WO2023064388A2 - Stereocilin promoters and uses thereof - Google Patents
Stereocilin promoters and uses thereof Download PDFInfo
- Publication number
- WO2023064388A2 WO2023064388A2 PCT/US2022/046444 US2022046444W WO2023064388A2 WO 2023064388 A2 WO2023064388 A2 WO 2023064388A2 US 2022046444 W US2022046444 W US 2022046444W WO 2023064388 A2 WO2023064388 A2 WO 2023064388A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- vector
- polynucleotide
- protein
- strc
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/16—Otologicals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/40—Systems of functionally co-operating vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
Definitions
- the polynucleotides described herein may be operably linked, e.g., to a polynucleotide encoding a desired expression product such as a protein or an inhibitory RNA, and may be administered to a subject, such as a human subject, to treat or prevent hearing loss (e.g., sensorineural hearing loss) or vestibular dysfunction (e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder).
- hearing loss e.g., sensorineural hearing loss
- vestibular dysfunction e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder.
- the invention provides a polynucleotide including a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof that includes nucleotides 280-560 of SEQ ID NO: 48 operably linked to a polynucleotide encoding a heterologous expression product.
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- the invention provides a nucleic acid vector containing the polynucleotide of any of the foregoing aspects.
- the functional portion of SEQ ID NO: 2 includes or consists of nucleotides 120-537 of SEQ ID NO: 2. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 2 includes or consists of nucleotides 35-530 of SEQ ID NO: 2.
- the STRC promoter consists of SEQ ID NO: 2.
- the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 280-560 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 280-564 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 124-560 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 124- 564 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- the protein is Actin Gamma 1 (ACTG1 ), Fascin Actin-Bundling Protein 2, Retinal (FSCN2), Radixin (RDX), POU Class 4 Homeobox 3 (POU4F3), TRIO and F-Actin Binding Protein (TRIOBP), Taperin (TPRN), Xin Actin Binding Repeat Containing 2 (XIRP2), Atonal BHLH Transcription Factor 1 (ATOH1 ), Growth Factor Independent 1 Transcriptional Repressor (GFI1 ), Cholinergic Receptor Nicotinic Alpha 9 Subunit (CHRNA9), Cholinergic Receptor Nicotinic Alpha 10 Subunit (CHRNA10), Calcium and Integrin Binding Family Member s (CIB3), Cadherin 23 (CDH23), Protocadherin 15 (PCDH15), Kinocilin (KNCN), Pejvakin (DFNB59), MKRN2 Opposite Strand (MKRN2OS), LIM Homeobox Protein 3 (L)
- the nucleic acid vector is a viral vector, plasmid, cosmid, or artificial chromosome. In some embodiments, the nucleic acid vector is a viral vector. In some embodiments, the viral vector is an adeno-associated virus (AAV) vector, an adenovirus vector, or a lentivirus vector. In some embodiments, the viral vector is an AAV vector.
- AAV adeno-associated virus
- the invention provides a two-vector system including: (a) a first nucleic acid vector containing a STRC promoter having: (i) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 ; or (ii) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof that includes nucleotides 252-537or 35-530 of SEQ ID NO: 2; operably linked to a first polynucleotide encoding an N-terminal portion of a stereocilin protein; and (b) a second nucleic
- the invention provides a two-vector system including: (a) a first nucleic acid vector containing a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof that includes nucleotides 280-560 of SEQ ID NO: 48 operably linked to a first polynucleotide encoding an N-terminal portion of a stereocilin protein; and (b) a second nucleic acid vector containing a second polynucleotide encoding a C-terminal portion of a stereocilin protein.
- a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
- the first and second nucleic acid vectors when introduced into a mammalian cell, undergo homologous recombination to form a recombined polynucleotide that encodes a full-length stereocilin protein.
- the first nucleic acid vector includes a splice donor signal sequence positioned 3’ of the first polynucleotide and a first recombinogenic region positioned 3’ of the splice donor signal sequence and the second nucleic acid vector includes a second recombinogenic region, a splice acceptor signal sequence positioned 3’ of the recombinogenic region, and the second polynucleotide positioned 3’ of the splice acceptor signal sequence.
- the first and second polynucleotides do not overlap.
- the first and second recombinogenic regions are the same.
- each of the first recombinogenic region and the second recombi nogen ic region is an AP gene fragment.
- the AP gene fragment includes or consists of the sequence of any one of SEQ ID NOs: 42-47.
- the AP gene fragment includes or consists of the sequence of SEQ ID NO: 45.
- the first nucleic acid vector further includes a degradation signal sequence positioned 3’ of the recombinogenic region and the second nucleic acid vector further includes a degradation signal sequence positioned between the recombinogenic region and the splice acceptor signal sequence.
- the second nucleic acid vector further includes a STRC promoter having: (i) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 ; or (ii) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof that includes nucleotides 252-537or 35-530 of SEQ ID NO: 2; operably linked to the second polynucleotide, in which the STRC promoter is positioned 5’ of the second polynucleotide.
