/tubulin levels in wild type and knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miRl 83 at doses 3 x IO 10 , 6 x IO 10 GC via neonatal ICV, and compared to AAVhu68.hSyn-CDKL5 at a dose of 5 x IO 10 GC.
- FIG. 22A shows a representative image from immunofluorescent microscopy analysis of CDKL5 expression following administration with AAVrh91.UbC.CDKL5- lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- FIG. 22B shows a representative image from immunofluorescent microscopy analysis of CDKL5 expression following administration with AAVrh91.CBh.CDKL5- lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- FIG. 23A shows a representative image (zoomed in view) from immunofluorescent microscopy analysis of CDKL5 expression (samples were also probed for NeuN, neuronal marker) following administration with AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x 1010 GC via neonatal ICV.
- FIG. 23B shows a representative image (zoomed in view) from immunofluorescent microscopy analysis of CDKL5 expression (samples were also probed for NeuN, neuronal marker) following administration with AAVrh91.CBh.CDKL5-lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- FIG. 24 shows quantification of CDKL5 -expressing neurons (above background levels; plotted at percent CDKL5 in positively identified neurons) as compared to previous results following administration with AAVhu68.hSyn.CDKL5.
- FIGs. 25A to 25C show results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 1 x IO 10 , 3 x IO 10 , 6 x 10 10 GC via neonatal ICV.
- FIG. 25 A shows results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 1 x IO 10 GC via neonatal ICV.
- FIG. 25 A shows results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 1 x IO 10 GC via neonatal ICV.
- 25B shows results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 3 x IO 10 GC via neonatal ICV.
- FIG. 25C shows results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 6 x IO 10 GC via neonatal ICV.
- FIG. 26A shows severity score observed in DRG neurons from cervical, thoracic, and lumbar collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC via ICM route.
- Score 0 signifies no signs of toxicity
- score 5 signifies severe toxicity, as scored by a board- certified veterinary pathologist.
- a score of 0.5 or lower is considered background, based on similar evaluations of naive tissue.
- FIG. 26B shows severity score observed in spinal cord neurons from cervical, thoracic, and lumbar collected tissue from NHPs treated with AAVrh91.UbC.CDKL5- lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC via ICM route.
- FIG. 26C shows severity score observed in sural nerve from proximal and distal collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC via ICM route.
- FIG. 27 shows results of the vector copy number plotted as GC/diploid genome in various tissues oh NHP following administration with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 vectors.
- FIG. 28 shows relative expression of CDKL5, plotted as per 100 ng of cDNA, in various CNS tissue (motor cortex, somatosensory (som. Sens). Cortex, parietal cortex, hippocampus, thalamus) of NHP, as compared to results observed in mouse brain.
- CNS tissue motor cortex, somatosensory (som. Sens). Cortex, parietal cortex, hippocampus, thalamus) of NHP, as compared to results observed in mouse brain.
- FIG. 29A shows CDKL5 expression quantified from Western blotting analysis, charted as CDKL5/tubulin levels in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miRl 83 at doses 3 x IO 10 GC, as compared to WT and knockout mice treated with PBS (control groups).
- FIG. 29B shows kinase activity quantified from Western blotting analysis, charted as pEB2pS222/total EB2 levels in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miRl 83 at doses 3 x IO 10 GC, as compared to WT and knockout mice treated with PBS (control groups)
- FIG. 30 shows kinase activity as measured qualitatively by Western blotting (using pEB-S222 antibody; Baltussen at al., Chemical genetic identification of CDKL5 substrates reveals its role in neuronal microtubule dynamics, 2018, EMBO J, 37:e99763), in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at doses 3 x IO 10 GC, as compared to WT and knockout mice treated with PBS (control groups).
- FIG. 31 A shows results of percent neurons with CDKL5 protein expression in mouse cortex and hippocampus tissue following neonatal ICV administration with AAVrh91.UbC.CDKL5-lco.miR183 at doses of 1 x IO 10 , 3 x IO 10 , 6 x IO 10 GC, as compared to WT mice treated with PBS.
- FIG. 3 IB shows a representative microscopy image from immunofluorescent analysis staining with DAPI (nuclei), CDKL5, and NeuN (neuronal marker) of cortical section tissue following neonatal ICV administration with AAVrh91.UbC.CDKL5- lco.miR183 at doses of 3 x 10 10 GC.
- DAPI nuclei
- CDKL5 nuclei
- NeuN neuroneuronal marker
- FIG. 32 shows analysis of measured body weights of wild type and CDKL5-ko when administered with PBS, or AAV.UbC.CDKL5-lco.miRl 83 at doses of 1 x IO 10 , 3 x IO 10 , 6 x IO 10 GC.
- FIG. 33A shows a results of the hindlimb clasping test for AAV.UbC.CDKL5- lco.miR183-treated group at a dose of 3 x IO 10 GC compared to untreated group in Cdkl5-ko mice and WT mice. Statistically significant improvement from ko is indicated (*p ⁇ 0.05, **p ⁇ 0.01).
- FIG. 33B shows dose-dependent effect on hyperactivity, as measured in the open field activity test and plotted as ambulatory activity (beam breaks) in Cdkl5-ko mice and WT mice following administration of AAV.UbC.CDKL5-lco.miR183 at doses of 1 x IO 10 , 3 x IO 10 , 6 x IO 10 GC.
- Statistically significant improvement from ko is indicated (*p ⁇ 0.05, **p ⁇ 0.01)
- FIG. 34A shows results of binned ambulatory activity for groups of WT and Cdkl5- ko mice administered with AAV.UbC.CDKL5-lco.miRl 83 at a low dose of 1 x IO 10 GC. Statistically significant improvement from ko is indicated (*p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001, ****p ⁇ 0.0001).
- FIG. 34B shows results of binned ambulatory activity for groups of WT and Cdkl5- ko mice administered with AAV.UbC.CDKL5-lco.miRl 83 at a medium dose of 3 x IO 10 GC.
- FIG. 34C shows results of binned ambulatory activity for groups of WT and Cdkl5- ko mice administered with AAV.UbC.CDKL5-lco.miR183 at a high dose of 6 x IO 10 GC.
- FIG. 35 shows results in nest building (nest quality/score) for the AAV.UbC.CDKL5-lco.miR183-treated WT and Cdkl5-ko mice at doses of 1 x IO 10 , 3 x IO 10 , 6 x lO 10 GC.
- FIG. 36A shows a schematic overview of the intra-cistema magna (ICM) administration procedure.
- FIG. 36B shows a more detailed overview of the ICM administration as a fluoroscopy-guided procedure.
- FIG. 37A shows analysis of the brain transduction as measured by vector genome copies via qPCR of extracted DNA/RNA from different brain regions of NHP following administration with AAVrh91.UbC.CDKL5-lco.miR183.
- FIG. 37B shows relative CDKL5 transgene expression (mRNA) as measured via qPCR of RNA extracted from different NHP brain regions following administration with AAVrh91.UbC.CDKL5-lco.miRl 83 (relative to expression in mouse brain when administered at a dose of 3 x 10 10 GC).
- FIG. 38A shows results of molecular analysis of CDKL5 gene therapy outcome on the single-neuron basis, plotted as percent of transduced neurons measured by vector genome copies.
- FIG. 38B shows CDKL5 transgene expression levels as measured from detectable CDKL5 transgene mRNA in single neurons, plotted as percent transgene expressing neurons.
- FIG. 39A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as time (sec) in open zone.
- FIG. 39B shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as time (sec) in open zone.
- FIG. 40A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as open zone entries.
- FIG. 40B shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as open zone entries.
- FIG. 41 A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as total distance moved.
- FIG. 4 IB shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as total distance moved.
- FIG. 42A shows results of Y maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent spontaneous alterations.
- FIG. 42B shows results of Y maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent spontaneous alterations.
- FIG. 43A shows results of contextual fear conditioning test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent freezing.
- FIG. 43B shows results of contextual fear conditioning test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent freezing.
- FIG. 44A shows results of a transgene product expression in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5 (CDKL5/tubulin).
- FIG. 44B shows results of an activity in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5 (pS222/Total EB2).
- FIG. 45A shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a low dose.
- FIG. 45B shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a low dose.
- FIG. 45 C shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a mid-dose.
- FIG. 45B shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a mid-dose.
- 45D shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a mid-dose.
- FIG. 45E shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a high dose.
- FIG. 45F shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a high dose.
- FIG. 47A shows upstream manufacturing process flow diagram for drug substance.
- FIG. 47B shows downstream manufacturing process flow diagram for drug substance.
- FIG. 48 shows overview of manufacturing process flow diagram for drug substance.
- compositions and methods for treating CDD are provided herein.
- An effective amount of a recombinant adeno-associated virus (rAAV) having an AAV capsid (e.g., AAVhu68) and packaged therein a vector genome encoding a functional human cychn dependent kinase like 5 (hCDKL5) is delivered to a subject in need.
- rAAV recombinant adeno-associated virus
- Cyclin dependent kinase like 5 (CDKL5, also known as CFAP247, serine/threonine kinase 9, STK9; Uniprot# 076039) gene is natively located on the short (p) arm of the X chromosome at position 22. 13.
- the N-terminus of the CDLK5 protein acts as a kinase, which is an enzyme that changes the activity of other proteins.
- Several direct substrates for CDKL5 have been identified (Baltussen et al, 2018; Munoz et al, 2018).
- the CDKL5 C- terminus is of unknown function.
- a functional hCDKL5 protein refers to an isoform, a natural variant, a variant, a polymorph, or a truncation of a CKDL5 protein which is not associated with CDD and/or delivery or expression of which may ameliorate symptoms or delay progression of CDD in an animal model or a patient. See, OMIM # 300203, each of the webpages is incorporated herein by reference in its entirety.
- the functional hCDKL5 has an amino acid sequence of SEQ ID NO: 2 (isoform 1) or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- the functional hCDKL5 protein has an amino acid sequence of SEQ ID NO: 19 (isoform 2) or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- the functional hCDKL5 protein has an amino acid sequence of SEQ ID NO: 20 (isoform 3) or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- the functional hCDKL5 protein has an amino acid sequence of SEQ ID NO: 21 (isoform 4) or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- the functional hCDKL5 is a truncated hCDKL5 which comprises a methyl-CpG binding domain (MBD) having the sequence and a NCoR/SMRT Interaction Domain (NID). See, WO2018172795A1, which is incorporated herein by reference in its entirety.
- a functional hCDKL5 protein ameliorates symptoms or delays progression of CDD in an animal model.
- One exemplified animal model is a CDKL5- ko mouse. Other suitable models are described herein.
- the CDD symptoms or progression may be evaluated using various assays/methods, including but not limited to, a survival plot (e.g., Kaplan-Meier survival plot), monitoring body weights, and observing behavior changes (for example, by hind limb clasping, Open Field Assay (motor function), Elevated Zone Maze (anxiety/risk vs. exploration), Y Maze (learning and memory /hippocampus), Marble Burying Assay (inborn behavior and locomotion), Nesting (inborn social behavior), and rotarod assay (motor function, coordination)).
- a survival plot e.g., Kaplan-Meier survival plot
- monitoring body weights for example, by hind limb clasping, Open Field Assay (motor function), Elevated Zone Maze (anxiety/risk vs. exploration), Y Maze (learning and memory /hippocampus), Marble Burying Assay (inborn behavior and locomotion), Nesting (inborn social behavior), and rotarod assay (motor function, coordination)
- administration or expression of a functional hCDKL5 protein in an animal model leads to amelioration of CDD symptoms or delay in CDD progression shown by an assay result which is at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100%, or more than 100% of that obtained in a corresponding wildtype animal.
- administration or expression of a functional hCDKL5 protein in a CDD animal model leads to amelioration of CDD symptoms or delay in CDD progression shown by an improved assay result which is at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100%, or more than 100% of that obtained from a corresponding non-treated CDD animal.
- hCDKL5 coding sequence a nucleic acid sequence encoding a functional hCDKL5 protein, termed as hCDKL5 coding sequence or CDKL5 coding sequence.
- the hCDKL5-coding sequence is SEQ ID NO: 3 or a sequence at least about 95% identical to SEQ ID NO: 3.
- the hCDKL5 coding sequence is selected from SEQ ID NO: 2 (referred to as CDKL5 or CDKL5co or CDKL5-1 or CDKL5-lco) or NCBI Reference Sequences NM_ 001037343.
- CDKL5 or CDKL5el SEQ ID NO: 16
- SEQ ID NO: 19 NM_001323289.2
- SEQ ID NO: 17 encoding amino acid sequence NP_001310218. 1
- SEQ ID NO: 20 NM_003159.2
- SEQ ID NO: 18 encoding amino acid sequence NP_003150.1 (SEQ ID NO: 21), or a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- the hCDKL5 coding sequence is a modified or engineered (hCDKL5 or hCDKL5co or CDKL5-1 or CDKL5-lco).
- the modified or engineered shares less than about 70% (e.g., about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identity to the NCBI Reference Sequences.
- the hCDKL5 coding sequence is SEQ ID NO: 22 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto.
- 70% e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%
- the hCDKL5 coding sequence is SEQ ID NO: 24 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto.
- 70% e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%
- the hCDKL5 coding sequence is SEQ ID NO: 25 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto.
- 70% e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%
- the hCDKL5 coding sequence is SEQ ID NO: 26 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto.
- 70% e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%
- the hCDKL5 -coding sequence is an engineered sequence of SEQ ID NO: 37 or a sequence at least about 95% identical to SEQ ID NO: 37. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 38 or a sequence at least about 95% identical to SEQ ID NO: 38. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 39 or a sequence at least about 95% identical to SEQ ID NO: 39. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 40 or a sequence at least about 95% identical to SEQ ID NO: 40.
- the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 41 or a sequence at least about 95% identical to SEQ ID NO: 41. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 42 or a sequence at least about 95% identical to SEQ ID NO: 42. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 43 or a sequence at least about 95% identical to SEQ ID NO: 43. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 44 or a sequence at least about 95% identical to SEQ ID NO: 44.
- the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 45 or a sequence at least about 95% identical to SEQ ID NO: 45. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 46 or a sequence at least about 95% identical to SEQ ID NO: 46. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 47 or a sequence at least about 95% identical to SEQ ID NO: 47. In certain embodiments, the hCDKL5-coding sequence is an engineered sequence of SEQ ID NO: 48 or a sequence at least about 95% identical to SEQ ID NO: 48.
- a “nucleic acid”, as described herein, can be RNA, DNA, or a modification thereof, and can be single or double stranded, and can be selected, for example, from a group including: nucleic acid encoding a protein of interest, oligonucleotides, nucleic acid analogues, for example peptide-nucleic acid (PNA), pseudocomplementary PNA (pc-PNA), locked nucleic acid (LNA) etc.
- PNA peptide-nucleic acid
- pc-PNA pseudocomplementary PNA
- LNA locked nucleic acid
- nucleic acid sequences include, for example, but are not limited to, nucleic acid sequence encoding proteins, for example that act as transcriptional repressors, antisense molecules, ribozymes, small inhibitory nucleic acid sequences, for example but are not limited to RNAi, shRNAi, siRNA, micro RNAi (mRNAi ), antisense oligonucleotides etc.
- sequence identity refers to the residues in the two sequences which are the same when aligned for correspondence.
- the length of sequence identity comparison may be over the full-length of the genome, the full-length of a gene coding sequence, or a fragment of at least about 500 to 5000 nucleotides, is desired. However, identity among smaller fragments, e.g., of at least about nine nucleotides, usually at least about 20 to 24 nucleotides, at least about 28 to 32 nucleotides, at least about 36 or more nucleotides, may also be desired.
- Percent identity may be readily determined for amino acid sequences over the full- length of a protein, polypeptide, about 32 amino acids, about 330 amino acids, or a peptide fragment thereof or the corresponding nucleic acid sequence coding sequences.
- a suitable amino acid fragment may be at least about 8 ammo acids in length, and may be up to about 700 amino acids.
- identity”, “homology”, or “similarity” is determined in reference to “aligned” sequences. “Aligned” sequences or “alignments” refer to multiple nucleic acid sequences or protein (amino acids) sequences, often containing corrections for missing or additional bases or amino acids as compared to a reference sequence.
- Sequence alignment programs are available for amino acid sequences, e.g., the “Clustal X”, “Clustal Omega” “MAP”, “PIMA”, “MSA”, “BLOCKMAKER”, “MEME”, and “Match-Box” programs. Generally, any of these programs are used at default settings, although one of skill in the art can alter these settings as needed. Alternatively, one of skill in the art can utilize another algorithm or computer program which provides at least the level of identity or alignment as that provided by the referenced algorithms and programs. See, e.g., J. D. Thomson et al, Nucl. Acids. Res., “A comprehensive comparison of multiple sequence alignments”, 27(13): 2682-2690 (1999).
- nucleic acid sequences Multiple sequence alignment programs are also available for nucleic acid sequences. Examples of such programs include, “Clustal W”, “Clustal Omega”, “CAP Sequence Assembly”, “BLAST”, “MAP”, and “MEME”, which are accessible through Web Servers on the internet. Other sources for such programs are known to those of skill in the art. Alternatively, Vector NTI utilities are also used. There are also a number of algorithms known in the art that can be used to measure nucleotide sequence identity, including those contained in the programs described above. As another example, polynucleotide sequences can be compared using FastaTM, a program in GCG Version 6.1. FastaTM provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. For instance, percent sequence identity between nucleic acid sequences can be determined using FastaTM with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) as provided in GCG Version 6. 1, herein incorporated by reference. II. Expression Cassette
- a nucleic acid sequence comprising the hCDKL5 coding sequence under control of regulatory sequences which direct the hCDKL5 expression in a target cell, also termed as an expression cassette.
- an “expression cassette” refers to a nucleic acid molecule which comprises a coding sequence (e.g., a CDKL5 coding sequence), and regulatory sequences operably linked thereto.
- a vector genome contains two or more expression cassettes.
- the term “transgene” refers to a DNA sequence from an exogenous source which is inserted into a target cell; typically, the transgene encodes a product (e.g., CDKL5).
- such an expression cassette to be packed into a viral vector contains the coding sequence for the gene product described herein flanked by packaging signals of the viral genome and other expression control sequences such as those described herein.
- the regulatory sequences necessary are operably linked to the hCDKL5 coding sequence in a manner which permits its transcription, translation and/or expression in target cell.
- operably linked sequences include sequences which modulate transcription, translation, and/or expression that are contiguous with the hCDKL5 coding sequence and regulatory sequences that act in trans or at a distance to control the hCDKL5 coding sequence.
- the expression cassette may contain regulatory sequences upstream (5’ to) of the gene sequence, e.g., one or more of a promoter, an enhancer, an intron, etc., and one or more of an enhancer, or regulatory sequences downstream (3’ to) a gene sequence, e.g., 3’ untranslated region (3 ’ UTR) comprising a polyadenylation site, among other elements.
- regulatory sequences typically include, e.g., one or more of a promoter, an enhancer, an intron, a Kozak sequence, a polyadenylation sequence, and a TATA signal.
- the promoter is a tissue-specific promoter, e.g., a CNS-specific or neuronspecific promoter.
- the promote is a human synapsin promoter (SEQ ID NO: 23).
- an additional or alternative neuron-specific promoter sequence may be selected from neuron-specific enolase (NSE) promoter (Andersen et al., (1993) Cell. Mol. Neurobiol., 13:503 15), neurofilament light chain gene promoter (Piccioli et al., (1991) Proc. Natl. Acad. Sci. USA, 88:5611 5), neuron-specific vgf gene promoter (Piccioli et al., (1995) Neuron, 15:373 84), and/or others.
- NSE neuron-specific enolase
- the human synapsin promoter has a sequence (e.g., nt 213 to nt 678 of SEQ ID NOs: 1, 3, 5, 7, 9 or SEQ ID NO: 23, also termed as hSyn or Syn herein.
- the promoter is a constitutive promoter, e.g., a chicken beta actin promoter with a cytomegalovirus enhancer (CB7) promoter, a human elongation initiation factor 1 alpha promoter (EFla) promoter, a human ubiquitin C (UbC) promoter.
- the regulatory sequences direct hCDKL5 expression in central nervous system (CNS) cells.
- the UbC promoter comprises nucleic acid sequence of SEQ ID NO: 52.
- the target cell may be a central nervous system cell.
- the target cell is one or more of an excitatory neuron, an inhibitory neuron, a glial cell, a cortex cell, a frontal cortex cell, a cerebral cortex cell, a spinal cord cell.
- the target cell is a peripheral nervous system (PNS) cell, for example a retina cell.
- PNS peripheral nervous system
- Other cells other than those from nervous system may also be chosen as a target cell, such as a monocyte, a B lymphocyte, a T lymphocyte, a NK cell, a lymph node cell, a tonsil cell, a bone marrow mesenchymal cell, a stem cell, a bone marrow stem cell, a heart cell, an epithelium cell, a esophagus cell, a stomach cell, a fetal cut cell, a colon cell, a rectum cell, a liver cell, a kidney cell, a lung cell, a salivary gland cell, a thyroid cell, an adrenal cell, a breast cell, a pancreas cell, an islet of Langerhans cell, a gallbladder cell, a prostate cell, a urinary bladder cell, a skin cell, a uterus cell, a cervix cell, a testis cell, or any other cell which expresses a functional CDKL5 protein in a subject without CDD.
- an additional or alternative promoter sequence may be included as part of the expression control sequences (regulatory sequences), e.g., located between the selected 5’ ITR sequence and the coding sequence.
- Constitutive promoters, regulatable promoters [see, e.g., WO 2011/126808 and WO 2013/04943], tissue specific promoters, or a promoter responsive to physiologic cues may be utilized in the vectors described herein.
- the promoter(s) can be selected from different sources, e.g., human cytomegalovirus (CMV) immediate-early enhancer/promoter, the SV40 early enhancer/promoter, the JC polymovirus promoter, myelin basic protein (MBP) or glial fibrillary acidic protein (GFAP) promoters, herpes simplex virus (HSV-1) latency associated promoter (LAP), rouse sarcoma virus (RSV) long terminal repeat (LTR) promoter, neuronspecific promoter (RNSE), platelet derived growth factor (PDGF) promoter, hSYN, melaninconcentrating hormone (MCH) promoter, CBA, matrix metalloprotein promoter (MPP), and the chicken beta-actin promoter.