- STRC promoter having: (i) at least 85% sequence identity (e.g.,
- the second nucleic acid vector further includes a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof that includes nucleotides 280-560 of SEQ ID NO: 48 operably linked to the second polynucleotide, in which the STRC promoter is positioned 5’ of the second polynucleotide.
- a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof that includes nucleotides 280-560 of SEQ ID NO: 48 operably linked to the second
- the STRC promoter in the second nucleic acid vector is the same (i.e., has the same nucleotide sequence) as the STRC promoter in the first nucleic acid vector. In some embodiments of any of the foregoing aspects, the STRC promoter in the second nucleic acid vector has a different nucleotide sequence than the STRC promoter in the first nucleic acid vector.
- the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 .
- the STRC promoter consists of SEQ ID NO: 1.
- the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof that includes nucleotides 252-537or 35-530 of SEQ ID NO: 2.
- the functional portion of SEQ ID NO: 2 includes or consists of nucleotides 252-537 of SEQ ID NO: 2. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 2 includes or consists of nucleotides 120-537 of SEQ ID NO: 2. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 2 includes or consists of nucleotides 35-530 of SEQ ID NO: 2.
- the STRC promoter consists of SEQ ID NO: 2.
- the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the STRC promoter has the sequence of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 280-560 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 280-564 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 124-560 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 124- 564 of SEQ ID NO: 48. In some embodiments of any of the foregoing aspects, the functional portion of SEQ ID NO: 48 includes or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- the first and/or second vectors include an intein degradation signal.
- the degradation signal is an N-degron and/or a C- degron.
- the N-degron and/or the C-degron are independently a CL1 , PB29, SMN, CIITA, or ODC degron.
- the degradation signal is an E. co// dihydrofolate reductase (ecDHFR) degradation signal.
- ecDHFR E. co// dihydrofolate reductase
- the degradation signal is an FKBP12 degradation domain (Banaszynski et al., Cell 126:995-1004, 2006).
- the degradation signal is a PEST degradation domain (Rechsteiner and Rogers, Trends Biochem Sci. 21 :267-271 , 1996). In some embodiments the degradation signal is a UbR tag ubiquitination signal (Chassin et al., Nat Commun. 10:2013, 2019). In some embodiments the degradation signal is a destabilized mutation of human ELRBD (Miyazaki et al., J. Am. Chem. Soc., 134:3942-3945, 2012).
- the first and second vectors when introduced into a mammalian (e.g., human) hair cell (e.g., inner hair cell, outer hair cell, Type I vestibular hair cell, or Type II vestibular hair cell), produce a first and second fusion protein, respectively, in which the first fusion protein includes the N-terminal portion of the stereocilin protein and the N-intein positioned 3’ thereto, and the second fusion protein includes the C-intein and the C-terminal portion of the stereocilin protein positioned 3’ thereto.
- a mammalian hair cell e.g., human
- the first fusion protein includes the N-terminal portion of the stereocilin protein and the N-intein positioned 3’ thereto
- the second fusion protein includes the C-intein and the C-terminal portion of the stereocilin protein positioned 3’ thereto.
- the C-terminus of the N-intein of the first fusion protein and the N-terminus of the C-intein of the second fusion protein are capable of forming a peptide bond, thereby producing a polypeptide including, from N-terminus to C-terminus, the N-terminal portion of the stereocilin protein, N-intein, C-intein, and the C-terminal portion of the stereocilin protein, in which the bound N-intein and C-intein are capable of self-excising and ligating the C-terminus of the N-terminal portion of the stereocilin protein and the N-terminus of the C-terminal portion of the stereocilin protein, thereby producing a full-length stereocilin protein.
- the split intein trans-splicing system is derived from a DnaE gene of one or more bacteria.
- the one or more bacteria are selected from the group consisting of Nostoc punctiforme (Npu), Synechocystis sp. PCC6803 (Ssp), Fischerella sp.
- PCC9605 Fsp
- Scytonema tolypothrichoides Sto
- Nodularia spumigena Nsp
- Nostoc flagelliforme Nfl
- Crocosphaera watsonii Cwa
- Chroococcidiopsis cubana Ccu
- Trichodesmium erythraeum Ter
- Rhodothermus marinus Rma
- Saccharomyces cerevisiae See
- Saccharomyces castellii Sea
- Saccharomyces unisporus Sun
- Zygosaccharomyces bisporus Zbi
- Torulaspora pretoriensis Tpr
- Mycobacteria tuberculosis Mtu
- Mycobacterium leprae Mie
- Mycobacterium smegmatis Msm
- the N-intein has a sequence of any one of SEQ ID NOs: 7, 9, 12, 14, 16-21 , 26, 28, 30, 32, 34, 36, 38, 49, 51 , 53, 55, and 57 and the C-intein has a sequence of any one of SEQ ID NOs: 8, 10, 11 , 13, 15, 22-25, 27, 29, 31 , 33, 35, 37, 39, 50, 52, 54, 56, and 58.
- the N-intein has the sequence of SEQ ID NO: 7 and the C-intein has the sequence of SEQ ID NO: 8.
- the N-intein has the sequence of SEQ ID NO: 7 and the C-intein has the sequence of SEQ ID NO: 10.
- the N-intein has the sequence of SEQ ID NO: 7 and the C-intein has the sequence of SEQ ID NO: 11. In some embodiments, the N- intein has the sequence of SEQ ID NO: 9 and the C-intein has the sequence of SEQ ID NO: 8. In some embodiments, the N-intein has the sequence of SEQ ID NO: 9 and the C-intein has the sequence of SEQ ID NO: 10. In some embodiments, the N-intein has the sequence of SEQ ID NO: 9 and the C-intein has the sequence of SEQ ID NO: 11. In some embodiments, the N-intein has the sequence of SEQ ID NO: 12 and the C-intein has the sequence of SEQ ID NO: 13.
- the N-intein has the sequence of SEQ ID NO: 14 and the C-intein has the sequence of SEQ ID NO: 15. In some embodiments, the N-intein has the sequence of SEQ ID NO: 16 and the C-intein has the sequence of SEQ ID NO: 22. In some embodiments, the N-intein has the sequence of SEQ ID NO: 19 and the C- intein has the sequence of SEQ ID NO: 23. In some embodiments, the N-intein has the sequence of SEQ ID NO: 20 and the C-intein has the sequence of SEQ ID NO: 24. In some embodiments, the N- intein has the sequence of SEQ ID NO: 21 and the C-intein has the sequence of SEQ ID NO: 25.
- the N-intein has the sequence of SEQ ID NO: 26 and the C-intein has the sequence of SEQ ID NO: 27. In some embodiments, the N-intein has the sequence of SEQ ID NO: 28 and the C- intein has the sequence of SEQ ID NO: 29. In some embodiments, the N-intein has the sequence of SEQ ID NO: 30 and the C-intein has the sequence of SEQ ID NO: 31 . In some embodiments, the N- intein has the sequence of SEQ ID NO: 32 and the C-intein has the sequence of SEQ ID NO: 33. In some embodiments, the N-intein has the sequence of SEQ ID NO: 34 and the C-intein has the sequence of SEQ ID NO: 35.
- the N-intein has the sequence of SEQ ID NO: 36 and the C- intein has the sequence of SEQ ID NO: 37. In some embodiments, the N-intein has the sequence of SEQ ID NO: 38 and the C-intein has the sequence of SEQ ID NO: 39. In some embodiments, the N- intein has the sequence of any one of SEQ ID NOs: 16-21 and the C-intein has the sequence of any one of SEQ ID NOs: 22-25. In some embodiments, the N-intein has the sequence of SEQ ID NO: 49 and the C-intein has the sequence of SEQ ID NO: 50.
- the N-intein has the sequence of SEQ ID NO: 51 and the C-intein has the sequence of SEQ ID NO: 52. In some embodiments, the N- intein has the sequence of SEQ ID NO: 53 and the C-intein has the sequence of SEQ ID NO: 54. In some embodiments, the N-intein has the sequence of SEQ ID NO: 55 and the C-intein has the sequence of SEQ ID NO: 56. In some embodiments, the N-intein has the sequence of SEQ ID NO: 57 and the C- intein has the sequence of SEQ ID NO: 58.
- the split intein trans-splicing system includes one or more inteins that perform protein trans-splicing only upon contact with a ligand.
- the ligand is selected from the group consisting of 4-hydroxytamoxifen, a peptide, a protein, a polynucleotide, an amino acid, and a nucleotide.
- a linking polynucleotide is used to link the 3’ end of the STRC promoter and the 5’ start site (ATG) of the first polynucleotide and/or the polynucleotide encoding a C-intein.
- the linking polynucleotide includes a Kozak sequence or a portion thereof.
- the linking polynucleotide includes a multiple cloning site or a portion thereof.
- the first nucleic acid vector further includes a polynucleotide encoding a signal peptide. In some embodiments, the polynucleotide encoding a signal peptide is placed 5’ of and in frame with the polynucleotide encoding the N-terminal portion of the stereocilin protein. In some embodiments of any of the foregoing aspects, the second nucleic acid vector further includes a polynucleotide encoding a signal peptide. In some embodiments, the polynucleotide encoding a signal peptide is placed 5’ of and in frame with the polynucleotide encoding the C-terminal portion of the stereocilin protein.
- neither the first nor the second polynucleotide encodes a full-length stereocilin protein. In some embodiments of any of the foregoing aspects, each of the first and second polynucleotides encodes about half of the stereocilin protein sequence.
- the second nucleic acid vector further includes a poly(A) sequence 3’ of the second polynucleotide.
- the first and second nucleic acid vectors do not include STRC untranslated regions (UTRs) that are not part of the promoters described herein. In some embodiments of any of the foregoing aspects, the first and second nucleic acid vectors include STRC UTRs. In some embodiments of any of the foregoing aspects, the first nucleic acid vector includes a 5’ STRC UTR 5’ of the first polynucleotide. In some embodiments of any of the foregoing aspects, the second nucleic acid vector includes a 3’ STRC UTR 3’ of the second polynucleotide.