- CMV human cytomegalovirus
- MBP myelin basic protein
- GFAP glial fibrillary acidic protein
- HSV-1 herpes simplex virus
- LAP rouse sar
- a vector may contain one or more other appropriate transcription initiation sequences, transcription termination sequences, enhancer sequences, efficient RNA processing signals such as splicing and polyadenylation (poly A) signals; sequences that stabilize cytoplasmic mRNA for example WPRE; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
- a suitable enhancer is the CMV enhancer.
- Other suitable enhancers include those that are appropriate for desired target tissue indications.
- the regulatory sequences comprise one or more expression enhancers.
- the regulatory sequences contain two or more expression enhancers.
- an enhancer may include a CMV immediate early enhancer. This enhancer may be present in two copies which are located adjacent to one another. Alternatively, the dual copies of the enhancer may be separated by one or more sequences.
- the expression cassette further contains an intron, e.g., the chicken beta-actin intron.
- the intron is a chimeric intron (CI) - a hybrid intron consisting of a human beta-globin splice donor and immunoglobulin G (IgG) splice acceptor elements.
- suitable introns include those known in the art, e.g., such as are described in WO 2011/126808.
- polyA sequences include, e.g., Rabbit globin poly A, SV40, SV50, bovine growth hormone (bGH), human growth hormone, and synthetic polyAs.
- the polyA sequence is an SV40 polyA sequence.
- the polyA sequence is a rabbit beta globin (RBG or rbg or rBG) polyA sequence.
- the polyA is a rabbit beta globin polyA comprising nucleic acid sequence of SEQ ID NO: 53.
- one or more sequences may be selected to stabilize mRNA.
- the expression cassettes provided may include one or more expression enhancers such as post-transcriptional regulatory element from hepatitis viruses of woodchuck (WPRE), human (HPRE), ground squirrel (GPRE) or arctic ground squirrel (AGSPRE); or a synthetic post-transcriptional regulatory element.
- WPRE woodchuck
- HPRE human
- GPRE ground squirrel
- AGSPRE arctic ground squirrel
- a synthetic post-transcriptional regulatory element are particularly advantageous when placed in a 3' UTR and can significantly increase mRNA stability and/or protein yield.
- the expressions cassettes provided include a regulator sequence that is a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE) or a variant thereof. Suitable WPRE sequences are provided in the vector genomes described herein and are known in the art (e.g., such as those are described in US Patent Nos.
- the WPRE is a variant that has been mutated to eliminate expression of the woodchuck hepatitis B virus X (WHX) protein, including, for example, mutations in the start codon of the WHX gene (See, Zanta- Boussif et al., Gene Ther. 2009 May;16(5):605-19, which is incorporated by reference).
- WHX woodchuck hepatitis B virus X
- enhancers are selected from a non-viral source.
- no WPRE sequence is present.
- an expression cassette refers to nucleic acid molecule with sequence of nt 213-4439 of SEQ ID NO: 1, encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 2). In certain embodiments, an expression cassette refers to nucleic acid molecule with sequence of nt 213-4562 of SEQ ID NO: 5 encoding for amino acid sequence of hCDKL5 (isoform 2 or 2GS SEQ ID NO: 6). In certain embodiments, an expression cassette refers to nucleic acid molecule with sequence of nt 213-4388 of SEQ ID NO: 7 encoding for amino acid sequence of hCDKL5 (isoform 3 or 3GS; SEQ ID NO: 8).
- an expression cassette refers to nucleic acid molecule with sequence of nt 213-4511 of SEQ ID NO: 9 encoding for amino acid sequence of hCDKL5 (isoform 4 or 4GS; SEQ ID NO: 10).
- an expression cassette comprises an engineered nucleic acid sequence selected from SEQ ID NOs: 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, or 48 and encoding for an amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 2).
- an expression cassette refers to nucleic acid molecule with sequence of nt 213-4555 of SEQ ID NO: 3, encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 4) and comprising of miRNA183 (SEQ ID NO: 11).
- these expression cassettes further comprise one, two, three, four or more miRNA sequences for reducing drg expression.
- an expression cassette refers to nucleic acid molecule with sequence of nt 226-4608 of SEQ ID NO: 29 (or SEQ ID NO: 59), encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 30) and comprising 4 tandem repeats of miRNA183 (SEQ ID NO: 11).
- an expression cassette refers to nucleic acid molecule with sequence of nt 220- 4609 of SEQ ID NO: 49 (or SEQ ID NO: 50), encoding for amino acid sequence of hCDKL5 (isoform 1) and comprising 4 tandem repeats of miRNA183 (SEQ ID NO: 11).
- an expression cassette refers to nucleic acid molecule with sequence of nt 224-4191 of SEQ ID NO: 31 (or SEQ ID NO: 60), encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 32) and comprising 4 tandem repeats of miRNA183 (SEQ ID NO: 11). See, e.g., PCT/US 19/67872, filed December 20, 2019 and now published as WO 2020/132455.
- the expression cassette comprises four copies of the miR183 expression cassette.
- the expression cassette contains a miR-183 target sequence that includes AGTGAATTCTACCAGTGCCATA (SEQ ID NO: 11), where the sequence complementary to the miR-183 seed sequence is underlined.
- the expression cassette contains more than one copy (e.g., two or three copies) of a sequence that is 100% complementary to the miR-183 seed sequence.
- a miR-183 target sequence is about 7 nucleotides to about 28 nucleotides in length and includes at least one region that is at least 100% complementary to the miR-183 seed sequence.
- a miR-183 target sequence contains a sequence with partial complementarity to SEQ ID NO: 11 and, thus, when aligned to SEQ ID NO: 11, there are one or more mismatches.
- a miR-183 target sequence comprises a sequence having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches when aligned to SEQ ID NO: 11, where the mismatches may be non-contiguous.
- a miR-183 target sequence includes a region of 100% complementarity which also comprises at least 30% of the length of the miR-183 target sequence. In certain embodiments, the region of 100% complementarity includes a sequence with 100% complementarity to the miR-183 seed sequence.
- the remainder of a miR-183 target sequence has at least about 80% to about 99% complementarity to miR-183.
- the expression cassette includes a miR-183 target sequence that comprises a truncated SEQ ID NO: 11, i.e., a sequence that lacks at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at either or both the 5’ or 3’ ends of SEQ ID NO: 11.
- the expression cassette comprises a transgene and one miR-183 target sequence.
- the expression cassette comprises at least two, three or four miR- 183 target sequences.
- the inclusion of at two, three or four miR- 183 target sequences in the expression cassette results in increased levels of transgene expression in a target tissue, such as the heart.
- the expression cassette comprises a UbC promoter, the hCDKL5-l coding sequence, 4 copies of a miR183 target sequence, and a polyA sequence.
- the expression cassette comprises a hSyn promoter, the hCDKL5-l coding sequence, 4 copies of a miR183 target sequence, and a polyA sequence.
- the expression cassette comprises a CBh promoter, the hCDKL5-l coding sequence, 4 copies of a miR183 target sequence, and a polyA sequence.
- the expression cassette further comprises at least one intron and/or at least one enhancer sequence.
- the enhancer is a mutant WPRE element lacking the ability to express the woodchuck hepatitis B virus X (WHX) protein.
- a vector genome comprises a 5 ’ - AAV ITR sequence, a spacer sequence, an expression cassette as described herein, a spacer sequence, and a 3 ’ - AAV ITR.
- the expression cassette comprises a nucleic acid sequence of nt 220 to 4609 of SEQ ID NO: 49 (or SEQ ID NO: 50). In certain embodiments, the expression cassette comprises a nucleic acid sequence of nt 226 to 4608 of SEQ ID NO: 29 (or SEQ ID NO: 59). In certain embodiments, the expression cassette comprises nucleic acid sequence of nt 224 to 4191 of SEQ ID NO: 31 (or SEQ ID NO: 60).
- a recombinant adeno-associated virus useful for treating ODD.
- the rAAV comprises (a) an AAV capsid; and (b) a vector genome packaged in the AAV capsid of (a).
- the AAV capsid selected targets the cells to be treated.
- the capsid is from Clade F.
- another AAV capsid source may be selected.
- the vector genome comprises inverted terminal repeats (ITR) and a nucleic acid sequence encoding a functional human cyclin dependent kinase like 5 (hCDKL5) under control of regulatory sequences which direct the hCDKL5 expression.
- CDKL5 may be referring to CDKL5 or hCDKL5, CDKL5-2GS or hCDKL5-2GS, CDKL5-3GS or hCDKL5-3GS, and CDKL5-4GS or hCDKL5-4GS.
- the hCDKL5-coding sequence is at least about 95% identical to SEQ ID NO: 22 (encoding amino acid sequence of CDKL5-1 or hCDKL5-l; SEQ ID NO: 2).
- the hCDKL5-coding sequence is at least about 95% identical to SEQ ID NO: 24 (encoding amino acid sequence of CDKL5-2GS or hCDKL5-2GS; SEQ ID NO: 6).
- the hCDKL5-coding sequence is at least about 95% identical to SEQ ID NO: 25 (encoding amino acid sequence of CDKL5-3GS or hCDKL5-3GS; SEQ ID NO: 8). In certain embodiments, the hCDKL5-coding sequence is at least about 95% identical to SEQ ID NO: 26 (encoding amino acid sequence of CDKL5- 4GS or hCDKL5-4GS; SEQ ID NO: 10). In certain embodiments, the hCDKL5-coding sequence is less than 80% identical to any one of hCDKL5 transcript variants 1 to 3 (NM_ 001037343. 1 with SEQ ID NO: 16 and encoding amino acid sequence NP_001032420.
- the hCDKL5-coding sequence is SEQ ID NOs: 37, 38, 39, 40, 41, 42, 43, 44, 45, 46 and 47 or at least about 95% identical thereto (encoding amino acid sequence of CDKL5-1 or hCDKL5-l; SEQ ID NO: 2).
- the functional hCDKL5 has an amino acid sequence of SEQ ID NO: 2 (CDKL5-1 or hCDKL5-l). In certain embodiments, the functional hCDKL5 has an amino acid sequence of SEQ ID NO: 6 (CDKL5-2GS or hCDKL5-2GS). In certain embodiments, the functional hCDKL5 has an amino acid sequence of SEQ ID NO: 8 (CDKL5-3GS or hCDKL5-3GS). In certain embodiments, the functional hCDKL5 has an amino acid sequence of SEQ ID NO: 10 (CDKL5-4GS or hCDKL5-4GS). In certain embodiments, the regulatory sequences direct hCDKL5 expression in central nervous system cells.
- the regulatory sequences comprise a human Synapsin promoter (hSyn) or a CB7 promoter. In certain embodiments, the regulatory sequences comprise a human Ubiquitin C (hUbC or UbC) promoter. In certain embodiments, the regulatory elements comprise one or more of a Kozak sequence, a polyadenylation sequence, an intron, an enhancer, and a TATA signal. In certain embodiments, the vector genome further comprises at least two tandem repeats of dorsal root ganglion (drg)-specific miRNA target sequences, wherein the at least two tandem repeats comprise at least a first miRNA target sequence and at least a second miRNA target sequence which may be the same or different.
- drg dorsal root ganglion
- the vector genome is nt 1 to nt 4634 of SEQ ID NO: 1, or nt 1 to nt 4750 of SEQ ID NO: 3, or nt 1 to nt 4757 of SEQ ID NO: 5, or nt 1 to nt 4583 of SEQ ID NO: 7, or nt 1 to nt 4706 of SEQ ID NO: 9 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
- a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 1, encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 2). In certain embodiments, a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 5 encoding for amino acid sequence of hCDKL5 (isoform 2 or 2GS SEQ ID NO: 6). In certain embodiments, a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 7 encoding for amino acid sequence of hCDKL5 (isoform 3 or 3GS; SEQ ID NO: 8).
- a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 9 encoding for amino acid sequence of hCDKL5 (isoform 4 or 4GS; SEQ ID NO: 10). In certain embodiments, a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 3, encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 4) and comprising of miRNA183 (SEQ ID NO: 11).
- a vector genome refers to a nucleic acid molecule comprising SEQ ID NO: 29, encoding an amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 30) and comprising tandem repeats of miRNA183 (SEQ ID NO: 11).
- a vector genome refers to nucleic acid molecule comprising SEQ ID NO: 31, encoding for amino acid sequence of hCDKL5 (isoform 1; SEQ ID NO: 32) and comprising tandem repeats of miRNA183 (SEQ ID NO: 11).
- another non- AAV coding sequence may be included, e.g., a peptide, polypeptide, protein, functional RNA molecule (e.g., miRNA, miRNA inhibitor) or other gene product, of interest.
- Useful gene products may include miRNAs. miRNAs and other small interfering nucleic acids regulate gene expression via target RNA transcript cleavage/degradation or translational repression of the target messenger RNA (mRNA). miRNAs are natively expressed, typically as final 19-25 non-translated RNA products. miRNAs exhibit their activity through sequence-specific interactions with the 3' untranslated regions (UTR) of target mRNA s.
- miRNAs form hairpin precursors which are subsequently processed into a miRNA duplex, and further into a “mature” single stranded miRNA molecule.
- This mature miRNA guides a multiprotein complex, miRISC, which identifies target site, e.g., in the 3 ! UTR regions, of target mRNAs based upon their complementarity to the mature miRNA.
- an “miRNA target sequence” is a sequence located on the DNA positive strand (5’ to 3’) and is at least partially complementary to a miRNA sequence, including the miRNA seed sequence.
- the miRNA target sequence is exogenous to the untranslated region of the encoded transgene product and is designed to be specifically targeted by miRNA in cells in which repression of transgene expression is desired.
- miR183 cluster target sequence refers to a target sequence that responds to one or members of the miR183 cluster (alternatively termed family), including miRs-183, -96 and - 182 (as described by Dambal, S. et al. Nucleic Acids Res 43:7173-7188, 2015, which is incorporated herein by reference).
- the miRNA target sequence is at least 7 nucleotides to about 28 nucleotides in length, at least 8 nucleotides to about 28 nucleotides in length, 7 nucleotides to 28 nucleotides, 8 nucleotides to 18 nucleotides, 12 nucleotides to 28 nucleotides in length, about 20 to about 26 nucleotides, about 22 nucleotides, about 24 nucleotides, or about 26 nucleotides, and contains at least one consecutive region (e.g., 7 or 8 nucleotides) which is complementary to the miRNA seed sequence.
- at least one consecutive region e.g., 7 or 8 nucleotides
- the target sequence comprises a sequence with exact complementarity (100%) or partial complementarity to the miRNA seed sequence with some mismatches. In certain embodiments, the target sequence comprises at least 7 to 8 nucleotides which are 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence consists of a sequence which is 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence contains multiple copies (e.g., two or three copies) of the sequence which is 100% complementary to the seed sequence. In certain embodiments, the region of 100% complementarity comprises at least 30% of the length of the target sequence. In certain embodiments, the remainder of the target sequence has at least about 80 % to about 99% complementarity to the miRNA. In certain embodiments, in an expression cassette containing a DNA positive strand, the miRNA target sequence is the reverse complement of the miRNA.
- an “miRNA target sequence” is a sequence located on the DNA positive strand (5’ to 3’) and is at least partially complementary to a miRNA sequence, including the miRNA seed sequence.
- the miRNA target sequence is exogenous to the untranslated region of the encoded transgene product and is designed to be specifically targeted by miRNA in cells in which repression of transgene expression is desired.
- miR183 cluster target sequence refers to a target sequence that responds to one or members of the miR183 cluster (alternatively termed family), including miRs-183, -96 and - 182 (as described by Dambal, S. et al.
- the messenger RNA (mRNA) for the transgene is present in a cell type to which the expression cassette containing the miRNA is delivered, such that specific binding of the miRNA to the 3’ UTR miRNA target sequences results in mRNA silencing and cleavage, thereby reducing or eliminating transgene expression only in the cells that express the miRNA.
- mRNA messenger RNA
- the miRNA target sequence is at least 7 nucleotides to about 28 nucleotides in length, at least 8 nucleotides to about 28 nucleotides in length, 7 nucleotides to 28 nucleotides, 8 nucleotides to 18 nucleotides, 12 nucleotides to 28 nucleotides in length, about 20 to about 26 nucleotides, about 22 nucleotides, about 24 nucleotides, or about 26 nucleotides, and contains at least one consecutive region (e.g., 7 or 8 nucleotides) which is complementary to the miRNA seed sequence.
- at least one consecutive region e.g., 7 or 8 nucleotides
- the target sequence comprises a sequence with exact complementarity (100%) or partial complementarity to the miRNA seed sequence with some mismatches. In certain embodiments, the target sequence comprises at least 7 to 8 nucleotides which are 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence consists of a sequence which is 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence contains multiple copies (e.g., two or three copies) of the sequence which is 100% complementary to the seed sequence. In certain embodiments, the region of 100% complementarity comprises at least 30% of the length of the target sequence. In certain embodiments, the remainder of the target sequence has at least about 80 % to about 99% complementarity to the miRNA. In certain embodiments, in an expression cassette containing a DNA positive strand, the miRNA target sequence is the reverse complement of the miRNA.
- the miRNA target sequence for the at least first and/or at least second miRNA target sequence for the expression cassette mRNA or DNA positive strand is selected from (i) AGTGAATTCTACCAGTGCCATA (miR183, SEQ ID NO: 11); or (ii) AGTGTGAGTTCTACCATTGCCAAA (miR182, SEQ ID NO: 13). In other embodiments, AGGGATTCCTGGGAAAACTGGAC (SEQ ID NO: 14) is selected.
- the vector genome or expression cassette contains at least one miRNA target sequence that is a miR-183 target sequence.
- the vector genome or expression cassette contains an miR- 183 target sequence that includes AGTGAATTCTACCAGTGCCATA (SEQ ID NO: 11), where the sequence complementary to the miR- 183 seed sequence is GTGCCAT.
- the vector genome or expression cassette contains more than one copy (e.g., two or three copies) of a sequence that is 100% complementary to the miR- 183 seed sequence.
- a miR- 183 target sequence is about 7 nucleotides to about 28 nucleotides in length and includes at least one region that is at least 100% complementary to the miR- 183 seed sequence.
- a miR- 183 target sequence contains a sequence with partial complementarity to SEQ ID NO: 11 and, thus, when aligned to SEQ ID NO: 11, there are one or more mismatches.
- a miR- 183 target sequence comprises a sequence having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches when aligned to SEQ ID NO: 11, where the mismatches may be non-contiguous.
- a miR- 183 target sequence includes a region of 100% complementarity which also comprises at least 30% of the length of the miR- 183 target sequence.
- the region of 100% complementarity includes a sequence with 100% complementarity to the miR- 183 seed sequence.
- the remainder of a miR- 183 target sequence has at least about 80% to about 99% complementarity to miR- 183.
- the expression cassette or vector genome includes a miR- 183 target sequence that comprises a truncated SEQ ID NO: 11, i.e., a sequence that lacks at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at either or both the 5’ or 3’ ends of SEQ ID NO: 11.
- the expression cassette or vector genome comprises a transgene and one miR- 183 target sequence.
- the expression cassette or vector genome comprises at least two, three or four miR-183 target sequences, (i) AGTGAATTCTACCAGTGCCATA (miR183, SEQ ID NO: 11).;
- the vector genome or expression cassette contains at least one miRNA target sequence that is a miR- 182 target sequence. In certain embodiments, the vector genome or expression cassette contains an miR- 182 target sequence that includes AGTGTGAGTTCTACCATTGCCAAA (SEQ ID NO: 13). In certain embodiments, the vector genome or expression cassette contains more than one copy (e.g., two or three copies) of a sequence that is 100% complementary to the miR- 182 seed sequence. In certain embodiments, a miR- 182 target sequence is about 7 nucleotides to about 28 nucleotides in length and includes at least one region that is at least 100% complementary to the miR- 182 seed sequence.
- a miR-182 target sequence contains a sequence with partial complementarity to SEQ ID NO: 13 and, thus, when aligned to SEQ ID NO: 13, there are one or more mismatches.
- a miR-183 target sequence comprises a sequence having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches when aligned to SEQ ID NO: 13, where the mismatches may be non-contiguous.
- a miR-182 target sequence includes a region of 100% complementarity which also comprises at least 30% of the length of the miR-182 target sequence. In certain embodiments, the region of 100% complementarity includes a sequence with 100% complementarity to the miR-182 seed sequence.
- the remainder of a miR-182 target sequence has at least about 80% to about 99% complementarity to miR-182.
- the expression cassette or vector genome includes a miR-182 target sequence that comprises a truncated SEQ ID NO: 13, i.e., a sequence that lacks at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at either or both the 5’ or 3’ ends of SEQ ID NO: 13.
- the expression cassette or vector genome comprises a transgene and one miR- 182 target sequence.
- the expression cassette or vector genome comprises at least two, three or four miR- 182 target sequences.
- tandem repeats is used herein to refer to the presence of two or more consecutive miRNA target sequences. These miRNA target sequences may be continuous, i.e., located directly after one another such that the 3’ end of one is directly upstream of the 5’ end of the next with no intervening sequences, or vice versa. In another embodiment, two or more of the miRNA target sequences are separated by a short spacer sequence.
- spacer is any selected nucleic acid sequence, e.g., of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides in length which is located between two or more consecutive miRNA target sequences.
- the spacer is 1 to 8 nucleotides in length, 2 to 7 nucleotides in length, 3 to 6 nucleotides in length, four nucleotides in length, 4 to 9 nucleotides, 3 to 7 nucleotides, or values which are longer.
- a spacer is a non-coding sequence.
- the spacer may be of four (4) nucleotides.
- the spacer is GGAT.
- the spacer is six (6) nucleotides.
- the spacer is CACGTG or GCATGC.
- the tandem repeats contain two, three, four or more of the same miRNA target sequence. In certain embodiments, the tandem repeats contain at least two different miRNA target sequences, at least three different miRNA target sequences, or at least four different miRNA target sequences, etc. In certain embodiments, the tandem repeats may contain two or three of the same miRNA target sequence and a fourth miRNA target sequence which is different.
- a 3’ UTR may contain a tandem repeat immediately downstream of the transgene, UTR sequences, and two or more tandem repeats closer to the 3’ end of the UTR.