- the first and second polynucleotides that encode portions of the stereocilin protein do not include introns (e.g., the first and second polynucleotides are portions of STRC cDNA). In some embodiments of any of the foregoing aspects, the first and second polynucleotides that encode portions of the stereocilin protein include introns.
- the vestibular hair cell is a Type II vestibular hair cell.
- the stereocilin protein is a human stereocilin protein having at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 3.
- the stereocilin protein has the sequence of SEQ ID NO: 3.
- the human stereocilin protein is encoded by a polynucleotide having at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 5.
- the polynucleotide that has at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 5 encodes the stereocilin protein of SEQ ID NO: 3.
- the human stereocilin protein is encoded by a polynucleotide having the sequence of SEQ ID NO: 5.
- the stereocilin protein is a murine stereocilin protein having at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 4.
- the stereocilin protein has the sequence of SEQ ID NO: 4.
- the murine stereocilin protein is encoded by a polynucleotide having at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 6.
- the polynucleotide that has at least 85% (e.g., at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 6 encodes the stereocilin protein of SEQ ID NO: 4.
- the murine stereocilin protein is encoded by a polynucleotide having the sequence of SEQ ID NO: 6.
- the first and second vectors are viral vectors, plasmids, cosmids, or artificial chromosomes. In some embodiments, the first and second vectors are viral vectors. In some embodiments, the viral vectors are AAV vectors, adenovirus vectors, or lentivirus vectors. In some embodiments, the first and second vectors are AAV vectors.
- each of the first and second AAV vectors has an AAV1 , AAV2, AAV2quad(Y-F), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11 , rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ/8, DJ/9, 7m8, PHP.B, PHP.eB, or PHP.S capsid.
- each of the first and second AAV vectors has an AAV1 capsid.
- each of the first and second AAV vectors has an AAV9 capsid.
- each of the first and second AAV vectors has a 7m8 capsid. In some embodiments, each of the first and second AAV vectors has a PHP.S capsid. In some embodiments, each of the first and second AAV vectors has an Anc80 capsid. In some embodiments, each of the first and second AAV vectors has an Anc80L65 capsid. In some embodiments, each of the first and second AAV vectors has an AAV2 capsid. In some embodiments, each of the first and second AAV vectors has an AAV2quad(Y-F) capsid. In some embodiments, each of the first and second AAV vectors has a PHP.eB capsid.
- each of the first and second AAV vectors has an AAV3 capsid. In some embodiments, each of the first and second AAV vectors has an AAV4 capsid. In some embodiments, each of the first and second AAV vectors has an AAV5 capsid. In some embodiments, each of the first and second AAV vectors has an AAV6 capsid. In some embodiments, each of the first and second AAV vectors has an AAV7 capsid. In some embodiments, each of the first and second AAV vectors has an AAV8 capsid. In some embodiments, each of the first and second AAV vectors has a PHP.B capsid. In another aspect, the invention provides a composition containing the nucleic acid vector or two- vector system of any of the foregoing aspects or embodiments. In some embodiments, the composition further includes a pharmaceutically acceptable carrier, diluent, or excipient.
- the invention provides a cell containing the polynucleotide, nucleic acid vector, or two-vector system of any of the foregoing aspects or embodiments.
- the cell is a hair cell.
- the hair cell is a mammalian hair cell.
- the mammalian hair cell is a human hair cell.
- the hair cell is a cochlear hair cell.
- the cochlear hair cell is an outer hair cell.
- the cochlear hair cell is an inner hair cell.
- the hair cell is a vestibular hair cell.
- the vestibular hair cell is a type II vestibular hair cell.
- the vestibular hair cell is a type I vestibular hair cell.
- the invention provides a method of expressing a stereocilin protein in a hair cell by contacting the hair cell with the two-vector system or composition of any of the foregoing aspects or embodiments.
- the contacting is in vivo (e.g., in a subject).
- the stereocilin protein is specifically expressed in hair cells.
- the invention provides a method of treating a subject having or at risk of developing a balance disorder by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of inducing or increasing hair cell regeneration in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of increasing hair cell maintenance in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of increasing hair cell survival in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of preventing or reducing ototoxic drug- induced hair cell damage or death in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of preventing or reducing hair cell damage or death in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of improving hair cell function in a subject in need thereof by administering to an inner ear of the subject an effective amount of the nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- the invention provides a method of increasing or improving hair bundle attachment (e.g., OHC hair bundle attachment) to the tectorial membrane in a subject in need thereof, including administering to an inner ear of the subject an effective amount of the nucleic acid vector, two- vector system, or composition of any of the foregoing aspects or embodiments.