- the 5’ UTR may contain one, two or more miRNA target sequences.
- the 3’ may contain tandem repeats and the 5’ UTR may contain at least one miRNA target sequence.
- the expression cassette contains two, three, four or more tandem repeats which start within about 0 to 20 nucleotides of the stop codon for the transgene. In other embodiments, the expression cassette contains the miRNA tandem repeats at least 100 to about 4000 nucleotides from the stop codon for the transgene.
- CDKL5 or hCDKL5 refers to isoform 1, unless otherwise specified.
- Isoforms 2-4 may be specified as: CDKL5-2GS or hCDKL5-2GS, CDKL5-3GS or hCDKL5-3GS, and CDKL5-4GS or hCDKL5-4GS.
- Expression cassettes and vector genomes with these isoforms may be constructed as described for isoform 1.
- the Clade F AAV capsid is selected from an AAVhu68 capsid, an AAV9 capsid, an AAVhu31 capsid, an AAVhu32 capsid, or an engineered variant of one of these capsids.
- Nucleic acid sequences encoding AAVhu68 capsid protein are utilized in the examples below for production of an AAV.hCDKL5 recombinant AAV (rAAV) carrying the vector genome. Additional details relating to AAVhu68 re provided in WO 2018/160582, and US 2015/0079038, each of which is incorporated herein by reference in its entirety.
- the Clade F vectors described herein are well suited for delivery of the vector genome comprising the hCDKL5 coding sequence to cells within the central nervous system, including brain, hippocampus, motor cortex, cerebellum, and motor neurons. These vectors may be used for targeting other cells within the central nervous system (CNS) and certain other tissues and cells outside the CNS.
- CNS central nervous system
- the AAV capsid for the compositions and methods described herein is chosen based on the target cell.
- the AAV capsid transduces a CNS cell and/or a PNS cell.
- the AAV capsid is selected from a cy02 capsid, a rh43 capsid, an AAV8 capsid, a rhOl capsid, an AAV9 capsid, an rh8 capsid, a rhlO capsid, a bbOl capsid, a hu37 capsid, a rh02 capsid, a rh20 capsid, a rh39 capsid, a rh64 capsid, an AAV6 capsid, an AAV1 capsid, a hu44 capsid, a hu48 capsid, a cy05 capsid a hul 1 capsid, a
- the AAV capsid is a Clade F capsid, such as AAV9 capsid, AAVhu68 capsid, hu31 capsid, hu32 capsid, or a variation thereof. See, e.g., WO 2005/033321 published April 14, 2015, WO 2018/160582, and US 2015/0079038, each of which is incorporated herein by reference in its entirety.
- the AAV capsid is a non-clade F capsid, for example a Clade A, B, C, D, or E capsid.
- the non-Clade F capsid is an AAV 1 or a variation thereof.
- the AAV capsid transduces a target cell other than the nervous system cells.
- the AAV capsid is a Clade A capsid (e.g., AAV1, AAV6, AAVrh91), a Clade B capsid (e.g., AAV 2), a Clade C capsid (e.g., hu53), a Clade D capsid (e.g., AAV7), or a Clade E capsid (e.g., rhlO).
- the AAV capsid is a Clade A capsid, such as AAVrh91 capsid (nucleic acid sequence of SEQ ID NOs: 33 and 35).
- the AAV capsid is a AAVhu68 capsid, or an AAVrh91 capsid.
- the AAVhu68 capsid is produced from a nucleic acid sequence encoding amino acid sequence of SEQ ID NO: 61.
- the AAVhu68 capsid comprises: (i) AAVhu68 vpl proteins, AAVhu68 vp2 proteins, and AAVhu68 vp3 proteins produced from a nucleic acid sequence encoding SEQ ID NO: 61; or (ii) heterogenous populations of AAVhu68 vpl, AAVhu68 vp2 and AAVhu68 vp3 proteins, wherein the AAVhu68 vpl, AAVhu68 vp2 and AAV hu68 vp3 proteins comprise at least 50% to 100% deamidated asparagines (N) in asparagine - glycine pairs at each of positions 57, 329, 452, 512, relative to the amino acids in SEQ ID NO: 61, wherein the deamidated asparagines are deamidated to aspartic acid, isoaspartic acid, an interconverting aspartic acid/isoaspartic acid pair, or combinations thereof, as determined
- the nucleic acid sequence encoding AAVhu68 vpl protein is SEQ ID NO: 57, or a sequence at least 80% to at least 99% identical to SEQ ID NO: 57 which encodes the amino acid sequence of SEQ ID NO: 61; optionally wherein the nucleic acid sequence is at least 80% to 97% identical to SEQ ID NO: 57. See, e.g., WO 2018/160582 and WO2019/ 169004 which are incorporated by reference herein in its entirety.
- the term “clade” as it relates to groups of AAV refers to a group of AAV which are phylogenetically related to one another as determined using a Neighbor- Joining algorithm by a bootstrap value of at least 75% (of at least 1000 replicates) and a Poisson correction distance measurement of no more than 0.05, based on alignment of the AAV vpl amino acid sequence.
- the Neighbor-Joining algorithm has been described in the literature. See, e.g., M. Nei and S. Kumar, Molecular Evolution and Phylogenetics (Oxford University Press, New York (2000). Computer programs are available that can be used to implement this algorithm. For example, the MEGA v2.
- a rAAV is composed of an AAV capsid and a vector genome.
- An AAV capsid is an assembly of a heterogeneous population of vpl, a heterogeneous population of vp2, and a heterogeneous population of vp3 proteins.
- the term “heterogeneous” or any grammatical variation thereof refers to a population consisting of elements that are not the same, for example, having vpl, vp2 or vp3 monomers (proteins) with different modified amino acid sequences.
- heterogeneous or any grammatical variation thereof refers to a population consisting of elements that are not the same, for example, having vpl, vp2 or vp3 monomers (proteins) with different modified amino acid sequences.
- heterogeneous population as used in connection with vpl, vp2 and vp3 proteins (alternatively termed isoforms), refers to differences in the amino acid sequence of the vpl, vp2 and vp3 proteins within a capsid.
- the AAV capsid contains subpopulations within the vp 1 proteins, within the vp2 proteins and within the vp3 proteins which have modifications from the predicted amino acid residues. These subpopulations include, at a minimum, certain deamidated asparagine (N or Asn) residues.
- certain subpopulations comprise at least one, two, three or four highly deamidated asparagines (N) positions in asparagine - glycine pairs and optionally further comprising other deamidated amino acids, wherein the deamidation results in an amino acid change and other optional modifications.
- AAV capsids are provided which have a heterogeneous population of AAV capsid isoforms (i.e., VP 1, VP2, VP3) which contain multiple highly deamidated “NG” positions.
- the highly deamidated positions are in the locations identified below, with reference to the predicted full-length VP 1 amino acid sequence.
- the capsid gene is modified such that the referenced “NG” is ablated and a mutant “NG” is engineered into another position.
- target cell and “target tissue” can refer to any cell or tissue which is intended to be transduced by the subject AAV vector.
- the term may refer to any one or more of muscle, liver, lung, airway epithelium, central nervous system, neurons, eye (ocular cells), or heart.
- the term “vector genome” refers to a nucleic acid molecule which is packaged in a viral capsid, for example, an AAV capsid, and is capable of being delivered to a host cell or a cell in a patient.
- the vector genome is an expression cassette having inverted terminal repeat (ITR) sequences necessary for packaging the vector genome into the AAV capsid at the extreme 5 ’ and 3 ’ end and containing therebetween a CDLK5 gene as described herein operably linked to sequences which direct expression thereof.
- a vector genome may comprise at a minimum from 5’ to 3’, an AAV 5 ’ ITR, coding sequence(s), and an AAV 3 ’ ITR.
- the ITRs are from AAV2, a different source AAV than the capsid, or other than full-length ITRs may be selected. In certain embodiments, the ITRs are from the same AAV source as the AAV which provides the rep function during production or a transcomplementing AAV. Further, other ITRs may be used.
- the vector genome is sometimes referred to herein as the “minigene”.
- the term “host cell” may refer to the packaging cell line in which the rAAV is produced from the plasmid. In the alternative, the term “host cell” may refer to the target cell in which expression of the transgene is desired.
- a rAAV which has an AAV capsid which targets the desired cells and a vector genome which comprises, at a minimum, AAV ITRs required to package the vector genome into the capsid, a hCDKL5 coding sequence and regulatory sequences which direct expression therefor.
- the vector genome is a single-stranded AAV vector genome.
- a rAAV vector may be utilized in the invention which contains self-complementary (sc) AAV vector genome.
- the AAV sequences of the vector typically comprise the cis-acting 5' and 3' inverted terminal repeat (ITR) sequences (See, e.g., B. J. Carter, in “Handbook of Parvoviruses”, ed., P. Tijsser, CRC Press, pp. 155 168 (1990)).
- the ITR sequences are about 145 base pairs (bp) in length.
- substantially the entire sequences encoding the ITRs are used in the molecule, although some degree of minor modification of these sequences is permissible.
- the ability to modify these ITR sequences is within the skill of the art. (See, e.g., texts such as Sambrook et al, “Molecular Cloning.
- An example of such a molecule employed in the present invention is a “cis-acting” plasmid containing the transgene, in which the selected transgene sequence and associated regulatory elements are flanked by the 5' and 3' AAV ITR sequences.
- the ITRs are from an AAV different than that supplying a capsid.
- the ITR sequences are from AAV2.
- a shortened version of the 5’ ITR, termed AITR has been described in which the D-sequence and terminal resolution site (trs) are deleted.
- the full-length AAV 5’ and 3’ ITRs are used.
- the vector genome includes a shortened AAV2 ITR of 130 base pairs, wherein the external A elements is deleted. The shortened ITR is reverted back to the wild-type length of 145 base pairs during vector DNA amplification using the internal A element as a template.
- the 5’ ITR comprises nucleic acid sequence of SEQ ID NO: 51.
- the 3 ITR comprises nucleic acid sequence of SEQ ID NO: 54.
- ITRs from other AAV sources may be selected. Where the source of the ITRs is from AAV2 and the AAV capsid is from another AAV source, the resulting vector may be termed pseudotyped. However, other configurations of these elements may be suitable.
- vector genomes are constructed which comprise a 5 ’ AAV ITR - promoter - optional enhancer - optional intron - hCDKL5 coding sequence - polyA - 3’ ITR. In certain embodiments, vector genomes are constructed which comprise a 5’ AAV ITR - promoter - optional enhancer - optional intron - hCDKL5 coding sequence - optionally repeating miR (de)targeting sequences - polyA - 3’ ITR. In certain embodiments, vector genomes are constructed which comprise a 5 ’ AAV ITR - promoter - optional intron - hCDKL5 coding sequence - optional enhancer - polyA - 3 ’ ITR.
- vector genomes are constructed which comprise a 5 ’ AAV ITR - promoter - optional enhancer - optional intron - hCDKL5 coding sequence - optional enhancer - optionally repeating miR (de)targetting sequences - polyA - 3’ ITR.
- the ITRs are from AAV2.
- more than one promoter is present.
- the enhancer is present in the vector genome.
- more than one enhancer is present.
- an intron is present in the vector genome.
- the enhancer and intron are present.
- the polyA is an SV40 poly A (i.e., a polyadenylation (PolyA) signal derived from Simian Virus 40 (SV40) late genes).
- the polyA is a rabbit beta-globin (RBG) poly A.
- the vector genome comprises, at a minimum: a 5’ AAV ITR - hSyn promoter - hCDKL5 coding sequence - poly A - 3’ ITR.
- the vector genome comprises, at a minimum, a 5’ AAV ITR - CB7 promoter - hCDKL5 coding sequence - RBG poly A - 3 ’ ITR.
- the drg detargeting sequences are one, two, three, four or more miR183 sequences as described herein and are included in the expression cassette.
- the hCDKL5 coding sequence is for CDKL5.
- the hCDKL5 coding sequence is for CDKL5-2GS.
- the hCDKL5 coding sequence is for CDKL5-3GS.
- the hCDKL5 coding sequence is for CDKL5-4GS.
- one or more of these vector genomes includes a WPRE element.
- a vector genome or a rAAV comprising the vector genome is illustrated herein as AAV.promoter (optional). Kozak (optional). intron (optional). CDKL5 coding sequence (e.g., hCDKL5, hCDKL5co, CDKL5, CDKL5co). miRNA (optional). poly A(optional). Staffer (optional).
- a rAAV is illustrated herein as AAV capsid.promoter (optional). Kozak (optional). intron (optional). CDKL5 coding sequence. miRNA (optional).polyA (optional). Staffer (optional).
- one or more of these vector genomes includes a WPRE element.
- the vector genome comprises at a minimum a 5 ’ AAV ITR - Ubiquitin C promoter - hCDKL5 coding sequence - RBG poly A - 3’ ITR. In certain embodiments, the vector genome comprises nucleic acid sequence of SEQ ID NO: 58. In certain embodiments, the vector genome comprises at a minimum a 5 ’ AAV ITR - Ubiquitin C promoter - hCDKL5 coding sequence - one, two, three, four or more miR183 sequences - RBG poly A - 3 ’ ITR. In certain embodiments, the vector genome comprises nucleic acid sequence of SEQ ID NO: 29.
- the vector genome comprises nucleic acid sequence of SEQ ID NO: 49. In certain embodiments, the vector genome comprises at a minimum a 5’ AAV ITR - Chicken-beta actin hybrid promoter - hCDKL5 coding sequence - one, two, three, four or more miR183 sequences - RBG poly A - 3’ ITR. In certain embodiments, the vector genome comprises nucleic acid sequence of SEQ ID NO: 31. Optionally, one or more of these vector genomes includes a WPRE element.
- an rAAV production system useful for producing a rAAV as described herein.
- the production system comprises a cell culture comprising (a) a nucleic acid sequence encoding an AAV capsid protein; (b) the vector genome; and (c) sufficient AAV rep functions and helper functions to permit packaging of the vector genome into the AAV capsid.
- the vector genome is SEQ ID NOs: 1, 3, 5, 7, 9, 29 or 31.
- the cell culture is a human embryonic kidney 293 cell culture.
- the AAV rep is from a different AAV. In certain embodiments, wherein the AAV rep is from AAV2.
- the AAV2 rep is encoded by the nucleic acid sequence of SEQ ID NO: 56.
- the AAV rep coding sequence and cap genes are on the same nucleic acid molecule, wherein there is optionally a spacer between the rep sequence and cap gene.
- the spacer is atgacttaaaccaggt (SEQ ID NO: 15).
- the vector genomes can be carried on any suitable vector, e.g., a plasmid, which is delivered to a packaging host cell.
- a suitable vector e.g., a plasmid
- the plasmids useful in this invention may be engineered such that they are suitable for replication and packaging in vitro in prokaryotic cells, insect cells, mammalian cells, among others. Suitable transfection techniques and packaging host cells are known and/or can be readily designed by one of skill in the art.
- a gene therapy vector refers to a rAAV as described herein, which is suitable for use in treating a patient.
- the ITRs are the only AAV components required in cis in the same construct as the nucleic acid molecule containing the gene.
- the cap and rep genes can be supplied in trans.
- the manufacturing process for rAAV involves method as described in US Provisional Patent Application No. 63/371,597, filed August 16, 2022, and US Provisional Patent Application No. 63/371,592, filed August 16, 2022, which are incorporated herein by reference in its entirety.
- the selected genetic element may be delivered to an AAV packaging cell by any suitable method, including transfection, electroporation, liposome delivery, membrane fusion techniques, high velocity DNA-coated pellets, viral infection and protoplast fusion.
- Stable AAV packaging cells can also be made.
- the methods used to make such constructs are known to those with skill in nucleic acid manipulation and include genetic engineering, recombinant engineering, and synthetic techniques. See, e.g., Molecular Cloning: A Laboratory Manual, ed. Green and Sambrook, Cold Spring Harbor Press, Cold Spring Harbor, NY (2012).
- AAV intermediate or “AAV vector intermediate” refers to an assembled rAAV capsid which lacks the desired genomic sequences packaged therein. These may also be termed an “empty” capsid. Such a capsid may contain no detectable genomic sequences of an expression cassette, or only partially packaged genomic sequences which are insufficient to achieve expression of the gene product. These empty capsids are nonfunctional to transfer the gene of interest to a host cell.
- the recombinant adeno-associated virus (AAV) described herein may be generated using techniques which are known. See, e.g., WO 2003/042397; WO 2005/033321, WO 2006/110689; US 7588772 B2.
- Such a method involves culturing a host cell which contains a nucleic acid sequence encoding an AAV capsid protein; a functional rep gene; an expression cassette composed of, at a minimum, AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the expression cassette into the AAV capsid protein.
- ITRs AAV inverted terminal repeats
- Methods of generating the capsid, coding sequences therefor, and methods for production of rAAV viral vectors have been described. See, e.g., Gao, et al, Proc. Natl. Acad. Sci. U.S.A. 100 (10), 6081-6086 (2003) and US 2013/0045186A1.
- a production cell culture useful for producing a recombinant AAVhu68 or AAVrh91 contains a nucleic acid which expresses the AAVhu68 capsid protein in the host cell; a nucleic acid molecule suitable for packaging into the AAVhu68 capsid, e.g., a vector genome which contains AAV ITRs and a non-AAV nucleic acid sequence encoding a gene operably linked to regulatory sequences which direct expression of the gene in a host cell; and sufficient AAV rep functions and adenovirus helper functions to permit packaging of the vector genome into the recombinant AAVhu68, or AAVrh91 capsid.
- the cell culture is composed of mammalian cells (e.g., human embryonic kidney 293 cells, among others) or insect cells (e.g., Spodoptera frugiperda (Sf9) cells).
- mammalian cells e.g., human embryonic kidney 293 cells, among others
- insect cells e.g., Spodoptera frugiperda (Sf9) cells.
- baculovirus provides the helper functions necessary for packaging the vector genome into the recombinant AAVhu68, or AAVrh91 capsid.
- the rep functions are provided by an AAV other than hu68.
- at least parts of the rep functions are from AAVhu68, or AAVrh91.
- the rep protein is a heterologous rep protein other than AAVhu68rep, for example but not limited to, AAV1 rep protein, AAV2 rep protein, AAV3 rep protein, AAV4 rep protein, AAV5 rep protein, AAV6 rep protein, AAV7 rep protein, AAV 8 rep protein; or rep 78, rep 68, rep 52, rep 40, rep68/78 and rep40/52; or a fragment thereof; or another source. Any of these AAVhu68 or mutant AAV capsid sequences may be under the control of exogenous regulatory control sequences which direct expression thereof in a host cell.
- cells are manufactured in a suitable cell culture (e.g., HEK 293 or Sf9) or suspension.
- Methods for manufacturing the gene therapy vectors described herein include methods well known in the art such as generation of plasmid DNA used for production of the gene therapy vectors, generation of the vectors, and purification of the vectors.
- the gene therapy vector is an AAV vector and the plasmids generated are an AAV cis-plasmid encoding the AAV vector genome and the gene of interest, an AAV trans-plasmid containing AAV rep and cap genes, and an adenovirus helper plasmid.
- the vector generation process can include method steps such as initiation of cell culture, passage of cells, seeding of cells, transfection of cells with the plasmid DNA, posttransfection medium exchange to serum free medium, and the harvest of vector-containing cells and culture media.
- the harvested vector-containing cells and culture media are referred to herein as crude cell harvest.
- the gene therapy vectors are introduced into insect cells by infection with baculovirus-based vectors.
- Zhang et al., 2009 Adenovirus-adeno- associated virus hybrid for large-scale recombinant adeno-associated virus production, Human Gene Therapy 20:922-929, the contents of each of which is incorporated herein by reference in its entirety.
- the crude cell harvest may thereafter be subject method steps such as concentration of the vector harvest, diafiltration of the vector harvest, microfluidization of the vector harvest, nuclease digestion of the vector harvest, filtration of microfluidized intermediate, crude purification by chromatography, crude purification by ultracentrifugation, buffer exchange by tangential flow filtration, and/or formulation and filtration to prepare bulk vector.
- a two-step affinity chromatography purification at high salt concentration followed anion exchange resin chromatography are used to purify the vector drug product and to remove empty capsids. These methods are described in more detail in WO 2017/160360filed December 9, 2016 and its priority documents, US Patent Application Nos. 62/322,071, filed April 13, 2016 and 62/226,357, filed December 11, 2015 and entitled “Scalable Purification Method for AAV9”, which is incorporated by reference herein.
- the purification of vector drug product include those described in more detail in W02017/100674, filed December 9, 2016, and its priority documents, US Provisional Patent Application Nos. 62/266,351. Filed December 9, 2015, and 62/322,083, filed April 13, 2016 and titled “Scalable Purification Method for AAV1”, which is incorporated herein by reference.
- GC genome copies
- the number of particles (pt) per 20 pL loaded is then multiplied by 50 to give particles (pt) /mL.
- Pt/mL divided by GC/mL gives the ratio of particles to genome copies (pt/GC).
- Pt/mL-GC/mL gives empty pt/mL.
- Empty pt/mL divided by pt/mL and x 100 gives the percentage of empty particles.
- the methods include subjecting the treated AAV stock to SDS -polyacrylamide gel electrophoresis, consisting of any gel capable of separating the three capsid proteins, for example, a gradient gel containing 3-8% Tris-acetate in the buffer, then running the gel until sample material is separated, and blotting the gel onto nylon or nitrocellulose membranes, preferably nylon.
- Anti-AAV capsid antibodies are then used as the primary antibodies that bind to denatured capsid proteins, preferably an anti-AAV capsid monoclonal antibody, most preferably the Bl anti-AAV-2 monoclonal antibody (Wobus et al., J. Virol. (2000) 74:9281- 9293).
- a secondary antibody is then used, one that binds to the primary antibody and contains a means for detecting binding with the primary antibody, more preferably an anti- IgG antibody containing a detection molecule covalently bound to it, most preferably a sheep anti-mouse IgG antibody covalently linked to horseradish peroxidase.
- a method for detecting binding is used to semi-quantitatively determine binding between the primary and secondary antibodies, preferably a detection method capable of detecting radioactive isotope emissions, electromagnetic radiation, or colorimetric changes, most preferably a chemiluminescence detection kit.