- hair bundle attachment e.g., OHC hair bundle attachment
- the hair cell is a mammalian hair cell. In some embodiments, the mammalian hair cell is a human hair cell. In some embodiments of any of the foregoing aspects, the hair cell is a hair cell that endogenously expresses STRC. In some embodiments of any of the foregoing aspects, the hair cell is a cochlear hair cell. In some embodiments, the cochlear hair cell is an outer hair cell. In some embodiments, the cochlear hair cell is an inner hair cell. In some embodiments of any of the foregoing aspects, the hair cell is a vestibular hair cell. In some embodiments, the vestibular hair cell is a type II vestibular hair cell. In some embodiments, the vestibular hair cell is a type I vestibular hair cell.
- the subject has or is at risk of developing hearing loss (e.g., sensorineural hearing loss, such as nonsyndromic hearing loss, auditory neuropathy, or deafness).
- hearing loss e.g., sensorineural hearing loss, such as nonsyndromic hearing loss, auditory neuropathy, or deafness.
- the hearing loss is genetic hearing loss.
- the genetic hearing loss is autosomal dominant hearing loss, autosomal recessive hearing loss, or X-linked hearing loss.
- the hearing loss is acquired hearing loss.
- the acquired hearing loss is noise- induced hearing loss, age-related hearing loss, disease or infection-related hearing loss, head trauma- related hearing loss, or ototoxic drug-induced hearing loss.
- the subject has or is at risk of developing vestibular dysfunction.
- the vestibular dysfunction is vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder.
- the vestibular dysfunction is age-related vestibular dysfunction, head trauma-related vestibular dysfunction, disease or infection-related vestibular dysfunction, or ototoxic drug-induced vestibular dysfunction.
- the vestibular dysfunction is associated with a genetic mutation.
- the vestibular dysfunction is idiopathic vestibular dysfunction.
- the ototoxic drug is an aminoglycoside (e.g., gentamycin, neomycin, streptomycin, tobramycin, kanamycin, vancomycin, or amikacin), an antineoplastic drug (e.g., a platinum-containing chemotherapeutic agent, such as cisplatin, carboplatin, and oxaliplatin), ethacrynic acid, furosemide, a salicylate (e.g., aspirin, particularly at high doses), or quinine.
- aminoglycoside e.g., gentamycin, neomycin, streptomycin, tobramycin, kanamycin, vancomycin, or amikacin
- an antineoplastic drug e.g., a platinum-containing chemotherapeutic agent, such as cisplatin, carboplatin, and oxaliplatin
- ethacrynic acid e.g., furosemide
- the hearing loss, vestibular dysfunction, or tinnitus is associated with loss of hair cells, damage to hair cells, or dysfunction of hair cells (e.g., cochlear and/or vestibular hair cells).
- the hearing loss or vestibular dysfunction is associated with abnormal hair cell stereocilia bundle deflection or impaired connectivity between the hair bundles (e.g., OHC hair bundles) and the tectorial membrane.
- the subject has a mutation in STRC. In some embodiments of any of the foregoing aspects, the subject has been identified as having a mutation in STRC. In some embodiments of any of the foregoing aspects, the method further includes identifying the subject as having a mutation in STRC prior to administering the two-vector system or pharmaceutical composition. In some embodiments of any of the foregoing aspects, the subject has deafness, autosomal recessive 16 (DFNB16). In some embodiments of any of the foregoing aspects, the subject has been identified as having DFNB16.
- DFNB16 autosomal recessive 16
- the method further includes evaluating the hearing of the subject prior to administering the nucleic acid vector, two-vector system, or composition (e.g., evaluating hearing using standard tests, such as audiometry, auditory brainstem response (ABR), electrocochleography (ECOG), or otoacoustic emissions).
- standard tests such as audiometry, auditory brainstem response (ABR), electrocochleography (ECOG), or otoacoustic emissions.
- the method further includes evaluating the hearing of the subject after administering the nucleic acid vector, two-vector system, or composition (e.g., evaluating hearing using standard tests, such as audiometry, ABR, ECOG, or otoacoustic emissions).
- the method further includes evaluating the vestibular function of the subject prior to administering the nucleic acid vector, two-vector system, or composition (e.g., evaluating vestibular function using standard tests, such as an electronystagmogram (ENG) or videonystagmogram (VNG), a test of the vestibulo-ocular reflex (VOR) (e.g., the head impulse test (Halmagyi-Curthoys test), which can be performed at the bedside or using a video-head impulse test (VHIT), or the caloric reflex test), posturography, rotary-chair testing, ECOG, vestibular evoked myogenic potentials (VEMP), or a specialized clinical balance test, such as those described in Mancini and Horak, Eur J Phys Rehabil Med, 46:239 (2010)).
- standard tests such as an electronystagmogram (ENG) or videonystagmogram (VNG)
- VOR vestibulo-ocular reflex
- VHIT video
- the method further includes evaluating the vestibular function of the subject after administering the nucleic acid vector, two-vector system, or composition (e.g., evaluating vestibular function using standard tests, such as an ENG, VNG, test of the VOR, posturography, rotary-chair testing, ECOG, VEMP, or a specialized clinical balance test).