- a detection method capable of detecting radioactive isotope emissions, electromagnetic radiation, or colorimetric changes, most preferably a chemiluminescence detection kit.
- samples from column fractions can be taken and heated in SDS-PAGE loading buffer containing reducing agent (e.g., DTT), and capsid proteins were resolved on pre-cast gradient polyacrylamide gels (e.g., Novex).
- Silver staining may be performed using SilverXpress (Invitrogen, CA) according to the manufacturer's instructions or other suitable staining method, i.e., SYPRO ruby or coomassie stains.
- the concentration of AAV vector genomes (vg) in column fractions can be measured by quantitative real time PCR (Q-PCR).
- Samples are diluted and digested with DNase I (or another suitable nuclease) to remove exogenous DNA. After inactivation of the nuclease, the samples are further diluted and amplified using primers and a TaqManTM fluorogenic probe specific for the DNA sequence between the primers. The number of cycles required to reach a defined level of fluorescence (threshold cycle, Ct) is measured for each sample on an Applied Biosystems Prism 7700 Sequence Detection System. Plasmid DNA containing identical sequences to that contained in the AAV vector is employed to generate a standard curve in the Q-PCR reaction. The cycle threshold (Ct) values obtained from the samples are used to determine vector genome titer by normalizing it to the Ct value of the plasmid standard curve. End-point assays based on the digital PCR can also be used.
- DNase I or another
- an optimized q-PCR method which utilizes a broad spectrum serine protease, e.g., proteinase K (such as is commercially available from Qiagen). More particularly, the optimized qPCR genome titer assay is similar to a standard assay, except that after the DNase I digestion, samples are diluted with proteinase K buffer and treated with proteinase K followed by heat inactivation. Suitably samples are diluted with proteinase K buffer in an amount equal to the sample size.
- the proteinase K buffer may be concentrated to 2 fold or higher. Typically, proteinase K treatment is about 0.2 mg/mL, but may be varied from 0. 1 mg/mL to about 1 mg/mL.
- the treatment step is generally conducted at about 55 °C for about 15 minutes, but may be performed at a lower temperature (e.g., about 37 °C to about 50 °C) over a longer time period (e.g., about 20 minutes to about 30 minutes), or a higher temperature (e.g., up to about 60 °C) for a shorter time period (e.g., about 5 to 10 minutes).
- heat inactivation is generally at about 95 °C for about 15 minutes, but the temperature may be lowered (e.g., about 70 to about 90 °C) and the time extended (e.g., about 20 minutes to about 30 minutes). Samples are then diluted (e.g., 1000 fold) and subjected to TaqMan analysis as described in the standard assay.
- droplet digital PCR may be used.
- ddPCR droplet digital PCR
- methods for determining single-stranded and self-complementary AAV vector genome titers by ddPCR have been described. See, e.g., M. Lock et al, Hu Gene Therapy Methods, Hum Gene Ther Methods. 2014 Apr;25(2): 115-25. doi: 10. 1089/hgtb.2013. 131. Epub 2014 Feb 14.
- the method for separating rAAVhu68 (or AAVrh91) particles having packaged genomic sequences from genome-deficient AAVhu68 (or AAVrh91) intermediates involves subjecting a suspension comprising recombinant AAVhu68 (or rh91 ) viral particles and AAVhu68 (or AAVrh91) capsid intermediates to fast performance liquid chromatography, wherein the AAVhu68 (or AAVrh91) viral particles and AAVhu68 intermediates are bound to a strong anion exchange resin equilibrated at a pH of about 10.2 (or about 9.8 for AAVrh91), and subjected to a salt gradient while monitoring eluate for ultraviolet absorbance at about 260 nanometers (nm) and about 280 nm.
- the pH may be in the range of about 10 to 10.4.
- the AAV full capsids are collected from a fraction which is eluted when the ratio of A260/A280 reaches an inflection point.
- the diafiltered product may be applied to an affinity resin (Life Technologies) that efficiently captures the AAVhu68 or AAVrh91 serotype. Under these ionic conditions, a significant percentage of residual cellular DNA and proteins flow through the column, while AAV particles are efficiently captured.
- the rAAV.hCDKL5 is suspended in a suitable physiologically compatible composition (e.g., a buffered saline).
- a suitable physiologically compatible composition e.g., a buffered saline
- This composition may be frozen for storage, later thawed and optionally diluted with a suitable diluent.
- the vector may be prepared as a composition which is suitable for delivery to a patient without proceeding through the freezing and thawing steps.
- NAb titer a measurement of how much neutralizing antibody (e.g., anti-AAV Nab) is produced which neutralizes the physiologic effect of its targeted epitope (e.g., an AAV).
- Anti-AAV NAb titers may be measured as described in, e.g., Calcedo, R., et al., Worldwide Epidemiology of Neutralizing Antibodies to Adeno- Associated Viruses. Journal of Infectious Diseases, 2009. 199(3): p. 381-390, which is incorporated by reference herein.
- sc refers to self-complementary.
- Self-complementary AAV refers a construct in which a coding region carried by a recombinant AAV nucleic acid sequence has been designed to form an intra-molecular double-stranded DNA template.
- dsDNA double stranded DNA
- a “replication-defective virus” or “viral vector” refers to a synthetic or artificial viral particle in which an expression cassette containing a gene of interest is packaged in a viral capsid or envelope, where any viral genomic sequences also packaged within the viral capsid or envelope are replication-deficient; i.e., they cannot generate progeny virions but retain the ability to infect target cells.
- the genome of the viral vector does not include genes encoding the enzymes required to replicate (the genome can be engineered to be "gutless" - containing only the gene of interest flanked by the signals required for amplification and packaging of the artificial genome), but these genes may be supplied during production. Therefore, it is deemed safe for use in gene therapy since replication and infection by progeny virions cannot occur except in the presence of the viral enzyme required for replication.
- rAAV particles are referred to as DNase resistant.
- DNase endonuclease
- other endo- and exo- nucleases may also be used in the purification steps described herein, to remove contaminating nucleic acids.
- Such nucleases may be selected to degrade single stranded DNA and/or double-stranded DNA, and RNA.
- Such steps may contain a single nuclease, or mixtures of nucleases directed to different targets, and may be endonucleases or exonucleases.
- nuclease-resistant indicates that the AAV capsid has fully assembled around the expression cassette which is designed to deliver a gene to a host cell and protects these packaged genomic sequences from degradation (digestion) during nuclease incubation steps designed to remove contaminating nucleic acids which may be present from the production process.
- the expression cassette comprises a nucleic acid sequence encoding a functional human cyclin dependent kinase like 5 (hCDKL5) under control of regulatory sequences which direct the hCDKL5 expression.
- hCDKL5 human cyclin dependent kinase like 5
- the hCDKL5- coding sequence encodes a hCDKL5 protein comprising an amino acid sequence of [MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKET TLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKV KSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYT EYVATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKV LGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPA DRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHR SNSKDIQNLSVGLPRADEGLPANESFLNGNLAGASLSPLHTK
- the hCDKL5-coding sequence encodes a hCDKL5-2GS protein comprising an amino acid sequence of [MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKET TLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKV KSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYT EYVATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKV LGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPA DRYLTEQCLNHPTFQTQRLLDRSPSRSAKRKPYHVESSTLSNRNQAGKSTALQSHHR SNSKDIQNLSVGLPRADEGLPANESFLNGNLAGASLSPLHTK
- the hCDKL5-coding sequence encodes a hCDKL5-4GS protein comprising an amino acid sequence of [MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKET TLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKV KSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYT EYVATRWYRSPELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKV LGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPA DRYLTEQCLNHPTFQTQRLLDRSPSRNQAGKSTALQSHHRSNSKDIQNLSVGLPRAD EGLPANESFLNGNLAGASLSPLHTKTYQASSQPGSTSKDLTNN
- the vector is a viral vector selected from a recombinant parvovirus, a recombinant lentivirus, a recombinant retrovirus, or a recombinant adenovirus; or a non-viral vector selected from naked DNA, naked RNA, an inorganic particle, a lipid particle, a polymer-based vector, or a chitosan-based formulation.
- the selected vector may be delivered by any suitable method, including transfection, electroporation, liposome delivery, membrane fusion techniques, high velocity DNA-coated pellets, viral infection and protoplast fusion.
- a “replication-defective virus” or “viral vector” refers to a synthetic or artificial viral particle in which an expression cassette containing a gene of interest is packaged in a viral capsid or envelope, where any viral genomic sequences also packaged within the viral capsid or envelope are replication-deficient; i.e., they cannot generate progeny virions but retain the ability to infect target cells.
- the genome of the viral vector does not include genes encoding the enzymes required to replicate (the genome can be engineered to be "gutless" - containing only the transgene of interest flanked by the signals required for amplification and packaging of the artificial genome), but these genes may be supplied during production.
- replication-defective viruses may be adeno-associated viruses (AAV), adenoviruses, lentiviruses (integrating or non-integrating), or another suitable virus source.
- AAV adeno-associated viruses
- adenoviruses adenoviruses
- lentiviruses integrating or non-integrating
- composition comprising an rAAV or a vector as described herein and an aqueous suspension media.
- the suspension is formulated for intravenous delivery, intrathecal administration, or intracerebroventricular administration.
- compositions containing at least one rAAV stock and an optional carrier, excipient and/or preservative are provided herein.
- a “stock” of rAAV refers to a population of rAAV. Despite heterogeneity in their capsid proteins due to deamidation, rAAV in a stock are expected to share an identical vector genome.
- a stock can include rAAV having capsids with, for example, heterogeneous deamidation patterns characteristic of the selected AAV capsid proteins and a selected production system. The stock may be produced from a single production system or pooled from multiple runs of the production system. A variety of production systems, including but not limited to those described herein, may be selected.
- carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- Supplementary active ingredients can also be incorporated into the compositions.
- pharmaceutically-acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a host.
- Delivery vehicles such as liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, may be used for the introduction of the compositions of the present invention into suitable host ceils.
- the rAA V vector delivered vector genomes may be formulated for delivery either encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle or the like.
- a composition in one embodiment, includes a final formulation suitable for delivery to a subject, e.g., is an aqueous liquid suspension buffered to a physiologically compatible pH and salt concentration.
- a final formulation suitable for delivery to a subject e.g., is an aqueous liquid suspension buffered to a physiologically compatible pH and salt concentration.
- one or more surfactants are present in the formulation.
- the composition may be transported as a concentrate which is diluted for administration to a subject.
- the composition may be lyophilized and reconstituted at the time of administration.
- a suitable surfactant, or combination of surfactants may be selected from among non-ionic surfactants that are nontoxic.
- a difunctional block copolymer surfactant terminating in primary hydroxyl groups is selected, e.g., such as Pluronic® F68 [BASF], also known as Poloxamer 188, which has a neutral pH, has an average molecular weight of 8400.
- BASF Pluronic® F68
- Poloxamer 188 also known as Poloxamer 188
- Other surfactants and other Poloxamers may be selected, i.e.
- nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (polypropylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (polyethylene oxide)), SOLUTOL HS 15 (Macrogol-15 Hydroxystearate), LABRASOL (Poly oxy capryllic glyceride), poly oxy 10 oleyl ether, TWEEN (polyoxyethylene sorbitan fatty acid esters), ethanol and polyethylene glycol.
- the formulation contains a poloxamer.
- Poloxamer 188 is selected.
- the surfactant may be present in an amount up to about 0.0005 % to about 0.001% (based on weight ratio, w/w %) of the suspension. In another embodiment, the surfactant may be present in an amount up to about 0.0005 % to about 0.001% (based on volume ratio, v/v %) of the suspension. In yet another embodiment, the surfactant may be present in an amount up to about 0.0005 % to about 0.001% of the suspension, wherein n % indicates n gram per 100 mL of the suspension.
- the composition includes a carrier, diluent, excipient and/or adjuvant.
- Suitable carriers may be readily selected by one of skill in the art in view of the indication for which the transfer virus is directed.
- one suitable carrier includes saline, which may be formulated with a variety of buffering solutions (e.g., phosphate buffered saline).
- Other exemplary carriers include sterile saline, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, and water.
- the buffer/carrier should include a component that prevents the rAAV, from sticking to the infusion tubing but does not interfere with the rAAV binding activity in vivo.
- a suitable surfactant, or combination of surfactants may be selected from among non-ionic surfactants that are nontoxic.
- a difunctional block copolymer surfactant terminating in primary hydroxyl groups is selected, e.g., such as Poloxamer 188 (also known under the commercial names Pluronic® F68 [BASF], Lutrol® F68, Synperonic® F68, Kolliphor® P188) which has a neutral pH, has an average molecular weight of 8400.
- Poloxamers may be selected, i.e., nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (polypropylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (polyethylene oxide)), SOLUTOL HS 15 (Macrogol- 15 Hydroxystearate), LABRASOL (Polyoxy capryllic glyceride), polyoxy -oleyl ether, TWEEN (polyoxyethylene sorbitan fatty acid esters), ethanol and polyethylene glycol.
- the formulation contains a poloxamer.
- the composition containing the rAAV.hCDKL5 is delivered at a pH in the range of 6.8 to 8, or 7.2 to 7.8, or 7.5 to 8.
- a pH above 7.5 may be desired, e.g., 7.5 to 8, or 7.8.
- the formulation may contain a buffered saline aqueous solution not comprising sodium bicarbonate.
- a buffered saline aqueous solution comprising one or more of sodium phosphate, sodium chloride, potassium chloride, calcium chloride, magnesium chloride and mixtures thereof, in water, such as a Harvard’s buffer.
- the aqueous solution may further contain Kolliphor® Pl 88, a poloxamer which is commercially available from BASF which was formerly sold under the trade name Lutrol® F68.
- the aqueous solution may have a pH of 7.2.
- the formulation may contain a buffered saline aqueous solution comprising 1 mM Sodium Phosphate (NasPCfi), 150 mM sodium chloride (NaCl), 3mM potassium chloride (KC1), 1.4 mM calcium chloride (CaCh), 0.8 mM magnesium chloride (MgCh), and 0.001% poloxamer (e.g., Kolliphor®) 188, pH 7.2. See, e.g., harvardapparatus.com/harvard-apparatus-perfusion-fluid.html.
- Harvard’s buffer is preferred due to better pH stability observed with Harvard’s buffer.
- the formulation buffer is artificial CSF with Pluronic F68.
- the formulation may contain one or more permeation enhancers.
- suitable permeation enhancers may include, e.g., mannitol, sodium glycocholate, sodium taurocholate, sodium deoxycholate, sodium salicylate, sodium caprylate, sodium caprate, sodium lauryl sulfate, polyoxyethylene-9-laurel ether, or EDTA.
- compositions of the invention may contain, in addition to the rAAV and carrier(s), other conventional pharmaceutical ingredients, such as preservatives, or chemical stabilizers.
- suitable exemplary preservatives include chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, and parachlorophenol.
- Suitable chemical stabilizers include gelatin and albumin.
- compositions according to the present invention may comprise a pharmaceutically acceptable carrier, such as defined above.
- the compositions described herein comprise an effective amount of one or more AAV suspended in a pharmaceutically suitable carrier and/or admixed with suitable excipients designed for delivery to the subject via injection, osmotic pump, intrathecal catheter, or for delivery by another device or route.
- the om maya reservoir is used for delivery.
- the composition is formulated for intrathecal delivery.
- the composition is formulated for intravenous (iv) delivery.
- a method of treating CDD comprising administrating an effective amount of an rAAV or a vector as described herein to a subject in need thereof.
- an “effective amount” herein is the amount which achieves amelioration of CDD symptoms and/or delayed CDD progression.
- the vectors are administered in sufficient amounts to transfect the cells and to provide sufficient levels of gene transfer and expression to provide a therapeutic benefit without undue adverse effects, or with medically acceptable physiological effects, which can be determined by those skilled in the medical arts.
- Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to a desired organ (e.g., brain, CSF, the liver (optionally via the hepatic artery), lung, heart, eye, kidney,), oral, inhalation, intranasal, intrathecal, intratracheal, intraarterial, intraocular, intravenous, intramuscular, subcutaneous, intradermal, intraparenchymal, intracerebroventricular, intrathecal, ICM, lumbar puncture and other parenteral routes of administration. Routes of administration may be combined, if desired.
- Dosages of the viral vector depend primarily on factors such as the condition being treated, the age, weight and health of the patient, and can thus vary among patients.
- a therapeutically effective human dosage of the viral vector is generally in the range of from about 25 to about 1000 microliters to about 100 mL of solution containing concentrations of from about 1 x 10 9 to 1 x 10 16 vector genome copies.
- a volume of about 1 mL to about 15 mL, or about 2.5 mL to about 10 mL, or about 5 mL suspension is delivered.
- a volume of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15 mL suspension is delivered.
- a dose of about 8.9 x 10 12 to 2.7 x 10 14 GC total is administered in this volume.
- a dose of about 1.1 xlO 10 GC/g brain mass to about 3.3 x 10 11 GC/g brain mass is administered in this volume.
- the dosage is adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
- the levels of expression of the transgene product can be monitored to determine the frequency of dosage resulting in viral vectors, preferably AAV vectors containing the minigene.
- dosage regimens similar to those described for therapeutic purposes may be utilized for immunization using the compositions of the invention.
- the replication-defective virus compositions can be formulated in dosage units to contain an amount of replication-defective virus that is in the range of about 1.0 x 10 9 GC to about 1.0 x 10 16 GC (to treat an subject) including all integers or fractional amounts within the range, and preferably 1.0 x 10 12 GC to 1.0 x 10 14 GC for a human patient.
- the compositions are formulated to contain at least IxlO 9 , 2xl0 9 , 3xl0 9 , 4xl0 9 , 5xl0 9 , 6xl0 9 , 7xl0 9 , 8xl0 9 , or 9xlO 9 GC per dose including all integers or fractional amounts within the range.
- compositions are formulated to contain at least IxlO 10 , 2xlO 10 , 3xl0 10 , 4xlO 10 , 5xl0 10 , 6xlO 10 , 7xlO 10 , 8xl0 10 , or 9xlO 10 GC per dose including all integers or fractional amounts within the range.
- the compositions are formulated to contain at least IxlO 11 , 2xlO n , 3xl0 n , 4xlO n , 5xl0 n , 6xlO n , 7xlO n , 8xl0 n , or 9xlO n GC per dose including all integers or fractional amounts within the range.
- compositions are formulated to contain at least IxlO 12 , 2xl0 12 , 3xl0 12 , 4xl0 12 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per dose including all integers or fractional amounts within the range.
- the compositions are formulated to contain at least IxlO 13 , 2xl0 13 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per dose including all integers or fractional amounts within the range.
- compositions are formulated to contain at least IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per dose including all integers or fractional amounts within the range.
- the compositions are formulated to contain at least IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per dose including all integers or fractional amounts within the range.
- the dose can range from IxlO 10 to about IxlO 15 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 9 , 2xl0 9 , 3xl0 9 , 4xl0 9 , 5xl0 9 , 6xl0 9 , 7xl0 9 , 8xl0 9 , or 9xl0 9 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 10 , 2xlO 10 , 3xlO 10 , 4xlO 10 , 5xlO 10 , 6xlO 10 , 7xlO 10 , 8xlO 10 , or 9xlO 10 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 11 , 2xlO n , 3xl0 n , 4xlO n , 5xl0 n , 6xlO n , 7xlO n , 8xl0 n , or 9xlO n GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 12 , 2xl0 12 , 3xl0 12 , 4xl0 12 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 13 , 2xl0 13 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per kg body weight including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per kg body weight including all integers or fractional amounts within the range.
- the dose is scaled by brain mass, which provides an approximation of the size of the CSF compartment.
- dose conversions are based on a brain mass of 0. 15 g for a neonatal mouse (Gu et al., 2012), 90 g for a juvenile NHP (Herndon et al., 1998), 610 g from a 6-8-month infant, 780 g for an 8-12-month infant, and 960 g for a >12-month infant (Dekaban, 1978).
- Estimated brain weights for each age range for human infants were derived from the male and female brain weights presented in (Dekaban, 1978) by assuming an approximately linear increase in brain weight between that of newborns (370 g) and infants aged 4-8 months, resulting in a mean estimated brain weight of 488 g for >l- ⁇ 4 month old infants.
- the value of 610 g corresponds to the average brain weight for males and females aged 4-8 months (Dekaban, 1978).
- An example of dose scaling from neonatal mice, juvenile NHPs, and equivalent human doses are presented in table immediately below.
- the administration volume may also be scaled from NHPs to humans based on the estimated volumes for cerebral CSF (Matsumae et al., 1996) and spinal CSF (Rochette et al., 2016).
- the dose can range from IxlO 10 to about IxlO 15 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 9 , 2xl0 9 , 3xl0 9 , 4xl0 9 , 5xl0 9 , 6xl0 9 , 7xl0 9 , 8xl0 9 , or 9xl0 9 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 10 , 2xlO 10 , 3xlO 10 , 4xlO 10 , 5xlO 10 , 6xlO 10 , 7xlO 10 , 8xlO 10 , or 9xlO 10 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 11 , 2xlO n , 3x10”, 4x10”, 5x10”, 6x10”, 7xlO n , 8xl0 n , or 9x10“ GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 12 , 2xl0 12 , 3xl0 12 , 4xl0 12 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 13 , 2x10 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the effective amount of the vector is about IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per gram (g) brain mass including all integers or fractional amounts within the range.
- the volume of carrier, excipient or buffer is at least about 25 pL. In one embodiment, the volume is about 50 pL. In another embodiment, the volume is about 75 pL. In another embodiment, the volume is about 100 pL. In another embodiment, the volume is about 125 pL. In another embodiment, the volume is about 150 pL. In another embodiment, the volume is about 175 pL.
- the volume is about 200 pL. In another embodiment, the volume is about 225 pL. In yet another embodiment, the volume is about 250 pL. In yet another embodiment, the volume is about 275 pL. In yet another embodiment, the volume is about 300 pL. In yet another embodiment, the volume is about 325 pL. In another embodiment, the volume is about 350 pL. In another embodiment, the volume is about 375 pL. In another embodiment, the volume is about 400 pL. In another embodiment, the volume is about 450 pL. In another embodiment, the volume is about 500 pL. In another embodiment, the volume is about 550 pL. In another embodiment, the volume is about 600 pL. In another embodiment, the volume is about 650 pL. In another embodiment, the volume is about 700 pL. In another embodiment, the volume is between about 700 and 1000 pL.
- the dose may be in the range of about 1 x 10 9 GC/g brain mass to about I x lO 12 GC/g brain mass. In certain embodiments, the dose may be in the range of about 1 x 10 10 GC/g brain mass to about 3 x 10 11 GC/g brain mass. In certain embodiments, the dose may be in the range of about 1 x 10 10 GC/g brain mass to about 2.5 x 10 11 GC/g brain mass. In certain embodiments, the dose may be in the range of about 5 x 10 10 GC/g brain mass.
- the viral constructs may be delivered in doses of from at least about least IxlO 9 GC to about 1 x 10 15 , or about 1 x 10 11 to 5 x 10 13 GC.
- Suitable volumes for delivery of these doses and concentrations may be determined by one of skill in the art. For example, volumes of about 1 pL to 150 mL may be selected, with the higher volumes being selected for adults. Typically, for newborn infants a suitable volume is about 0.5 mL to about 10 mL, for older infants, about 0.5 mL to about 15 mL may be selected. For toddlers, a volume of about 0.5 mL to about 20 mL may be selected. For children, volumes of up to about 30 mL may be selected.
- volume up to about 50 mL may be selected.
- a patient may receive an intrathecal administration in a volume of about 5 mL to about 15 mL are selected, or about 7.5 mL to about 10 mL.
- Other suitable volumes and dosages may be determined. The dosage may be adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
- the above-described recombinant vectors may be delivered to host cells according to published methods.
- the rAAV preferably suspended in a physiologically compatible carrier, may be administered to a human or non-human mammalian patient.
- the rAAV is suitably suspended in an aqueous solution containing saline, a surfactant, and a physiologically compatible salt or mixture of salts.
- the formulation is adjusted to a physiologically acceptable pH, e.g., in the range of pH 6 to 9, or pH 6.5 to 7.5, pH 7.0 to 7.7, or pH 7.2 to 7.8.
- pH of the cerebrospinal fluid is about 7.28 to about 7.32
- a pH within this range may be desired; whereas for intravenous delivery, a pH of about 6.8 to about 7.2 may be desired.
- other pHs within the broadest ranges and these subranges may be selected for other route of delivery.
- Intrathecal delivery refers to a route of administration for drugs via an injection into the spinal canal, more specifically into the subarachnoid space so that it reaches the cerebrospinal fluid (CSF).
- Intrathecal delivery may include lumbar puncture, intraventricular (including intracerebroventricular (ICV)), suboccipital/intracistemal, and/or Cl-2 puncture.
- material may be introduced for diffusion throughout the subarachnoid space by means of lumbar puncture.
- injection may be into the cistema magna.
- a rAAV, vector, or composition as described herein is administrated to a subject in need via the intrathecal administration.
- the intrathecal administration is performed as described in US Patent Publication No. 2018-0339065 Al, published November 29, 2019, which is incorporated herein by reference in its entirety.
- tracistemal delivery or “intracistemal administration” refer to a route of administration for drugs directly into the cerebrospinal fluid of the cisterna magna cerebellomedularis, more specifically via a suboccipital puncture or by direct injection into the cistema magna or via permanently positioned tube.
- treatment of the composition described herein has minimal to mild asymptomatic degeneration of DRG sensory neurons in animals and/or in human patients, well-tolerated with respect to sensory nerve toxicity and subclinical sensory neuron lesions.
- the vectors provided herein may be administered intrathecally via the method and/or the device provided in this section and described in WO 2018/160582, which is incorporated by reference herein. Alternatively, other devices and methods may be selected.
- the method comprises the steps of CT-guided suboccipital injection via spinal needle into the cisterna magna of a patient.
- CT Computed Tomography
- the term Computed Tomography (CT) refers to radiography in which a three-dimensional image of a body structure is constructed by computer from a series of plane cross-sectional images made along an axis.
- vectors and/or compositions thereof as described herein are administered via computed tomography- (CT-) guided sub-occipital injection into the cistema magna (intra-cistema magna [ICM]).
- CT- computed tomography-
- ICM intra-cistema magna
- the Ommaya Reservoir is used for delivery of a pharmaceutical composition.
- the apparatus is described in US Patent Publication No. 2018-0339065 Al, published November 29, 2019, which is incorporated herein by reference in its entirety.
- the AAVhu68.UbC.hCDKL5-lco.miR183.rBG is administered as a single dose to hospitalized participants on Day 1 via CT-guided suboccipital injection into the cisterna magna.
- a syringe containing AAVhu68.UbC.hCDKL5-lco.miR183.rBG (final volume ⁇ 5 ml) at the appropriate titer is prepared by the Investigational Pharmacy associated with the study and delivered to the procedure room.
- the participant Prior to study drug administration, the participant is anesthetized, intubated, and the injection site is prepped and draped using sterile technique.
- a lumbar puncture is performed to remove a predetermined volume of CSF, after which iodinated contrast is IT injected to aid in visualization of relevant anatomy of the cistema magna.
- IV contrast may be administered prior to or during needle insertion as an alternative to the IT contrast. The decision to use IV or IT contrast is at the discretion of the interventionalist performing the procedure.
- a spinal needle (22-25 G) is advanced into the cistema magna under fluoroscopic guidance. A larger introducer needle may be used to assist with needle placement. After confirmation of needle placement, the extension set is attached to the spinal needle and allowed to fill with CSF.
- a syringe containing contrast material may be connected to the extension set and a small amount injected to confirm needle placement in the cistema magna. After the needle placement is confirmed, the syringe containing rAAV is connected to the extension set. The syringe contents are slowly injected over 1-2 minutes, delivering a volume of ⁇ 5.0 ml.
- “Patient” or “subject”, as used herein interchangeably, means a male or female mammalian animal, including a human, a veterinary or farm animal, a domestic animal or pet, and animals normally used for clinical research.
- the subject of these methods and compositions is a human patient.
- the subject of these methods and compositions is a male or female human.
- the subject of these methods and compositions is diagnosed with CDD and/or with symptoms of CDD. The methods and compositions may be used for treatment of any of the stages of CDD.
- the patient is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 month(s) old, or about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 12, 13, 14, 15, 16, 17, 18 year(s) old.
- the patient is a toddler, e.g., 18 months to 3 years of age.
- the patient is from 3 years to 6 years of age, from 3 years to 12 years of age, from 3 years to 18 years of age, from 3 years to 30 years of age.
- patients are older than 18 years of age.
- Symptoms in CDD include seizures that usually begin within the first 3 months of life, and can appear as early as the first week after birth.
- the types of seizures change with age, and may follow a predictable pattern.
- the most common types are generalized tonic- clonic seizures, which involve a loss of consciousness, muscle rigidity, and convulsions; tonic seizures, which are characterized by abnormal muscle contractions; and epileptic spasms, which involve short episodes of muscle jerks.
- Seizures occur daily in most people with CDKL5 deficiency disorder, although they can have periods when they are seizure-free. Seizures in CDKL5 deficiency disorder are typically resistant to treatment.
- CDKL5 deficiency disorder Other common features include repetitive hand movements (stereotypies), such as clapping, hand licking, and hand sucking; teeth grinding (bruxism); disrupted sleep; feeding difficulties; and gastrointestinal problems including constipation and backflow of acidic stomach contents into the esophagus (gastroesophageal reflux). Some affected individuals have episodes of irregular breathing. Distinctive facial features in some people with CDKL5 deficiency disorder include a high and broad forehead, large and deep-set eyes, a well-defined space between the nose and upper lip (philtrum), full lips, widely spaced teeth, and a high roof of the mouth (palate). Other physical differences can also occur, such as an unusually small head size (microcephaly), side-to-side curvature of the spine (scoliosis), and tapered fingers.
- the terms “increase” “decrease” “reduce” “ameliorate” “improve” “delay” or any grammatical variation thereof, or any similar terms indication a change means a variation of about 5 fold, about 2 fold, about 1 fold, about 90%, about 80%, about 70%, about 60%, about 50%, about 40%, about 30%, about 20%, about 10%, about 5 % compared to the corresponding reference (e.g., untreated control or a subject in normal condition without CDD), unless otherwise specified.
- the patient receives medications controlling some signs and symptoms associated with the CDD, such as seizures, muscle stiffness, or problems with breathing, sleep, the gastrointestinal tract or the heart.
- a diuretic agent may be used in co-therapy in a subject in need thereof. Diuretic agent used may be acetazolamine (Diamox) or other suitable diuretics.
- the diuretic agent is administered at the time of gene therapy administration. In some embodiments, the diuretic agent is administered prior to gene therapy administration. In some, embodiments the diuretic agent is administered where the volume of injection is 3 mL.
- co-therapies may be utilized, which comprise coadministration of Cdkl5-isoform 1, isoform 2, isoform 3, and/or isoform 4- expressing vectors, or various two- or three-way combinations thereof.
- co-therapy may further comprise administration of another active agent.
- co-therapy may comprise enzyme replacement therapy.
- an immunosuppressive co-therapy may be used in a subject in need.
- Immunosuppressants for such co-therapy include, but are not limited to, a glucocorticoid, steroids, antimetabolites, T-cell inhibitors, a macrolide (e.g., a rapamycin or rapalog), and cytostatic agents including an alkylating agent, an anti-metabolite, a cytotoxic antibiotic, an antibody, or an agent active on immunophilin.
- the immune suppressant may include a nitrogen mustard, nitrosourea, platinum compound, methotrexate, azathioprine, mercaptopurine, fluorouracil, dactinomycin, an anthracycline, mitomycin C, bleomycin, mithramycin, IL-2 receptor- (CD25-) or CD3-directed antibodies, anti-IL-2 antibodies, ciclosporin, tacrolimus, sirolimus, IFN- , IFN-y, an opioid, or TNF-a (tumor necrosis factoralpha) binding agent.
- the immunosuppressive therapy may be started 0, 1, 2, 3, 4, 5, 6, 7, or more days prior to or after the gene therapy administration.
- Such immunosuppressive therapy may involve administration of one, two or more drugs (e.g., glucocorticoids, prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin)).
- drugs e.g., glucocorticoids, prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin
- Such immunosuppressive drugs may be administrated to a subject in need once, twice or for more times at the same dose or an adjusted dose.
- Such therapy may involve co-administration of two or more drugs, e.g., prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin)) on the same day.
- prednelisone e.g., prednelisone, micophenolate mofetil (MMF) and/
- Such therapy may be for about 1 week (7 days), about 60 days, or longer, as needed.
- a tacrolimus-free regimen is selected.
- the words comprise comprises , and comprising are to be interpreted inclusively rather than exclusively.
- the words "consist”, “consisting”, and its variants, are to be interpreted exclusively, rather than inclusively. While various embodiments in the specification are presented using “comprising” language, under other circumstances, a related embodiment is also intended to be interpreted and described using “consisting of’ or “consisting essentially of’ language.
- RNA Ribonucleic acid
- expression is used herein in its broadest meaning and comprises the production of RNA or of RNA and protein.
- expression or “translation” relates in particular to the production of peptides or proteins. Expression may be transient or may be stable.
- a refers to one or more, for example, “an enhancer”, is understood to represent one or more enhancer(s).
- the terms “a” (or “an”), “one or more,” and “at least one” is used interchangeably herein.
- CDD is caused by a splice site mutation of the CDKL5 gene, which encodes a phosphorylated serine/threonine protein kinase that is highly expressed in the brain. This mutation results in the disruption of CDKL5 kinase activity, leading to a reduction in signal transduction of AKT-mTOR and other related pathways, along with deficits in neural circuit communication.
- CDD Several models for CDD have been developed and may selected for use in evaluating therapeutic effect. These following models are null for CDKL5 expression: g., a Cdkl5-ko mouse having a deletion in exon 6 (A exon 6), Wang et al, Proceedings of the National Academy of Sciences Dec 2012, 109 (52) 21516-21521; DOI: 10. 1073/pnas. 1216988110; a Cdkl5-ko mouse having a deletion in exon 4 (A exon 4) (see, Amendola et al. (2014) Mapping Pathological Phenotypes in a Mouse Model of CDKL5 Disorder. PLoS ONE 9(5): e91613.
- CDD mice harboring a truncated CDKL5 gene lacking exon 6 that corresponds to exon 7 of human CDKL5, exhibits a phenotype from 10 to 11 weeks with clinically relevant symptoms observed in humans with CDD, including motor coordination impairment, poor cognition function and social behavior as well as AKT and mTOR signaling).
- motor coordination impairment including motor coordination impairment, poor cognition function and social behavior as well as AKT and mTOR signaling.
- hindlimb clasping and autistic-like and non-social behavior was observed in the CDD mice, indicating the development of neurodegeneration mice within 2 or 2.5 months.
- the current CDD mouse model does not exhibit any forms of spontaneous or refractory epilepsy, as opposed to the disease phenotype attributed to the pathogenic variants of CDKL5 in humans.
- the absence of this phenotype in CDD mice may be attributed to the age of animals, study duration, and increased seizure resistance conferred by genetic background of C57BL/6 mice (Wang et al., 2012 and Amendola et al., 2014). Based on this observation, it is not possible to observe the seizure phenotype in neonatal CDD mice.
- CDD mainly affects heterozygous female individuals and, consequently, the proposed clinical trial patient population includes heterozygous females
- signs of CDD development are evident in heterozygous male Cdkl5 K0/Y mice but not in heterozygous female Cdkl5 K0/+ mice. Therefore, heterozygous male Cdkl5 K0/Y mice were used in the current nonclinical program as they best represent the disease phenotype of CDD in humans, which also tends to be more severe in male patients.
- Several other mouse models for CDKL5 deficiency have been reported as described herein. These mice all lack CDKL5 protein expression, exhibit a normal life span and display a broad spectrum of mild behavior abnormalities.
- CDKL5 expression is developmentally regulated in mouse brain. Accordingly, CDKL5 is found highly expressed throughout the mouse brain, including the cortex and hippocampus, suggesting that Cdkl5 -deficiency in these areas may relate to the observed phenotypes in Cdkl5 deficient mice. The most pronounced phenotypes have been observed in male Cdkl5-ko mice, manifesting at about 11 weeks of age, and most studies involving neurobehavior phenotypes have been conducted with male Cdkl5-ko mice.
- CDKL5 The human CDKL5 was mostly localized to the cytoplasm; protein expression and kinase activity persisted for over 4 months.
- CDKL5 patient-derived frameshift mutations
- CDKL5 is expressed as at least four different isoforms in the human brain.
- CDKL5 gene therapy provides a lasting curative benefit to model mice and is tolerated well in non-human primates. Further optimization of this approach may eventually offer an option for clinical intervention in children affected by CDD.
- Plasmids The amino acid sequences for four CDKL5 (cyclin-dependent kinase-like 5, Uniprot ID 076039) that express in human brain 1 were reverse translated into a DNA sequence.
- the coding sequence was further engineered, e.g., by considering codon frequencies found in the human genome, cryptic RNA splice sites and alternative reading frames.
- the engineered sequence was cloned into an AAV expression plasmid under the control of the human synapsin promoter 2 .
- the coding sequence is preceded by a Kozak sequence, followed by an WPRE enhancer cassette (Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element), the SV40 poly A sequence, and framed by AAV2 inverted terminal repeats (ITR).
- WPRE enhancer cassette Wide Hepatitis Virus Posttranscriptional Regulatory Element
- ITR AAV2 inverted terminal repeats
- DRG dorsal root ganglia
- AAV CDKL5 vector was produced using either as capsid PHP.B for mouse studies or AAVhu68 4 or AAVrh91 for mouse and non-human primate studies.
- mice Male hemizygous Cdkl5-ko (also referenced as KO mice or mice), male wt, female heterozygous Cdkl5-ko and female wt.
- mice received AAV Cdkl5 vector (dose range 1 x 10 11 GC to 5 x 10 11 GC) or vehicle control (sterile phospho-buffered saline) at 18-21 days of age by retro- orbital injections in a total volume of 100 pl.
- mice were injected at day of birth intracerebroventricular with a dose of 1 x 10 10 GC to 5 x 10 10 GC in a total volume of 2 pl.
- Mice were housed mixed in regard of genotype and injection product, weighed and observed at least twice a week, and aged to 11 weeks for males or 14 week for females when they were subjected to behavior testing. We did not observer treatment-related morbidity.
- mice were single-house overnight in a new cage, supplied with a standardized 2x2 inch nestlet squares (cotton based). After 24 hours, the quality of the nest was scored on a scale of 1-5 and any remaining untouched nestlet material was weighed.
- Non-human primate experiments All studies involving non-human primates were approved by the University of Pennsylvania IACUC and carried out according to USDA regulations.
- Non-human primates (NHPs) for the species Macaca mulatta (rhesus macaques) were obtained from Covance Research Products, Inc. Quarantine and animal husbandry was performed according to Gene Therapy Program SOPs.
- HIPs Non-human primates
- Macaca mulatta rhesus macaques
- Quarantine and animal husbandry was performed according to Gene Therapy Program SOPs.
- blood and CSF samples obtained. Whole blood was used for cell counts and differentials, and a clinical blood chemistry panel.
- CSF samples were used for blood cell counts and differentials, and total protein quantification.
- a leur access extension catheter was connected to the spinal needle to facilitate dosing of 1 ml lohexol (Trade Name: Omnipaque 180 mg/mL, General Electric Healthcare) contrast media.
- a syringe containing the test article (volume equivalent to 1 mL plus the volume of syringe and linker dead space) was connected to the flexible linker and injected over 30 ⁇ 5 seconds. The needle was removed, and direct pressure applied to the puncture site.
- AAVhu68.hSyn.Cdkl5-lco and AAVhu68.hSyn.Cdkl5-lco vector has injected at a dose of up to 3 x 10 13 GC/NHP.
- a neurological assessment was given to all macaques for detailed evaluation of neurological function. Briefly, evaluation included posture and gait assessment, cranial nerve assessment, proprioceptive assessment and spinal/nerve reflexes.
- macaques were euthanized, and gross postmortem examination and necropsy was performed. 25 major tissues were harvested from each macaque in duplicate for either snap freezing or fixation in formalin.
- DNA or RNA was purified from snap-frozen tissues and used for vector biodisfribution or transgene expression analysis, respectively.
- genome copies (GC) per total DNA weight were determined using a TaqMan qPCR assay with probes directed again the polyA region of the fransgene cassette and an internal standard.
- total RNA was used to generate cDNA via first strand synthesis with polyT oligonucleotides, followed by TaqMan qPCR with probes specific for the fransgene that did not cross-react with the endogenous rhesus CDKL5 sequence.
- the expression construct between the ITRs is comprised of the human synapsin promoter (SEQ ID NO: 23), the engineered coding sequence for human CDKL5, isoform 1 (SEQ ID NO: 22), the WPRE expression enhancer (SEQ ID NO: 27) and SV40 poly A sequence (SEQ ID NO: 28) (FIG 1A).
- the alternative expression constructs contain engineered coding sequences for human CDKL5, isoform 2 (CDKL5-2GS or hCDKL5-2GS; SEQ ID NO: 24), 3 (CDKL5-3GS or hCDKL5-3GS; SEQ ID NO: 25) or 4 (CDKL5-4GS or hCDKL5-4GS; SEQ ID NO: 26), respectively, instead of isoform 1.
- All tested plasmids expressed well in mouse brain, showing minor differences in ability to phosphorylate EB2 (measurement of CDKL5 kinase activity).
- WPRE enhancer is required to obtain human CDKL5 expression levels in the mouse brain that resemble wildtype mouse Cdkl5 expression (FIG 2).
- CDKL5 was fully active, as determined by its ability to phosphorylate its endogenous target EB2 protein (FIG. 2).
- the expression and localization of CDKL5 was confirmed via IHC.
- AAVrh91.UbC.CDKL5-lco.miR183 and AAVrh91.CBh.CDKL5-lco.miR183, in AAVrh91 capsid were administered at a dose of 3 x 10 10 GC via neonatal ICV in Cdkl5-ko mice and necropsy was performed at P14.
- FIG. 29A shows CDKL5 expression quantified from Western blot analysis, charted as CDKL5/tubulin levels in knockout mice which were administered
- FIG. 29B shows kinase activity quantified from Western blot analysis, charted as pEB2pS222/total EB2 levels in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at doses 3 x IO 10 GC, as compared to WT and knockout mice treated with PBS (control groups).
- FIG. 29B shows kinase activity quantified from Western blot analysis, charted as pEB2pS222/total EB2 levels in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at doses 3 x IO 10 GC, as compared to WT and knockout mice treated with PBS (control groups).
- FIG. 29B shows kinase activity quantified from Western blot analysis, charted as pEB2pS222/total EB2 levels in knockout mice which were administered AAVrh91.UbC.CD
- FIG. 30 shows kinase activity as measured qualitatively by Western blotting (using pEB-S222 antibody; Baltussen et al., (2016)), in knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at doses 3 x 10 10 GC, as compared to WT and knockout mice treated with PBS (control groups).
- mice were administered with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 via neonatal ICV at doses of 1 x 10 10 , 3 x 10 10 , 6 x 10 10 GC.
- Tissue samples of cortex were harvested form mice at 4 months age and examined for CDKL5 expression via Western blotting (FIGs. 21A, 21B and 21C).
- FIG 21A shows CDKL5 expression as measured qualitatively by Western blotting, at 4 months of age, wherein mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x 10 10 or 6 x 10 10 GC via neonatal ICV.
- FIG. 21A shows CDKL5 expression as measured qualitatively by Western blotting, at 4 months of age, wherein mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x 10 10 or 6 x 10 10 GC via neonatal ICV.
- 21C shows CDKL5 expression quantified from Western blotting analysis, charted as CDKL5/tubulin levels in wild type and knockout mice which were administered AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x 10 10 or 6 x 10 10 GC via neonatal ICV, and compared to AAVhu68.hSyn-CDKL5 at a dose of 5 x 10 10 GC.
- Western blot analysis of cortex showed robust hCDKL5 transgene expression. From these results, we observed a a dose-dependent expression, a saturation at a dose of 6 x 10 10 GC.
- FIG 21B shows CDKL5 expression as measured qualitatively by Western blotting, at 4 months of age, wherein mice which were administered AAVrh91.CBh.CDKL5-lco.miR183 at a dose of 3 x IO 10 or 1 x IO 10 GC via neonatal ICV.