- standard tests such as an ENG, VNG, test of the VOR, posturography, rotary-chair testing, ECOG, VEMP, or a specialized clinical balance test.
- the nucleic acid vector, two-vector system, or composition is locally administered. In some embodiments, the nucleic acid vector, two-vector system, or composition is administered to the inner ear. In some embodiments, the nucleic acid vector, two- vector system, or composition is administered to the middle ear. In some embodiments, the nucleic acid vector, two-vector system, or composition is administered to a semicircular canal. In some embodiments, the nucleic acid vector, two-vector system, or composition is administered transtympanically or intratympanically. In some embodiments, the nucleic acid vector, two-vector system, or composition is administered into the perilymph.
- the nucleic acid vector, two-vector system, or composition is administered into the endolymph. In some embodiments, the nucleic acid vector, two- vector system, or composition is administered to or through the oval window. In some embodiments, the nucleic acid vector, two-vector system, or composition is administered to or through the round window.
- the vectors in the two-vector system are administered concurrently. In some embodiments of any of the foregoing aspects, the vectors in the two- vector system are administered sequentially.
- the nucleic acid vector, two-vector system, or composition is administered in an amount sufficient to prevent or reduce vestibular dysfunction, delay the development of vestibular dysfunction, slow the progression of vestibular dysfunction, improve vestibular function, prevent or reduce hearing loss, prevent or reduce tinnitus, delay the development of hearing loss, slow the progression of hearing loss, improve hearing, improve speech discrimination, improve hair cell function, increase STRC expression in a hair cell, increase cochlear and/or vestibular hair cell numbers, increase cochlear and/or vestibular hair cell maturation, increase cochlear and/or vestibular hair cell regeneration, improve cochlear and/or vestibular hair cell function, prevent or reduce cochlear and/or vestibular hair cell damage, prevent or reduce cochlear and/or vestibular hair cell death, improve hair bundle attachment (e.g., OHC hair bundle attachment) to the tectorial membrane, or promote or increase cochlear and/or vestibular hair cell
- hair bundle attachment e.g., O
- the subject is a human subject.
- the invention provides a kit containing the polynucleotide, nucleic acid vector, two-vector system, or composition of any of the foregoing aspects or embodiments.
- administration refers to providing or giving a subject a therapeutic agent (e.g., a nucleic acid vector containing an STRC promoter operably linked to a transgene), by any effective route. Exemplary routes of administration are described herein below.
- a therapeutic agent e.g., a nucleic acid vector containing an STRC promoter operably linked to a transgene
- conservative amino acid families include (i) G, A, V, L, and I; (ii) D and E; (iii) C, S and T; (iv) H, K and R; (v) N and Q; and (vi) F, Y and W.
- a conservative mutation or substitution is therefore one that substitutes one amino acid for a member of the same amino acid family (e.g., a substitution of Ser for Thr or Lys for Arg).
- the terms “effective amount,” “therapeutically effective amount,” and a “sufficient amount” of a composition, vector construct, or viral vector described herein refer to a quantity sufficient to, when administered to the subject, including a mammal, for example a human, effect beneficial or desired results, including clinical results, and, as such, an “effective amount” or synonym thereto depends upon the context in which it is being applied. For example, in the context of treating sensorineural hearing loss or vestibular dysfunction, it is an amount of the composition, vector construct, or viral vector sufficient to achieve a treatment response as compared to the response obtained without administration of the composition, vector construct, or viral vector.
- a “therapeutically effective amount” of a composition, vector construct, or viral vector of the present disclosure is an amount which results in a beneficial or desired result in a subject as compared to a control.
- a therapeutically effective amount of a composition, vector construct, or viral vector of the present disclosure may be readily determined by one of ordinary skill by routine methods known in the art. Dosage regimen may be adjusted to provide the optimum therapeutic response.
- endogenous refers to a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is found naturally in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, a tissue, or a cell, such as a human cell, e.g., a human hair cell).
- a particular organism e.g., a human
- a particular location within an organism e.g., an organ, a tissue, or a cell, such as a human cell, e.g., a human hair cell.
- the term “express” refers to one or more of the following events: (1 ) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
- expression product refers to a protein or RNA molecule produced by any of these events.
- exogenous describes a molecule (e.g., a polypeptide, nucleic acid, or cofactor) that is not found naturally in a particular organism (e.g., a human) or in a particular location within an organism (e.g., an organ, a tissue, or a cell, such as a human cell, e.g., a human hair cell).
- Exogenous materials include those that are provided from an external source to an organism or to cultured matter extracted there from.
- exon refers to a region within the coding region of a gene, the nucleotide sequence of which determines the amino acid sequence of the corresponding protein.
- exon also refers to the corresponding region of the RNA transcribed from a gene. Exons are transcribed into pre-mRNA and may be included in the mature mRNA depending on the alternative splicing of the gene. Exons that are included in the mature mRNA following processing are translated into protein, wherein the sequence of the exon determines the amino acid composition of the protein.