- CDKL5 varied expression following administration AAVrh91.UbC.CDKL5- lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183, as observed by western blot analysis, was further confirmed by fluorescent microscopy. Representative immunofluorescent microscopy images showed significant expression of CDKL5 throughout brain post administration of AAVrh91.UbC.CDKL5-lco.miR183, and a dim expression was observed post administration with AAVrh91.CBh.CDKL5-lco.miR183, while mostly being visible in cortex (FIGs. 22A and 22B). FIG.
- FIG. 22A shows a representative image from immunofluorescent microscopy analysis of CDKL5 expression following administration with AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- FIG. 22B shows a representative image from immunofluorescent microscopy analysis of CDKL5 expression following administration with AAVrh91.CBh.CDKL5-lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- the UbC promoter drives CDKL5 expression in more cells than the CBh promoter, which localizes mostly in neurons (FIGs. 23A and 23B).
- FIG. 23A and 23B shows a representative image from immunofluorescent microscopy analysis of CDKL5 expression following administration with AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 3 x IO 10 GC via neonatal
- FIG. 23A shows a representative image (zoomed in view) from immunofluorescent microscopy analysis of CDKL5 expression (samples were also probed for NeuN, neuronal marker) following administration with AAVrh91.UbC.CDKL5- lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- FIG. 23B shows a representative image (zoomed in view) from immunofluorescent microscopy analysis of CDKL5 expression (samples were also probed for NeuN, neuronal marker) following administration with AAVrh91.CBh.CDKL5-lco.miR183 at a dose of 3 x IO 10 GC via neonatal ICV.
- CDKL5 transgene in mouse brain following the transduction with AAVrh91.UbC.CDKL5-lco.miR183 and AAVrh91.CBh.CDKL5- lco.miR183.
- AAVrh91.UbC.CDKL5-lco.miR183 Upon further analysis, a higher CDKL5 expression per cell was observed in hippocampus of mouse brain after transduction with AAVrh91.UbC.CDKL5-lco.miR183.
- lower expression of CDKL5 per cell was observed in hippocampus of mouse brain after transduction with AAVrh91.CBh.CDKL5-lco.miR183, wherein.
- a CDKL5 expression was observed in mouse brain after transduction either with AAVrh91.UbC.CDKL5-lco.miRl 83 (AAVrh91 capsid; Ubiquitin C promoter) or with AAVhu68.hSyn.CDKL5-lco.miRl 83 (AAVhu68 capsid; Synapsin promoter).
- mice were treated cohort of juvenile Cdkl5-ko (also referenced as KO mice or mice) and wild type (wt) littermates with 5 x 10 11 GC (5el 1 gc) of AAV9-PHP.B-hSyn-hCDKL5- Ico.WPRE vector by retro-orbital IV injection. All treatment groups continued to grow at the same rate and no treatment-related deaths were observed. At 10 weeks of age, mice were subjected to the battery of behavior testing. We observed a robust and statistically significant normalization for the treated group in the Elevated Zero Maze and Open Field Activity tests. There was a marginal improvement in the same group in the rotarod and Y -Maze test, and no improvement in thermal sensitivity.
- KO mice show the characteristic hind limb clasping phenotype, which was substantially ameliorated in treated ko mice.
- Therapeutic efficacy of CDKL5 gene therapy was measured by hind limb clasping test.
- a dose dependent improvement was observed of the severity score in treated CDKL5-ko mice (FIGs 9C-9F). Likewise, the persistent hyperactivity and rearing phenotype found in ko mice was normalized towards wildtype activity.
- Cdkl5(D471fs) carry a patient point mutation that leads to a premature stop codon.
- no CDKL5 protein and highly reduced EB phosphorylation levels were found in the brains of these mice.
- Cdkl5(D471fs) share the absence of Cdkl5 protein with the previously used Cdkl5-ko mice, however, the genetic background is slightly different due the method of generation for the mouse models.
- Neonatal pups were injected at the same concentration as before (5 x 10 10 GC, neoICV) and showed robust hCDKL5 protein expression and EB2 phosphorylation 3 months later.
- Cdkl5(R59X) carry a patient point mutation that introduces a premature stop codon. As in patients, no CDKL5 protein and highly reduced EB phosphorylation levels were found in the brains of these mice. Thus, Cdkl5(R59X) share the absence of Cdkl5 protein with the previously used Cdkl5-ko mice, however, the genetic background is slightly different due the method of generation for the mouse models.
- Neonatal pups were injected at the same concentration as before (5 x 10 10 GC, neoICV) and showed robust hCDKL5 protein expression and EB2 phosphorylation 3 months later.
- a small pilot cohort was subjected to behavior testing. AAV treatment was well tolerated, and no morbidity was observed. Hind limb clasping was significantly corrected in treated mutant mice.
- CDKL5 Gene therapy dose escalation in WT mice WT (C57B16/J) mice were injected at 7.5 x IO 10 GC and 1 x 10 11 GC (i.e., 1.5x or 2x of previously highest used dose) via neonatal ICV. There was no overt effect observed on weight, development, and survival. Mice appeared normal and did not show hindlimb clasping or activity changes. There was no observed effects in pathologist review of CNS tissues (FIGs 19A and 19B).
- Example 4 Pre-chmcal therapeutic benefit of CDKL5 gene therapy (AAVrh91.UbC.CDKL5-1 co.miR183) in CDD mouse model
- Cdkl5-ko also referenced as KO mice or mice
- wild type mice were administered either AAVrh91.UbC.
- FIG. 24 shows quantification of CDKL5-expressing neurons (above background levels) as compared to previous results following administration with AAVhu68.hSyn.CDKL5.
- AAVrh91.UbC.CDKL5-lco.miR183 administration was observed to achieve expression within the range of WT expression in normal subjects.
- FIG. 31A shows results as the percent neurons with CDKL5 protein expression in mouse cortex and hippocampus tissue following neonatal ICV administration with AAVrh91.UbC.CDKL5-lco.miR183 at a dose of 1 x IO 10 , 3 x IO 10 , or 6 x IO 10 GC, as compared to WT mice treated with PBS.
- FIG.31B shows a representative microscopy image from immunofluorescent analysis staining with DAPI (nuclei), CDKL5, and NeuN (neuronal marker) of cortical section tissue following neonatal ICV administration with AAVrh91.UbC.CDKL5-lco.miR183 at doses of 3 x 10 10 GC.
- DAPI nuclei
- CDKL5 neurotrophic factor
- NeuN neuroneuronal marker
- FIG. 25 shows results of the survival study with tallied survival at post-natal day 16 (PND16) of mice which were administered with AAVrh91.CBh.CDKL5-lco.miR183 at doses of 1 x IO 10 , 3 x IO 10 , or 6 x IO 10 GC via neonatal ICV.
- FIG. 32 shows analysis of measured body weights of wild type and CDKL5-ko when administered with PBS, or AAV.UbC.CDKL5-lco.miR183 at doses of 1 x IO 10 , 3 x IO 10 , 6 x IO 10 GC.
- FIG. 33A shows a results of the hindlimb clasping test for AAV.UbC.CDKL5-lco.miR183-treated group at a dose of 3 x IO 10 GC compared to untreated group in Cdkl5-ko mice and WT mice.
- FIG. 33B shows a dose-dependent effect on hyperactivity, as measured in the open field activity test and plotted as ambulatory activity (beam breaks) in Cdkl5-ko mice and WT mice following administration of AAV.UbC.CDKL5-lco.miR183 at a dose of 1 x IO 10 , 3 x IO 10 , or 6 x IO 10 GC.
- FIG. 34A shows results of binned ambulatory activity for groups of WT and Cdkl5-ko mice administered with AAV.UbC.CDKL5-lco.miRl 83 at a low dose of 1 x IO 10 GC.
- FIG. 34A shows results of binned ambulatory activity for groups of WT and Cdkl5-ko mice administered with AAV.UbC.CDKL5-lco.miRl 83 at a low dose of 1 x IO 10 GC.
- FIG. 34B shows results of binned ambulatory activity for groups of WT and Cdkl5-ko mice administered with AAV.UbC.CDKL5-lco.miRl 83 at a medium dose of 3 x IO 10 GC.
- FIG. 34C shows results of binned ambulatory activity for groups of WT and Cdkl5- ko mice administered with AAV.UbC.CDKL5-lco.miR183 at a high dose of 6 x IO 10 GC. These result show a dose-dependent improvement of hyperactivity in Cdkl5-ko mice administered with AAV.UbC.CDKL5-lco.miR183.
- FIG. 35 shows results in nest building (nest quality/score) for the AAV.UbC.CDKL5-lco.miR183-treated WT and Cdkl5-ko mice at a dose of 1 x IO 10 , 3 x IO 10 , or 6 x IO 10 GC.
- the AAV.UbC.CDKL5-lco.miR183 vector showed therapeutic utility in mice similar to when CDKL5 expression was driven by hSyn.
- the rAAV.CDLK5 vector having an AAVrh91 capsid used with an AAV vector genome comprising an engineered nucleic acid sequence achieved CDKL5 expression levels similar to that of the rAAVhu68.CDKL5.
- CDKL5 protein levels in mouse brain were higher with the Ubc promoter compared with the hSyn promoter.
- Isoform 1 accounts for >85% of brain CDKL5.
- FIG 12 shows significant correction of clasping phenotype with treatment by alternative CDKL5 isoforms (2, 3, and 4).
- FIGs 8A to 8D provide CDKL5 expression levels or activity for AAV.CDLK5 vector constructs for the expression isoform 1, isoform 2, isoform 3 or isoform 4.
- FIG 8A shows expression levels in knock-out mice injected with AAV vectors (5 x IO 10 GC, neonatal ICV) expressing each one of these isoforms, as compared to a wild-type mouse injected with vehicle and a knock-out mouse injected with vehicle.
- FIG 8B shows CDKL5 activity as determined using the pS222EB2 in a wild-type mouse injected with vehicle (PBS), a knock-out mouse injected with vehicle, or the AAV.CDKL5-lco.
- FIG 8C shows CDKL5 activity as determined using the pS222EB2 for the groups in FIG 8A.
- FIG 8D shows CDKL5 expression levels for the groups in FIG 8B.
- CDKL5 gene therapy with CDKL5 isoform 1 is a promising and safe approach in male CDD model mice with a significant therapeutic benefit.
- FIG. 36A shows a schematic overview of the intra-cisterna magna (ICM) administration procedure.
- FIG. 36B shows a more detailed overview of the ICM administration as a fluoroscopy-guided procedure. Injection into CSF via the cistema magna (ICM) provides best access to brain.
- ICM intra-cisterna magna
- non-human primate (NHP) study the toxicity and safety testing of hCDKL5 gene therapy was performed using an AAVhu68-hSyn-Cdkl5-lco-WPRE vector.
- 3 x 10 12 GC/animal 3 x 10 12 GC/animal
- 1 x 10 13 GC/animal 3 x 10 13 GC/animal
- 3 x 10 13 GC/animal 3 x 10 13 GC/animal.
- a dose of 1 x 10 14 GC/animal was selected, and two different volumes (3 mL and 5 mL) were assessed for delivery of the AAV vector to the cerebrospinal fluid (CSF) via cisternal magna.
- CSF cerebrospinal fluid
- Other study arms used 1 x 10 14 GC/animal with a diuretic (e.g., a Diamox brand acetazolamide) or 3 x 10 14 GC/animal (subject).
- Necropsy was carried out 28 days after injection, followed by molecular analysis, histology and pathology review. Overall, no major transduction differences in main organs outside CNS were found (e.g., transduction of liver has likely already reach a maximum). No major transduction differences in spinal cord and DRGs (remain at very high transduction rates) were observed, however significant changes in brain tissues depending on the injection parameters became evident. The highest transduction increase of transduction was seen in the cortex. Diamox lead to a slight increase in transduction efficiency through the brain.
- FIG. 17 shows vector biodistribution for each NHP across non-neuronal tissue, spinal tract tissues and brain tissue.
- FIG. 18 only the vector biodistribution data for brain is shown.
- the results show that there is an observed strong transduction of dorsal root ganglion tissue (DRGs), moderate to low transduction of brain tissues, and present transduction leakage into neuronal tissues.
- DRGs dorsal root ganglion tissue
- the pathology result indicated mild axonopathy in dorsal white matter tracts.
- Slight differences in hCDKL5 mRNA levels were observed. There is a trend for higher mRNA expression when a 3ml injection volume was used.
- ISH in-situ hybridization
- DRG Dorsal root ganglia
- Vectors are administered to C. macaques at a dose of 3 x IO 10 GC via ICM route. Pathology analysis and neuro-examination was performed to evaluate the effects of CDKL5 expression following AAV vector administration.
- FIG. 26A shows severity score observed in DRG neurons from cervical, thoracic, and lumbar collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miRl 83 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC administered via the ICM route.
- FIG. 26A shows severity score observed in DRG neurons from cervical, thoracic, and lumbar collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miRl 83 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC administered via the ICM route.
- 26B shows severity score observed in spinal cord neurons from cervical, thoracic, and lumbar collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5- lco.miR183 vectors at a dose of 3 x IO 10 GC via ICM route.
- FIG. 26C shows severity score observed in sural nerve from proximal and distal collected tissue from NHPs treated with AAVrh91.UbC.CDKL5-lco.miRl 83 or AAVrh91.CBh.CDKL5-lco.miR183 vectors at a dose of 3 x IO 10 GC via ICM route.
- FIG. 1 shows results of the vector copy number plotted as GC/diploid genome in various tissues oh NHP following administration with AAVrh91.UbC.CDKL5-lco.miR183 or AAVrh91.CBh.CDKL5-lco.miR183 vectors.
- FIG. 37A shows analysis of the brain transduction as measured by vector genome copies via qPCR of extracted DNA/RNA from different brain regions of NHP following administration with AAVrh91.UbC.CDKL5- lco.miR183.
- We observed good transduction in cortex -10 GC/cell
- high transduction in DRG neurons and liver cells (-100 gc/cell).
- FIG. 28 shows relative expression of CDKL5, plotted as per 100 ng of cDNA, in various CNS tissue (motor cortex, som. sens. Cortex, parietal cortex, hippocampus, thalamus) of NHP, as compared to results observed in mouse brain.
- FIG. 37B shows relative CDKL5 transgene expression (mRNA) as measured via qPCR of RNA extracted from different NHP brain regions following administration with AAVrh91.UbC.CDKL5-lco.miRl 83 (relative to expression in mouse brain when administered at a dose of 3 x 10 10 GC).
- ISH In Situ Hybridization
- FIG. 38A shows results of molecular analysis of CDKL5 gene therapy outcome on the single-neuron basis, plotted as percent of transduced neurons measured by vector genome copies.
- FIG. 38B confirms results obtained from single neuron analysis.
- FIG. 38B shows CDKL5 transgene expression levels as measured from bulk mRNA, plotted as percent transgene expressing neurons. From these results we observed many neurons expressing CDKL5 transgene, but at modest levels.
- AAV-CDKL5 vector (SEQ ID NO: 1) examined in our studies can be used to achieve stable CDKL5 protein expression in neurons.
- AAV-CDKL5 gene therapy significantly improved the phenotype of a CDD mouse model.
- AAV-CDKL5 vector can be efficiently delivered via the cistema magna to non-human primates and expresses in throughout the CNS.
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG is an AAV serotype hu68 (AAVhu68) vector expressing a mutant coding sequence of the human CDKL5 isoform 1 gene.
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG addresses the significant unmet need by providing functional CDKL5 protein in the CNS and thereby correcting the underlying cause of the disease as described below.
- the described first-in-human (FIH) trial is an open-label, multi-center, dose escalation study of AAVhu68.UbC.hCDKL5-lco.miR183.rBG administered via an intra-cistema magna (ICM) injection to evaluate safety, tolerability, and exploratory efficacy endpoints in pediatric (> 30 days of age) and adult subjects with CDKL5 deficiency disorder (CDD).
- ICM intra-cistema magna
- some clade F isolates such as AAV9 have demonstrated extremely efficient brain transduction (Gray et al., 2013; Haurigot et al., 2013; Hinderer et al., 2014b; Hinderer et al., 2015).
- gene therapy has shown greatly enhanced potential to treat a variety of neurological disorders, and several programs utilizing second-generation vectors have progressed into the clinic (Haurigot et al., 2013; Hinderer et al., 2014b; Hinderer et al., 2015; Gurda et al., 2016).
- AAV vectors including AAV9
- AAV9 can transduce cells within the CNS after IV delivery
- IV vector delivery has two critical limitations.
- gene transfer to the CNS after IV vector delivery is profoundly limited by pre-existing NAbs to the vector capsid (Gray et al., 2011).
- IT intrathecal
- CSF cerebrospinal fluid
- PNS peripheral nervous system
- IT vector delivery is not affected by pre-existing NAbs to the AAV capsid, making this approach applicable to a broader patient population (Haurigot et al., 2013).
- IT AAV delivery can be performed using a variety of routes for CSF access.
- Lumbar puncture (LP) is the most common method for accessing CSF, and was therefore evaluated as a route for AAV administration in NHPs. Delivery of an AAV9 vector into the CSF via an LP was found to be at least 10-fold less efficient at transducing cells of the brain and spinal cord compared to injection of the vector more superiorly at the level of the cisterna magna (Hinderer et al., 2014b).
- ICM injection also known as suboccipital puncture
- LPs blood vessels
- CT computed tomography
- the AAVhu68.UbC.hCDKL5-lco.miR183.rBG filled drug product consists of a non-replicating recombinant adeno-associated viral (rAAV) vector active ingredient and a formulation buffer.
- the rAAV vector is produced at a contract manufacturing organization (CMO).
- CMO contract manufacturing organization
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG is produced using procedures that ensure the safety, identity, quality, purity, and strength of the product with practices consistent with both the “U.S.
- FDA Food and Drug Administration
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG involves transient transfection of human embryonic kidney 293 (HEK293) cells with plasmid DNA.
- HEK293 human embryonic kidney 293
- BDS bulk drug substance
- PEL polyethylenimine-
- Harvested AAV material are purified sequentially by clarification, tangential flow filtration (TFF), affinity chromatography, and anion exchange chromatography in disposable, closed bioprocessing systems where possible.
- the drug substance (DS) and drug product (DP) is formulated in intrathecal final formulation buffer (ITFFB; artificial CSF with 0.001% poloxamer 188).
- IFFB intrathecal final formulation buffer
- the BDS batch or batches is frozen, subsequently thawed, pooled if necessary, adjusted to the target concentration, sterile-filtered through a 0.2 gm filter, and filled into vials. Fill data is provided as part of the lot documentation package.
- ddPCR droplet digital polymerase chain reaction
- the biological product comprises hCDKL5-lco, human cyclin-dependent kinase-like 5, isoform 1 (engineered mutant); ITR, inverted terminal repeats; miR183, microRNA-183; PolyA, polyadenylation; rBG, rabbit [3-globin; UbC, ubiquitin C), and its sequence elements are detailed below (See also, SEQ ID NO: 49 (vector genome), and SEQ ID NO: 50 (expression cassette)).
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG is produced by triple plasmid transfection of HEK293 cells with the AAV cis plasmid (pAAV.UbC.hCDKL5- lco.miR183.rBG.KanR (vector genome of SEQ ID NO: 49)), the AAV trans plasmid encoding the AAV2 rep and AAVhu68 cap genes (pAAV2/hu68n.KanR (comprising SEQ ID NO: 55), and the helper adenovirus plasmid (pAdAF6.KanR).
- the size of the AAVhu8.UbC.hCDKL5-lco.mirR183.RBG packaged vector genome is 4857 bases (including wild-type length ITRs).
- the vector genome in the plasmid, as described in SEQ ID NO: 49, includes a shortened AAV2 ITR of 130 base pairs, wherein the external A elements is deleted.
- the shortened ITR is reverted back to the wild-type length of 145 base pairs during vector DNA amplification using the internal A element as a template.
- the cis plasmid contains the following vector genome sequence elements:
- ITR Inverted Terminal Repeat
- AAV2 130 base pairs [bp] (SEQ ID NO: 51), GenBank: NC_001401) that flank all components of the vector genome.
- the ITRs function as both the origin of vector DNA replication and the packaging signal for the vector genome when AAV and adenovirus helper functions are provided in trans. As such, the ITR sequences represent the only cis sequences required for vector genome replication and packaging.
- the coding sequence is an engineered version of the human CDKL5 isoform 1 gene (2883 bp, GenBank: NP_001310218.1 (SEQ ID NO: 20)). This isoform comprises >85% of the total brain CDKL5 expression and is considered the primary brain isoform of CDKL5. (Note: The original name for the predominant brain isoform of CDKL5 was isoform 2. However, CDKL5 isoform 2 was recently redesignated CDKL5 isoform 1 in Hector et al 2016.
- CDKL5 isoform 1 While the GenBank sequence listed above has not been updated to reflect this nomenclature change and is still designated CDKL5 isoform 2, we will refer to the coding sequence in AAVhu68.UbC.hCDKL5-lCO.miR183.RBG as CDKL5 isoform 1 to reflect the current nomenclature used in this field for the predominant brain isoform of CDKL5) (SEQ ID NO: 22).
- MicroRNA- 183 (miRl 83): Four 22 -bp target sequences for miRl 83 (GenBank: NR_029615. 1) are included in the 3’ untranslated region of the human CDKL5 sequence. microRNAs post-transcriptionally downregulate expression of target messenger ribonucleic acids (mRNAs) in multicellular organisms by affecting both mRNA stability and translation. Since miRl 83 expression is largely restricted to the DRG, the miRl 83 target sequences enable DRG-specific downregulation of the human CDKL5 transgene product. (SEQ ID NO: 11).
- rBG PolyA Rabbit P-Globin Polyadenylation Signal
- GenBank GenBank: V00882.
- This element functions as a signal for transcriptional termination, a specific cleavage event at the 3’ end of the nascent transcript and the addition of a long poly adenyl tail (SEQ ID NO: 53).
- a AAV2/hu68 trans plasmid pAAV2/hu68 (comprising SEQ ID NO: 55) is used.
- the AAVhu68 trans plasmid encodes the four WT AAV serotype 2 (AAV2) Rep proteins and the three WT AAV VP capsid proteins from AAVhu68.