- the term “functional portion,” when referring to a promoter sequence described herein refers to a nucleotide sequence that is shorter than a promoter sequence provided in Table 2 (e.g., SEQ ID NO: 2 or SEQ ID NO: 48) and is capable of recruiting RNA polymerase and driving transcription of a gene to which it is operably linked.
- a functional portion of the murine STRC promoter of SEQ ID NO: 2 (537 bases (b)) may have the sequence of or include nucleotides 252-537of SEQ ID NO: 2.
- STRC promoter of SEQ ID NO: 2 may have the sequence of or include nucleotides 120-537 or nucleotides 35-530 of SEQ ID NO: 2.
- a functional portion of the human STRC promoter of SEQ ID NO: 48 (564 bases (b)) may have the sequence of or include nucleotides 280-560 of SEQ ID NO: 48.
- Other functional portions of the STRC promoter of SEQ ID NO: 48 may have the sequence of or include nucleotides 280-564, nucleotides 124-560, nucleotides 124-564, nucleotides 61 - 560 (set forth in SEQ ID NO: 1 ), or nucleotides 1 -560 of SEQ ID NO: 48.
- heterologous refers to a combination of elements that is not naturally occurring.
- a heterologous transgene refers to a transgene that is not naturally expressed by the promoter to which it is operably linked.
- hair cell-specific expression refers to production of an RNA transcript or polypeptide primarily within hair cells (e.g., cochlear hair cells and/or vestibular hair cells) as compared to other cell types of the inner ear (e.g., spiral ganglion neurons, glia, or other inner ear cell types). Hair cell-specific expression of a transgene can be confirmed by comparing transgene expression (e.g., RNA or protein expression) between various cell types of the inner ear (e.g., hair cells vs.
- transgene expression e.g., RNA or protein expression
- a hair cellspecific promoter induces expression (e.g., RNA or protein expression) of a transgene to which it is operably linked that is at least 50% greater (e.g., 50%, 75%, 100%, 125%, 150%, 175%, 200% greater or more) in hair cells compared to at least 3 (e.g., 3, 4, 5, 6, 7, 8, 9, 10, or more) of the following inner ear cell types: Border cells, inner phalangeal cells, inner pillar cells, outer pillar cells, first row Deiter cells, second row Deiter cells, third row Deiter cells, Hensen’s cells, Claudius cells, inner sulcus cells, outer sulcus cells, spiral prominence cells, root cells, interdental cells, basal cells of the stria vascular
- a hair cell specific promoter does not have to induce expression in all hair cells but induces expression in at least one of one of the following hair cell types: inner hair cells, outer hair cells, type I vestibular hair cells, or type II vestibular hair cells.
- the STRC promoters described herein e.g., SEQ ID NO: 1 , SEQ ID NO: 2, and SEQ ID NO: 48, and portions thereof are hair cell-specific promoters.
- the terms “increasing” and “decreasing” refer to modulating resulting in, respectively, greater or lesser amounts, of function, expression, or activity of a metric relative to a reference.
- the amount of a marker of a metric e.g., transgene expression
- the amount of a marker of a metric may be increased or decreased in a subject by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 98% or more relative to the amount of the marker prior to administration.
- the metric is measured subsequent to administration at a time that the administration has had the recited effect, e.g., at least one week, one month, 3 months, or 6 months, after a treatment regimen has begun.
- intein also referred to as “protein intron,” refers to a portion of a protein that is typically 100-900 amino acid residues long and that is capable of self-excision and ligation of the flanking protein fragments (“exteins”) with a peptide bond. Inteins are produced during protein splicing.
- the term “intein” subsumes four different classes of inteins, including maxi-intein, mini-intein, trans-splicing intein, and alanine intein. Maxi-inteins refer to N- and C-terminal splicing regions of a protein containing an endonuclease domain.
- Endonuclease domains also known as “homing endonuclease genes” or “HEGs” refer to a class of endonucleases encoded as stand-alone genes within introns, as protein fusions with other proteins, or as self-splicing inteins. HEGs generally hydrolyze very few and often targeted DNA regions. Once a HEG hydrolyzes a piece of DNA, the gene encoding the HEG typically incorporates itself into the cleavage site, thereby increasing its allele frequency. Mini- inteins refer to N- and C-terminal splicing domains lacking the endonuclease domain.
- Trans-splicing inteins refer to inteins that are split into two or more domains which are further split into N-termini and C- termini.
- Alanine inteins refer to inteins having a splicing junction of an alanine instead of a cysteine or serine.
- An intein of a precursor protein may come in two genes; in such cases, the intein is designated a split “intein.”
- the term “intron” refers to a region within the coding region of a gene, the nucleotide sequence of which is not translated into the amino acid sequence of the corresponding protein.
- the term intron also refers to the corresponding region of the RNA transcribed from a gene. Introns are transcribed into pre-mRNA, but are removed during processing, and are not included in the mature mRNA.
- locally or “local administration” means administration at a particular site of the body intended for a local effect and not a systemic effect.