- An adenovirus helper plasmid used which contains the regions of adenovirus genome that are important for AAV replication; namely, E2A, E4, and VA RNA (the adenovirus El functions are provided by the HEK293 cells). However, the plasmid does not contain other adenovirus replication or structural genes.
- the plasmid does not contain the cis elements critical for replication, such as the adenoviral ITRs.
- FIGs. 47A, 47B A manufacturing process flow diagram is shown in FIGs. 47A, 47B.
- FIG. 46A shows upstream manufacturing process flow diagram for drug substance.
- FIG. 46B shows downstream manufacturing process flow diagram for drug substance. The proposed in-process tests are depicted on the right side of the diagram. A description of each production and purification step is also provided.
- ITFFB intrathecal final formulation buffer
- Example 8 Further Evaluation of the pharmacology, safety, and toxicology of AAVhu68.UbC.hCDKL5-1co.miR183.rBG:
- AAVhu68.UbC.hCDKL5- lco.miR183.rBG an AAV serotype hu68 vector encoding an engineered, mutant, version of the human cyclin-dependent kinase-like 5 (CDKL5) isoform 1 gene has been assessed in various studies with other candidates.
- AAVhu68 AAV serotype hu68 vector encoding an engineered, mutant, version of the human cyclin-dependent kinase-like 5 (CDKL5) isoform 1 gene
- a pharmacology study evaluates efficacy and determine the MED of AAVhu68.UbC.hCDKL5-lco.miR183.rBG in neonatal (PND 0-1) male Cdkl5KO/Y mice.
- the MED is determined based on transgene product expression (human CDKL5) and the impact on neurological and behavioral phenotypes pronounced of clinical features observed in CDD patients. Seizures, which are a clinical feature of CDD in humans, are not assessed in the MED study.
- mice In vivo pharmacology studies are performed in C57BL/6J (wild type) mice, a mouse model of CDD (male Cdkl5 KO mice and female Cdkl5 HET mice), and two species of NHP (Rhesus macaques and African green monkeys).
- Nonclinical pharmacology studies described herein utilize a knockout mouse model of CDD in which exon 6 of the X-linked murine Cdkl5 has been deleted, resulting in significant reductions in Cdkl5 mRNA and no detectable CDKL5 protein (Wang et al. 2012).
- This knockout mutation in the CDD mouse model recapitulates a CDKL5 patient-associated splice site mutation that causes skipping of human exon 7 (homologous to murine exon 6) and results in a premature stop codon in human exon 8, leading to a lack of residual CDKL5 protein expression in humans with this mutation.
- mice Male mice are commonly utilized by groups studying the CDD mouse phenotype because male Cdkl5KO/Y mice (which are hemizygous for the X-linked Cdkl5 knockout allele) typically exhibit a more severe and consistent phenotype than that of female Cdkl5KO/X mice (which are heterozygous for the X linked Cdkl5 knockout allele and also demonstrate variable tissue mosaicism for expression of the wild type Cdkl5 gene due to random X chromosome inactivation).
- male Cdkl5KO/Y mice spent more time occupying and sniffing a novel object in the nonsocial chamber compared to time spent in the social chamber with a novel stimulus mouse, and when exposed to a barrier-free chamber, the interaction time of male Cdkl5KO/Y mice with other mice in the social chamber was significantly reduced compared to that of wild type mice, suggesting a reduction in social preference.
- Anxietylike motor behaviors e.g., compulsiveness, hyperactivity, and/or risk-prone behaviors
- have also been observed in male Cdkl5KO/Y mice on the elevated zero maze test and open field test Wang et al., 2012).
- Cognitive phenotypes include deficits in motor activity, along with impaired learning and memory. For example, a significant deficit in the context- and cue-dependent behavioral responses of male Cdkl5KO/Y mice was observed by 9-12 weeks of age based on the contextual fear conditioning assay.
- Male Cdkl5KO/Y mice also exhibit deficits in auditory - evoked event-related potentials (ERPs), which is indicative of impaired neural circuit activity reminiscent of that seen in patients with CDD.
- ERPs are stereotyped, electrophysiological responses to specific sensory, cognitive, or motor stimuli.
- ERPs have been leveraged as a readout of neural circuit communication and have been shown to be altered in disorders of cognition, such as schizophrenia and autism.
- Disturbances within the neuronal circuit network may contribute to the delay in behavioral responses observed in Cdkl5 KO mice.
- Circuit communication is dependent upon oscillations over low or high frequencies and low frequencies are associated with long-range neuronal circuit communication. Similar to the neuronal defects reported in autism spectrum disorder patients, oscillatory strength at low delta, theta, and alpha frequencies is attenuated in Cdkl5 KO mice (Wang et al., 2012).
- Cdkl5 KO mice do not exhibit spontaneous or refractory epilepsy.
- the absence of this phenotype in CDD mice may be attributed to the age of the animals, study duration, and increased seizure resistance conferred by the genetic background of the Cdkl5 KO mouse model (C57BL/6) (Wang et al., 2012 and Amendola et al., 2014).
- Abnormal EEG patterns were not observed in Cdkl5 KO mice before 12 weeks age.
- Several mouse models of CDD have been generated through heterozygous mutations in mouse strains.
- Cdkl5KO/Y mice treated at a presymptomic stage of disease represent the most relevant animal model of the intended patient population for assessment of the potential efficacy of AAVhu68.UbC.hCDKL5- lco.miR183.rBGin the MED study.
- the NHP have been selected for POC large-animal pharmacology studies. These studies include both rhesus macaques and African green monkeys . The NHP was selected for pilot pharmacology studies because the toxicological and immune responses of the NHP closely represent that of a human. Furthermore, the dimensions of the NHP central nervous system (CNS) of both rhesus macaques and African green monkeys act as a representative model of the target clinical population and allow administration of AAVhu68.UbC.hCDKL5-lco.miR183.rBG via the intended clinical route (ICM administration).
- CNS central nervous system
- Cdkl5 is an X-linked gene
- initial POC pharmacology studies utilize female Cdkl5KO/X mice (heterozygous for the Cdkl5 KO allele) and male Cdkl5KO/Y mice (hemizygous for the Cdkl5 KO allele) to model CDD in humans.
- male Cdkl5KO/Y mice are evaluated.
- genotypes and sex are challenging to determine in neonatal mice (PND 0-1)
- full litters of neonatal mice is dosed in the MED study, including female Cdkl5KO/X; however, only male Cdkl5KO/Y mice are enrolled and analyzed to determine the MED.
- Wild type C57BL/6 mice have also been selected for initial POC and the MED study because they are a similar genetic background as the Cdkl5 KO mouse model and are therefore useful as a healthy control group.
- Male Cdkl5KO/Y mice, female Cdkl5KO/X mice, and sex-matched C57BL/6J wild type controls have been included in initial POC studies to characterize the severity and progression of the CDD phenotype. Since the data obtained and described herein demonstrated that male Cdkl5KO/Y mice have a more severe phenotype than that of female Cdkl5KO/X mice on certain assessments that are critical for determining the MED (e.g., the open field test), male Cdkl5KO/Y mice have been selected for the MED study.
- Male Cdkl5KO/Y mice are also preferred for the planned MED study because random X chromosome inactivation leads to mosaic Cdkl5 expression in females due to Cdkl5 being an X-linked gene.
- Mosaicism for Cdkl5 expression can cause phenotype variability due to interanimal variability in the overall percentage of cells expressing the wild type Cdkl5 allele versus the Cdkl5 knockdown allele, making female mice suboptimal for use in an MED study.
- Male and female rhesus macaques and African green monkeys have been used in POC pharmacology studies. Both sexes were selected to model the intended patient population in the planned clinical trial (male and female CDD patients).
- mice administered vector on PND 0-1 All mouse pharmacology studies have evaluated neonatal mice administered vector on PND 0-1. This age has been selected because it is the earliest feasible treatment time point and represents a pre-symptomatic stage of disease prior to the onset of overt clinical symptoms, which normally begin to manifest around 8-10 weeks of age in male Cdkl5KO/Y mice depending on the assay employed.
- the neonatal (PND 0-1) mouse model therefore mirrors the disease stage of the youngest intended patient population to the greatest extent feasible.
- the completed POC mouse pharmacology study evaluated test article at a dose of 5.0 x 10 10 GC because this is close to the highest feasible dose for ICV administration in mice based on expected vector titers and volume constraints.
- Another POC mouse pharmacology study evaluates AAVhu68.UbC.hCDKL5-lco.miR183.rBG at a 2-fold lower dose (2.5 x 10 10 GC) because studies conducted with other candidate AAV vectors expressing human CDKL5 have demonstrated efficacy at this dose comparable to that of the highest feasible dose (data not shown).
- the MED study subsequently includes a high dose, two mid-doses, and a low dose and are selected based upon the results of the aforementioned POC studies. The selected doses permit an assessment of dose-dependent efficacy while ensuring that the dose levels evaluated in the MED study are distinct.
- the NHP POC pharmacology study conducted in rhesus macaques utilized a high dose of 3.0 x 10 13 GC, which is close to the highest feasible dose for ICM administration in NHPs based on expected vector titers and volume constraints.
- the mid-dose and low dose were approximately 3-fold and 10-fold lower than the maximum feasible dose, respectively. This range was selected to ensure that doses were distinct and encompassed a dose range similar to that which may be evaluated in the mouse MED pharmacology study and the GLP- compliant NHP toxicology study.
- the NHP POC pharmacology study conducted in African green monkeys has utilized a dose of 5.0 x 10 13 GC because this dose is close to the highest feasible dose for ICM administration in NHPs based on expected vector titers and volume constraints.
- the ICV route i.e., administration of vector directly into the cerebral ventricles
- the ICV route has been selected for pharmacology studies in mice because it enables efficient delivery of AAV vector to the disease relevant target tissue (brain).
- Use of the intended clinical route (ICM administration into the cistema magna), which employs CSF as a vehicle for vector dispersal with the potential to achieve transgene product expression throughout the CNS via a single minimally invasive injection, is not feasible in mice due to the small size of the animals.
- the ICM route has been selected for the NHP POC pharmacology studies to mirror the intended clinical route and enable the use of a clinical administration system comparable to the one utilized in the planned clinical trial.
- the open field test measures locomotor activity and can be used to measure anxietylike behavior in rodents. It consists of a circular or square enclosure with an open, unobstructed field in the center of the apparatus.
- the open field arena sends out infrared beams from one side of the enclosure to the other. When a beam is broken by an animal moving through it, this is counted as a “beam break.”
- a mouse is placed in the enclosure, and study personnel exit the room. Mouse behavior is recorded using video tracking software for 30 minutes and beam breaks are quantified.
- Activity is and anxiety are evaluated based on movement occurring away from the walls of within the enclosure, including overall ambulatory activity in the center of the field (horizontal activity based on the number of x/y axis beam breaks) and along with the percent center beam breaks) and rearing behaviors (z-axis beam breaks).
- Cdkl5KO/Y mice have been shown to exhibit hyperactivity on open field testing consisting of increased ambulatory activity (increased x/y axis beam breaks) in the center of the field and increased rearing (increased z-axis beam breaks). Movement within the center of the arena (determined as the percent of beam breaks occurring in the center of the maze [i. e.
- the marble burying assay evaluates compulsive and hyperactivity phenotypes in rodents. Marble burying was evaluated in Cdkl5 KO mice because these mice have demonstrated hyperactivity phenotypes in other assays (e.g., open field test).
- mice are first acclimated in the home cage for 30 minutes. Mice are then placed in a test cage in which 12 marbles are pre-placed on top of a level mound of dry cage bedding (3 marbles by 4 marbles). The study personnel leaves the room, and the mouse is left for 30 minutes in the cage. After 30 minutes, the mouse is returned to its home cage, and the number of marbles that have been buried in the cage bedding by >50% are counted. A decrease the number of buried marbles would be expected to indicate an improvement in the hyperactivity phenotype of Cdkl5 KO mice following AAV administration. Elevated Zero Maze (Risk-Prone Behavior Testing)
- the elevated zero maze measures behaviors in rodents based on the animal’s ability to balance exploration/foraging behaviors (curiosity) and avoidance of potential dangers (risk-taking) (a test for anxiety-like behaviors).
- the elevated zero maze is a circularly shaped maze with alternating “open” and closed” quadrants.
- the elevated zero maze test is performed by first acclimating the mouse in the home cage for 30 minutes. The animal is then placed into an open area of the maze, which is illuminated by a lamp at one end of the apparatus to create brightly lit open areas and poorly lit enclosed areas. The study personnel leaves the room, and the animal is video recorded for approximately 15 minutes.
- Cdkl5 KO mice have been shown to be more risk-prone on elevated zero maze testing, spending an increased amount of time in the brighter open zones compared to normal control mice, which instead spend a greater amount of time in the darker enclosed areas of the apparatus (Wang et al., 2012).
- a reduction in the number of entries into the open zone, time spent in the open zone, and/or total distance traveled by Cdkl5 KO mice while in the maze would be expected to indicate an improvement in the disease phenotype following AAV administration.
- Nest building is a home cage social behavior in rodents that is important for shelter, heat conservation, and reproduction.
- Nesting involves mice shredding materials, such as tightly packed cotton or twine that has been placed in the cage, and then arranging it into a nest (Deacon 2006).
- Cdkl5 KO mice demonstrate impaired nest-building behaviors characterized by either failed nest building (i.e., no shredding of the nestlet to create material for nest construction) or poor quality nest building, suggesting a defect in social behavior.
- Nest building is assessed by first acclimating the mouse for approximately 24 hours in the test room. Mice are then singly housed with a pre-weighed cotton square nestlet in the late afternoon.
- Hindlimb clasping is a motor control phenotype observed in Cdkl5 KO mice in which animals pull their hindlimbs in toward their body and clasp them together when held upside down (Wang, 2012). Hindlimb clasping is assessed by suspending a mouse over its cage by its tail for 20-30 seconds and observing the behavior of its hindlimbs according to the scoring system presented in Table immediately below. A reduction in cumulative hindlimb clasping scores would be expected to indicate an improvement in the motor phenotype of Cdkl5 KO mice following AAV administration.
- the Y maze spontaneous alteration test assesses the exploratory activity of mice and evaluates spatial working memory.
- the apparatus for the test is an opaque Y-shaped enclosed maze with three arms placed at 120° angles from each other.
- the animal is first placed in the center of the maze.
- the study personnel exit the room, and the mouse is allowed to freely explore the maze for approximately 5 minutes.
- the animal’s movements are recorded on video to assess arm entries, which are defined as the animal moving all four limbs fully into an arm of the maze. Since normal mice usually prefer to investigate a new arm of the maze instead of returning to a portion of the maze that it previously explored, normal mice are expected to exhibit a tendency to explore an arm of the maze that it visited less recently.
- spontaneous alternation The tendency to visit an arm of the maze that was less recently explored is referred to as spontaneous alternation, and the percent spontaneous alternation is calculated by dividing the number of spontaneous alternations by the total number of entries minus 2 and multiplying the result by 100 Since Cdkl5 KO mice exhibit reduced spontaneous alternations on the Y maze test relative to WT, an increase in the percentage of spontaneous alternations would be expected to indicate an improvement in the exploratory /spatial working memory phenotype of Cdkl5 KO mice following AAV administration.
- the contextual fear condition test assesses the learning and memory capacity of rodents.
- a training phase is performed in which mice are placed in conditioning chambers for 3 minutes, at the end of which time, the mice receive a 1.5 mA shock to the foot. Mice are then left in the chamber for 1 minute after the shock. The next day, mice are returned to the conditioning chamber again for the testing phase for 5 minutes. The animal is video recorded and the proportion of tune that the animals spends frozen (i.e., no motion detected except for respiratory movements) during the test phase is determined.
- Cdkl5 KO mice typically spend a shorter proportion of the test phase frozen, which is indicative of a deficiency in learning and memory. An increase in the proportion of the test time spent frozen would therefore indicate an improvement in the learning and memory deficits of Cdkl5 KO mice following AAV administration (Yennawar, 2019).
- CDKL5 Protein Transgene Product Expression - CDKL5 Protein (Western Blot, Immunofluorescence), CDKL5 mRNA (In Situ Hybridization, qPCR, Single-Cell RNAseq)
- transgene product in the diseaserelevant target tissue has been evaluated at the level of mRNA by human CDKL5 in situ hybridization, human CDKL5 qPCR, and single-cell RNAseq.
- expression of the transgene product in the disease-relevant target tissue has been evaluated at the level of protein by CDKL5 Western blotting, which detects both human CDKL5 and endogenous mouse CDKL5, and human CDKL5 immunofluorescence using an anti-human CDKL5 antibody.
- AAV administration would be expected to increase CDKL5 expression in the brain where the protein is needed for normal neuronal function.
- the kinase activity of CDKL5 can be assessed by measuring phosphorylation of its substrates, including the microtubule-associated protein EB2.
- CDKL5 kinase activity is assessed in the disease-relevant target tissue (brain) of Cdkl5 KO mice by phospho-EB2 Western blotting using an antibody that recognizes phosphorylation of serine 222.
- AAV administration would be expected to increase the abnormally low level of EB2 phosphorylation that is typically observed in the brain of Cdkl5 KO mice.
- Example 9 Further Evaluation the pharmacology, safety, and toxicology of AAVhu68.UbC.hCDKL5-1co.miR183.rBG: A. Proof-of-Concept Pharmacology and Assay Development Study Evaluating the Efficacy of a rAAV Vector in a Mouse Model of CDD
- AAVhu68.hSyn.hCDKL5- lco.WPRE.SV40 utilizes the same capsid (AAVhu68) and expresses the same transgene product (human CDKL5 isoform 1).
- AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 includes a different promoter (hSyn versus UbC) and polyA (SV40 versus rBG), incorporates a WPRE sequence 3’ to the transgene sequence, and lacks the miR183 target sequences for DRG detargeting.
- FIG. 15A to 15F show results of the open field test in Male Cdkl5 K0/Y Mice and Female Cdkl5 K0/x Mice following ICV administration of an AAV vector expressing human CDKL5.
- FIG. 15 A shows results of the horizontal activity open field test in males, plotted as X/Y-Axis beam breaks.
- FIG. 15B shows results of the horizontal activity open field test in females, plotted as X/Y-Axis beam breaks.
- FIG. 15C shows results of the rearing open field test in males, plotted as Z-axis beam breaks.
- FIG. 15D shows results of the rearing open field test in females, plotted as Z-axis beam breaks.
- FIG. 15 A shows results of the horizontal activity open field test in males, plotted as X/Y-Axis beam breaks.
- FIG. 15B shows results of the horizontal activity open field test in females, plotted as X/Y-Axis beam breaks.
- FIG. 15C shows results
- FIG. 15E shows results of the center activity open field test in males, plotted as percent center beam breaks.
- FIG. 15F shows results of the center activity open field test in females, plotted as percent center beam breaks.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5 cyclin-dependent kinase-like 5 (gene, mouse); GC, genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- WT wild type.
- AAV-treated male Cdkl5 KO mice exhibited a trending reduction in risk-prone behavior as evidenced by spending less time on average in the open zone of the maze when compared to vehicle-treated male Cdkl5 K0/Y mice; however, the reduction was not statistically significant.
- the increase in risk-prone behavior compared to that of healthy sex-matched vehicle-treated wild type controls was minor, and while a trending reduction in open zone time following AAV administration in female Cdkl5 K0/x mice was observed, the difference was not significant (FIGs. 39A, 39B, 40A, 40B, 41A, 41B).
- AAV -treated female Cdkl5 K0/x mice exhibited a marked reduction in risk-prone behavior as evidenced by significantly fewer open zone entries when compared to that of vehicle-treated female Cdkl5 K0/x mice, with AAV treatment normalizing entries into the open zone to near-wild type levels.
- the risk-prone phenotype assessed by this parameter was not evident in male Cdkl5 K0/Y mice, with vehicle-treated male Cdkl5 K0/Y mice exhibiting a similar number of entries into the open zone as that of healthy sex-matched vehicle-treated wild type controls, therefore precluding the use of this parameter in males for evaluation of AAV treatment efficacy (FIGs. 39A, 39B, 40A, 40B, 41A, 4 IB).
- FIG. 39A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as time (sec) in open zone.
- FIG. 39B shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as time (sec) in open zone.
- FIG. 40A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as open zone entries.
- FIG. 39A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as open zone entries.
- FIG. 40B shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as open zone entries.
- FIG. 41A shows results of the elevated zero maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as total distance moved.
- FIG. 4 IB shows results of the elevated zero maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as total distance moved.
- the elevated zero maze test was performed. *p ⁇ 0.05; **p ⁇ 0.01; ***p ⁇ 0.001 based on a one-way ANOVA followed by Sidak’s multiple comparisons test comparing all groups to each other except for AAV -treated wild type mice.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5 cyclin-dependent kinase-like 5 (gene, mouse); GC, genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- WT wild type.
- AAV -treated male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice displayed an improved quality of nests, as evidenced by a significant increase in nest building quality scores and a significant decrease in the percent of intact nestlets compared to that of vehicle-treated male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice, respectively.
- AAV treatment normalized both nest building quality scores and the size of intact nestlets to wild type levels (FIGs. 10A and 10F).
- FIG. 10F shows results of the nest building test in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent weight of original nestlet weight intact.
- the nest building test was performed. Nest quality scores were assigned and the percent of the original intact nestlet based on weight was measured.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5, cyclin-dependent kinase-like 5 (gene, mouse); GC genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- WT wild type.
- AAV-treated male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice displayed significantly reduced hindlimb clasping scores compared to that of vehicle-treated male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice, respectively, indicating a significant improvement in motor control.
- AAV-treated female Cdkl5 K0/x mice exhibited an increase in the percent of spontaneous alternations when compared to vehicle-treated female Cdkl5 K0/x mice, with AAV treatment normalizing the percent alternations to near-wild type levels. This result indicated that AAV treatment increased the tendency of female Cdkl5 K0/x mice to explore less recently visited arms of the maze, which is suggestive of an improvement in spatial leaming/memory.
- FIG. 42A shows results of Y maze test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent spontaneous alterations.
- FIG. 42B shows results of Y maze test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent spontaneous alterations.
- the Y maze test was performed. *p ⁇ 0.05 based on a one-way ANOVA followed by Sidak’s multiple comparisons test comparing all groups to each other except for AAV-treated wild type mice.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5, cyclin-dependent kinase-like 5 (gene, mouse); GC genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- WT wild type.
- AAV -treated female Cdkl5 K0/x mice displayed a significant increase in percent freezing behavior compared that of vehicle-treated female Cdkl5 K0/x mice, indicating a significant improvement in the phenotype following AAV administration.
- AAV treatment in female Cdkl5 K0/x mice increased percent freezing to the level of healthy sex-matched wild type controls, indicating a normalization of the phenotype.
- AAV treatment in male Cdkl5 K0/Y mice did not significantly increase the percent freezing compared that of vehicle-treated male Cdkl5 K0/Y mice, indicating that AAV administration did not improve this phenotype in male Cdkl5 K0/Y mice despite significant efficacy in female Cdkl5 K0/x mice (FIG. 43A and 43B).
- FIG. 43A shows results of contextual fear conditioning test in male Cdkl5 K0/Y mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent freezing.
- FIG. 43B shows results of contextual fear conditioning test in female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5, plotted as percent freezing.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5 cyclin-dependent kinase-like 5 (gene, mouse)
- GC genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- WT wild type.
- Improvements in behavioral phenotypes correlated with a normalization of transgene product expression and activity following AAV administration to male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice. Specifically, the absence of detectable brain CDKL5 protein expression that was observed in vehicle-treated male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice was restored to wild type levels in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice at 14 weeks following AAV administration.
- FIG. 44A shows results of a transgene product expression in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5 (CDKL5/tubulin).
- FIG. 44B shows results of an activity in male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice following ICV administration of an AAV vector expressing human CDKL5 (pS222/Total EB2).
- mice and female Cdkl5 K0/x mice received a single ICV administration of either AAVhu68.hSyn.hCDKL5 lco.WPRE.SV40 at a dose of 5.0 x 10 10 GC or vehicle (PBS).
- Additional age-matched C57BL/6 wild type mice were ICV-administered either AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 (5.0 x IO 10 GC) or vehicle (PBS) as controls.
- AAV adeno-associated virus
- ANOVA analysis of variance
- Cdkl5 cyclin-dependent kinase-like 5 (gene, mouse); GC, genome copies
- ICV intracerebroventricular
- KO knockout
- N number of animals
- PBS phosphate-buffered saline
- PND postnatal day
- pS222 phospho-serine 222
- WT wild type.
- the most sensitive assays for evaluating the efficacy of AAV administration in the CDD mouse model were the open field test, nest building test, and hindlimb clasping test. Specifically, on the open field test, both male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice exhibited normalization of hyperactivity following AAV treatment, as evidenced by a significant reduction in horizontal activity and rearing to wild type levels. The treatment effect on the open field test was most obvious in male Cdkl5 K0/Y mice, as males displayed a markedly more severe phenotype than that of female Cdkl5 K0/x mice on this assay, resulting in increased test sensitivity for male Cdkl5 K0/Y mice.
- both male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice exhibited a normalization in the nest building defects following AAV administration characterized by significantly increased nest building scores and significantly reduced nestlet weights, both of which were normalized to wild type levels.
- both male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice also exhibited an improvement in the motor coordination phenotype following AAV administration characterized by significantly reduced hindlimb clasping scores, although the phenotype was not fully normalized to wild type levels.
- Some tests (marble burying test and Y maze test) were shown to be ineffective for evaluating the ODD mouse model phenotype because minimal to no phenotypic abnormalities were observed for vehicle-treated male Cdkl5 K0/Y mice and/or female Cdkl5 K0/x mice when compared to healthy wild type controls, making the future evaluation of a dose-dependent treatment effect challenging with these assessments.
- one additional test (contextual fear conditioning) demonstrated an AAV treatment effect in only one sex (female Cdkl5 K0/x KO mice but not male Cdkl5 K0/Y mice), which precludes the use of this assessment in future pharmacology studies.
- the open field test, nest building test, and hindlimb clasping test were found to be the most sensitive assays for evaluating the efficacy of AAV administration in both male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice and were therefore selected for use in future pharmacology studies.
- This POC vector comparison study aimed to assess the safety, tolerability, and transgene product expression of two lead candidates (AAVhu68.hSyn.hCDKL5 lco.WPRE.SV40 [evaluated in Example 3 and Example 9A] and AAVhu68.UbC.hCDKL5- lco.SV40) following ICM administration to adult rhesus macaques.
- AAVhu68.hSyn.hCDKL5 lco.WPRE.SV40 and AAVhu68.UbC.hCDKL5 lco.SV40 utilize the same capsid (AAVhu68) and express the same transgene product (human CDKL5).
- AAVhu68.UbC.hCDKL5-lco.SV40 also includes the same promoter as AAVhu68.UbC.hCDKL5-lco.miR183.rBG (UbC).
- AAVhu68.hSyn.hCDKL5 lco.WPRE.SV40 includes a different promoter (hSyn versus UbC) and a WPRE sequence 3’ to the transgene sequence, while both vectors have a different polyA (SV40 versus rBG) and lack the miR183 target sequences for DRG detargeting found in AAVhu68.UbC.hCDKL5- lco.miR183.rBG.
- the disease-relevant target tissue (brain) along with additional highly perfused CNS (spinal cord), PNS (DRG, TRG, and sciatic nerve), and peripheral tissues were collected for evaluation of vector biodistribution.
- CNS spinal cord
- PNS PNS
- peripheral tissues were collected for evaluation of vector biodistribution.
- Brain, spinal cord, and PNS tissues were evaluated for histopathology as these are tissues that are highly transduced by the ICM route.
- Pituitary gland tissues were also evaluated for histopathology.
- Additional brain tissue was collected to assess transgene product expression (human CDKL5 mRNA expression by ISH and qPCR) in this disease-relevant target tissue.
- Serum was collected and stored for possible future assessment of NAbs to the vector capsid.
- PBMCs and tissue-resident lymphocytes were also collected and stored for possible future evaluation of T cell responses to the vector capsid and/or transgene product (IFN-y ELISpot).
- AAVhu68.UbC.hCDKL5-lco.miR183.rBG was well-tolerated, and no test article- related findings were observed on cage-side observations, neurological monitoring, or blood clinical pathology.
- a transient mild CSF lymphocytic pleocytosis >6 white blood cells [WBCs]/pL
- WBCs white blood cells
- the pleocytosis was asymptomatic and resolved without treatment by the following time point on Day 42.
- peripheral nerves sciatic nerve
- AAVhu68.hSyn.hCDKL5- lco.WPRE.SV40 led to a lower overall incidence of peripheral axonopathy, while AAVhu68.UbC.hCDKL5 lco.SV40 led to a lower overall severity of axonopathy.
- FIG. 45A shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a low dose.
- FIG. 45B shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a low dose.
- FIG. 45 C shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a mid-dose.
- FIG. 45B shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a mid-dose.
- 45D shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a mid-dose.
- FIG. 45E shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.hSyn.hCDKL5-lco.WPRE.SV40 at a high dose.
- FIG. 45F shows results of the vector biodistribution in adult rhesus macaques following ICM administration of an AAVhu68.UbC.hCDKL5-lco.SV40 at a high dose.
- AAVhu68 adeno- associated virus hu68
- DNA deoxyribonucleic acid
- GC genome copies
- ICM intra-cistema magna
- N number of animals
- NHP non-human primate
- qPCR quantitative polymerase chain reaction.
- transgene product expression human CDKL5 isoform 1 mRNA
- transgene product expression was detectable at all doses evaluated for both vectors in brain regions relevant to the treatment of CDD, including the cerebellum and throughout the cortex (FIG. 46).
- Transgene product expression was generally dosedependent for both vectors, with a lower level of expression observed for most brain regions at the low dose compared to that of the mid-dose and high dose for each vector. Comparing across vectors, expression levels for each brain region were generally similar at each respective dose when taking into account expected inter-animal variability.
- CDKL5 isoform 1 mRNA qPCR.
- CDKL5-1 cyclin- dependent kinase-like 5 (isoform 1); GC, genome copies; ICM, intra-cistema magna; mRNA, messenger ribonucleic acid; N, number of animals; NHP, non-human primate; qPCR, quantitative polymerase chain reaction.
- Histopathologic evaluation for both vectors on Day 56 revealed an asymptomatic axonopathy of the dorsal white matter tracts of the spinal cord and a peripheral nerve, which was considered secondary to DRG sensory neuron degeneration. While the incidence and severity of the axonopathy in the spinal cord was similar for both vectors, the severity in the peripheral nerve was slightly lower for AAVhu68.UbC.hCDKL5 lco.SV40 compared to that of AAVhu68.hSyn.hCDKL5 lco.WPRE.SV40 (Grade 1 versus Grade 2, respectively). Both vectors also demonstrated similarly robust vector transduction profiles and led to transgene product (human CDKL5 mRNA) in the disease-relevant target tissue (brain) on Day 56.
- transgene product human CDKL5 mRNA
- This POC pharmacology study evaluates the therapeutic efficacy of AAVhu68.UbC.hCDKL5-lco.miR183.rBG following ICV administration to neonatal male Cdkl5 K0/Y mice and female Cdkl5 K0/x mice in order to optimize the study design and assays to be used in the planned MED pharmacology study.
- Ongoing inlife assessments includes viability checks performed daily, body weight measurements performed weekly, and behavioral assessments performed at 10-11 weeks post treatment (open field, nest building, hindlimb clasping tests). Necropsies are performed 13-14 weeks post treatment.
- This pharmacology study evaluates the efficacy and determine the MED of ICV - administered AAVhu68.UbC.hCDKL5-lco.miR183.rBG in neonatal male Cdkl5 K0/Y mice.
- the vector used for this study is the toxicological vector lot that is manufactured for the planned GLP compliant NHP toxicology study.
- Four dose levels of AAVhu68.UbC.hCDKL5- lco.miR183.rBG is evaluated using ICV administration.
- the dose levels are selected based on the results from the ongoing POC pharmacology study evaluating the efficacy of AAVhu68.UbC.hCDKL5-lco.miR183.rBG administration in this mouse model of CDD (as described above), in addition to the POC safety and pharmacology study of AAVhu68.UbC.hCDKL5-lco.miR183.rBG conducted in adult African green monkeys (also, as described above).
- In-life assessments include viability checks performed daily, body weight measurements, and behavioral assessments (open field, nest building, hindlimb clasping tests). Necropsies are performed 13-14 weeks post treatment. At necropsy, blood is collected for CBC/differentials and serum clinical chemistry analysis. A list of tissues are collected for histopathological evaluation. Transgene product expression (CDKL5 Western blot, CDKL5 immunofluorescence) and activity (phosphorylation of EB2) are evaluated in the diseaserelevant target tissue (brain) and highly transduced peripheral tissues.
- the NHP (rhesus macaque) was selected for the planned toxicology study (Genotoxicity, Carcinogenicity, Reproductive Toxicity, and Developmental Toxicity Assessments).
- the highest dose evaluated is the maximum feasible dose based on anticipated vector titers and the maximum administration volume.
- the mid-dose and low dose are approximately 3 -fold and 10-fold lower than the maximum feasible dose, respectively. This range was selected to ensure that doses are distinct and encompass the dose range evaluated in the mouse MED pharmacology study. A 180 day study duration with an interim Day 90 necropsy time point for this toxicology study.
- the intrathecal (IT) ROA has the potential to achieve transgene delivery throughout the CNS.
- Studies in large animal models of lysosomal storage diseases (such as mucopolysaccharidosis [MPS] type I and MPS type VII) demonstrated that CSF delivery of AAV results in widespread transduction of neurons throughout the brain, which is the key target tissue for the treatment of CDD (Hinderer et al., 2014a; Hinderer et al., 2015; Gurda et al., 2016).
- ICM administration was therefore selected for the planned clinical trial, and the ICM route will be utilized in the planned NHP toxicology study to replicate the intended clinical ROA.
- ICM vector administration results in immediate vector distribution within the CSF compartment, and it is anticipated that both efficacy and toxicity is related to CNS vector exposure. Doses are therefore scaled by brain mass, which provides an approximation of the size of the CSF compartment. Dose conversions are based on a brain mass of 0. 15 g for a neonatal mouse (Gu et al., 2012), 90 g for a juvenile NHP (Herndon et al., 1998), 610 g from a 6-8-month infant, 780 g for an 8-12-month infant, and 960 g for a >12-month infant (Dekaban, 1978).
- Estimated brain weights for each age range for human infants were derived from the male and female brain weights presented in (Dekaban, 1978) by assuming an approximately linear increase in brain weight between that of newborns (370 g) and infants aged 4-8 months, resulting in a mean estimated brain weight of 488 g for >l- ⁇ 4 month old infants.
- the value of 610 g corresponds to the average brain weight for males and females
- the FIH trial is an open-label, multi-center, dose escalation study of AAVhu68.UbC.hCDKL5-lco.miR183.rBG administered via an intra-cistema magna (ICM) injection to evaluate safety, tolerability, and exploratory efficacy endpoints in pediatric (> 30 days of age) and adult subjects with CDKL5 deficiency disorder (CDD). A maximum of 36 subjects with CDD may be enrolled in the study. This study is initially enrolling subjects who are > 12 years of age in the first dose escalation cohort.
- ICM intra-cistema magna
- the dose escalation assesses a single ICM administration of two dose levels of AAVhu68.UbC.hCDKL5-lco.miR183.rBG.
- the AAVhu68.UbC.hCDKL5- lco.miR183.rBG dose levels to be tested is determined based on data from the murine MED study and GLP NHP toxicology study, and consists of a low dose (administered to Cohort 1) and a high dose (administered Cohort 2). Both dose levels are anticipated to confer therapeutic benefit, with the understanding that, if tolerated, the higher dose would be expected to be advantageous and advanced.
- the dose escalation portion of this study follows a 3+3 design. For each age group, three subjects are enrolled in a dose cohort. If safety data are deemed acceptable by the DSMB, the age cohort may proceed to the next dose level. Additionally, the next younger age cohort may begin enrolling at the same dose level tested in the older age cohort. If one of the first three subjects develops a safety review trigger (SRT) or based on DSMB guidance, additional up to three subjects will be enrolled into that same age and dose cohort.
- SRT safety review trigger
- the performance of the second dose-level cohort depends on the evolving safety, tolerability and efficacy data available.
- the dose level, size of the cohort, safety monitoring for subsequent cohorts are confirmed with the DSMB prior to enrollment.
- IP Investigational Product
- AE Adverse Events
- this 6-week window captures the time when maximal gene expression is expected based on nonclinical data. This duration between IP dosing of subjects may be further refined based on emerging nonclinical data to either shorten or prolong the interval between subject IP dosing in the final protocol.
- CDKL5 disorder is an independent clinical entity associated with early- onset encephalopathy. Eur J Hum Genet 21, 266-273, (2013).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3235593A CA3235593A1 (en) | 2021-10-18 | 2022-10-18 | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) |
| EP22884659.8A EP4419690A4 (en) | 2021-10-18 | 2022-10-18 | USEFUL COMPOSITIONS IN THE TREATMENT OF CDKL5 DEFICIENCY DISORDER (CDD) |
| MX2024004723A MX2024004723A (es) | 2021-10-18 | 2022-10-18 | Composiciones útiles en el tratamiento del trastorno por deficiencia de cdkl5 (cdd). |
| AU2022369293A AU2022369293A1 (en) | 2021-10-18 | 2022-10-18 | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) |
| KR1020247014950A KR20240100490A (ko) | 2021-10-18 | 2022-10-18 | Cdkl5 결핍 장애(cdd)의 치료에 유용한 조성물 |
| JP2024523457A JP2024542950A (ja) | 2021-10-18 | 2022-10-18 | Cdkl5欠損症(cdd)の治療において有用な組成物 |
| CN202280083857.7A CN118401667A (zh) | 2021-10-18 | 2022-10-18 | 用于治疗cdkl5缺乏症(cdd)的组合物 |
| US18/702,258 US20240425882A1 (en) | 2021-10-18 | 2022-10-18 | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) |
| IL312241A IL312241A (en) | 2021-10-18 | 2022-10-18 | Compositions useful in the treatment of CDKL5 deficiency disorder (CDD) |
| CONC2024/0006328A CO2024006328A2 (es) | 2021-10-18 | 2024-05-17 | Composiciones útiles en el tratamiento del trastorno por deficiencia de cdkl5 (cdd) |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163256827P | 2021-10-18 | 2021-10-18 | |
| US63/256,827 | 2021-10-18 |
Publications (4)
| Publication Number | Publication Date |
|---|---|
| WO2023069967A2 true WO2023069967A2 (en) | 2023-04-27 |
| WO2023069967A9 WO2023069967A9 (en) | 2023-08-24 |
| WO2023069967A3 WO2023069967A3 (en) | 2023-11-02 |
| WO2023069967A8 WO2023069967A8 (en) | 2024-05-16 |
Family
ID=86058644
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/078327 Ceased WO2023069967A2 (en) | 2021-10-18 | 2022-10-18 | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240425882A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4419690A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024542950A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240100490A (cg-RX-API-DMAC7.html) |
| CN (1) | CN118401667A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022369293A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3235593A1 (cg-RX-API-DMAC7.html) |
| CO (1) | CO2024006328A2 (cg-RX-API-DMAC7.html) |
| IL (1) | IL312241A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024004723A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023069967A2 (cg-RX-API-DMAC7.html) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025050032A1 (en) * | 2023-08-31 | 2025-03-06 | Ultragenyx Pharmaceutical Inc. | Methods of producing cdkl5 proteins and uses of the same |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20230003569A (ko) * | 2020-04-27 | 2023-01-06 | 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 | Cdkl5 결핍 장애 (cdd)의 치료에 유용한 조성물 |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HUE070436T2 (hu) * | 2017-10-23 | 2025-06-28 | Stoke Therapeutics Inc | Antiszensz oligomerek nonszensz-mediált RNS-lebomláson alapuló állapotok és betegségek kezelésére |
| WO2020132455A1 (en) * | 2018-12-21 | 2020-06-25 | The Trustees Of The University Of Pennsylvania | Compositions for drg-specific reduction of transgene expression |
| CA3133889A1 (en) * | 2019-04-24 | 2020-10-29 | The Trustees Of The University Of Pennsylvania | Compositions useful in treatment of rett syndrome |
| WO2021081217A1 (en) * | 2019-10-23 | 2021-04-29 | The Trustees Of The University Of Pennsylvania | Compositions for drg-specific reduction of transgene expression |
| US20230043046A1 (en) * | 2019-10-30 | 2023-02-09 | Amicus Therapeutics, Inc. | Recombinant CDKL5 Proteins, Gene Therapy and Production Methods |
| KR20230003569A (ko) * | 2020-04-27 | 2023-01-06 | 더 트러스티스 오브 더 유니버시티 오브 펜실베니아 | Cdkl5 결핍 장애 (cdd)의 치료에 유용한 조성물 |
-
2022
- 2022-10-18 MX MX2024004723A patent/MX2024004723A/es unknown
- 2022-10-18 CN CN202280083857.7A patent/CN118401667A/zh active Pending
- 2022-10-18 KR KR1020247014950A patent/KR20240100490A/ko active Pending
- 2022-10-18 IL IL312241A patent/IL312241A/en unknown
- 2022-10-18 WO PCT/US2022/078327 patent/WO2023069967A2/en not_active Ceased
- 2022-10-18 CA CA3235593A patent/CA3235593A1/en active Pending
- 2022-10-18 EP EP22884659.8A patent/EP4419690A4/en active Pending
- 2022-10-18 AU AU2022369293A patent/AU2022369293A1/en active Pending
- 2022-10-18 JP JP2024523457A patent/JP2024542950A/ja active Pending
- 2022-10-18 US US18/702,258 patent/US20240425882A1/en active Pending
-
2024
- 2024-05-17 CO CONC2024/0006328A patent/CO2024006328A2/es unknown
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025050032A1 (en) * | 2023-08-31 | 2025-03-06 | Ultragenyx Pharmaceutical Inc. | Methods of producing cdkl5 proteins and uses of the same |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4419690A4 (en) | 2026-01-21 |
| US20240425882A1 (en) | 2024-12-26 |
| AU2022369293A1 (en) | 2024-05-16 |
| WO2023069967A3 (en) | 2023-11-02 |
| CN118401667A (zh) | 2024-07-26 |
| CO2024006328A2 (es) | 2024-07-18 |
| WO2023069967A9 (en) | 2023-08-24 |
| IL312241A (en) | 2024-06-01 |
| MX2024004723A (es) | 2024-07-19 |
| KR20240100490A (ko) | 2024-07-01 |
| EP4419690A2 (en) | 2024-08-28 |
| CA3235593A1 (en) | 2023-04-27 |
| WO2023069967A8 (en) | 2024-05-16 |
| JP2024542950A (ja) | 2024-11-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230270884A1 (en) | Compositions useful for treatment of charcot-marie-tooth disease | |
| US20220202960A1 (en) | Compositions useful in treatment of rett syndrome | |
| US20240425882A1 (en) | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) | |
| US20220118108A1 (en) | Compositions useful in treatment of krabbe disease | |
| US20230167455A1 (en) | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) | |
| US20230190966A1 (en) | Compositions useful for treating gm1 gangliosidosis | |
| WO2023077143A1 (en) | Compositions useful in treatment of cdkl5 deficiency disorder (cdd) | |
| EP4405469A1 (en) | Compositions useful for treatment of charcot-marie-tooth disease | |
| WO2022094078A1 (en) | Compositions useful in treatment of rett syndrome | |
| US20240115733A1 (en) | Compositions and methods for treatment of niemann pick type a disease | |
| AU2024320694A1 (en) | Compositions and methods for treatment of spinal muscular atrophy | |
| EP4149564A1 (en) | Compositions useful in treatment of krabbe disease |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22884659 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18702258 Country of ref document: US Ref document number: MX/A/2024/004723 Country of ref document: MX Ref document number: 312241 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2024523457 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3235593 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024007532 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022369293 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2022369293 Country of ref document: AU Date of ref document: 20221018 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2024/0006328 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022884659 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022884659 Country of ref document: EP Effective date: 20240521 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202402649P Country of ref document: SG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22884659 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280083857.7 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2024/0006328 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 112024007532 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240417 |