- local administration are epicutaneous, inhalational, intra-articular, intrathecal, intravaginal, intravitreal, intrauterine, intra-lesional administration, lymph node administration, intratumoral administration, administration to the inner ear, and administration to a mucous membrane of the subject, wherein the administration is intended to have a local and not a systemic effect.
- Stereocilin protein expression is limited to stereocilia in hair bundles of hair cells.
- Stereocilin is thought to form horizontal top connectors and tectorial membrane-attachment crowns, which are required for the normal functioning of the auditory apparatus (Avan et al., PNAS 116:25948-57 (2019); Verpy et al., J. Comp. Neurol. 519:194-210 (2011 )).
- Mice lacking stereocilin have been shown to exhibit abnormal hair cell bundles with defective cohesion and impaired hearing (Verpy et al., Nature 456:255-8 (2008)).
- the present disclosure provides polynucleotides encoding the full-length stereocilin protein, which, when incorporated into the vector systems described herein, may be used as a therapeutic agent for the treatment of hearing loss (e.g., sensorineural hearing loss) or vestibular dysfunction (e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder) in subjects in need thereof.
- hearing loss e.g., sensorineural hearing loss
- vestibular dysfunction e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder
- stereocilin and “STRC” also refer to variants of wildtype stereocilin protein and nucleic acids encoding the same, respectively, such as variant proteins having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more sequence identity) to the amino acid sequence of a wild-type stereocilin protein (e.g., SEQ ID NO: 3 or SEQ ID NO: 4) or polynucleotides having at least 85% sequence identity (e.g., 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more sequence identity) to the nucleic acid sequence of a wild-type STRC gene (e.g., SEQ ID NO: 5 or SEQ ID NO: 6), provided
- STRC promoter refers to promoter sequences having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% identity, or more sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2, such as, e.g., a portion containing nucleotides 252-537or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48, such as a portion containing nucleotides 280- 560 of SEQ ID NO: 48.
- transcription regulatory element refers to a polynucleotide that controls, at least in part, the transcription of a gene of interest. Transcription regulatory elements may include promoters, enhancers, and other polynucleotides (e.g., polyadenylation signals) that control or help to control gene transcription. Examples of transcription regulatory elements are described, for example, in Lorence, Recombinant Gene Expression: Reviews and Protocols (Humana Press, New York, NY, 2012).
- the terms “subject” and “patient” refer to an animal (e.g., a mammal, such as a human).
- a subject to be treated according to the methods described herein may be one who has been diagnosed with hearing loss (e.g., sensorineural hearing loss) or vestibular dysfunction (e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder) or one at risk of developing one or both of these conditions. Diagnosis may be performed by any method or technique known in the art.
- hearing loss e.g., sensorineural hearing loss
- vestibular dysfunction e.g., vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder
- Diagnosis may be performed by any method or technique known in the art.
- a subject to be treated according to the present disclosure may have been subjected to standard tests or may have been identified, without examination, as one at risk due to the presence of one or more risk factors associated
- transduction refers to a method of introducing a vector construct or a part thereof into a cell.
- the vector construct is contained in a viral vector such as for example an AAV vector
- transduction refers to viral infection of the cell and subsequent transfer and integration of the vector construct or part thereof into the cell genome.
- treatment and “treating” in reference to a disease or condition, refer to an approach for obtaining beneficial or desired results, e.g., clinical results.
- beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions; diminishment of extent of disease or condition; stabilized (i.e., not worsening) state of disease, disorder, or condition; preventing spread of disease or condition; delay or slowing the progress of the disease or condition; amelioration or palliation of the disease or condition; and remission (whether partial or total), whether detectable or undetectable.
- “Ameliorating” or “palliating” a disease or condition means that the extent and/or undesirable clinical manifestations of the disease, disorder, or condition are lessened and/or time course of the progression is slowed or lengthened, as compared to the extent or time course in the absence of treatment. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder, as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- vector refers to a nucleic acid vector, e.g., a DNA vector, such as a plasmid, cosmid, or artificial chromosome, an RNA vector, a virus, or any other suitable replicon (e.g., viral vector).
- a DNA vector such as a plasmid, cosmid, or artificial chromosome
- RNA vector a virus
- any other suitable replicon e.g., viral vector.
- a variety of vectors have been developed for the delivery of polynucleotides encoding exogenous proteins into a prokaryotic or eukaryotic cell. Examples of such expression vectors are described in, e.g., Gellissen, Production of Recombinant Proteins: Novel Microbial and Eukaryotic Expression Systems (John Wiley & Sons, Marblehead, MA, 2006).
- Expression vectors suitable for use with the compositions and methods described herein contain a polynucleotide sequence as well as, e.g., additional sequence elements used for the expression of proteins and/or the integration of these polynucleotide sequences into the genome of a mammalian cell.
- Certain vectors that can be used for the expression of transgene as described herein include vectors that contain regulatory sequences, such as promoter and enhancer regions, which direct gene transcription.
- Other useful vectors for expression of a transgene contain polynucleotide sequences that enhance the rate of translation of the transgene or improve the stability or nuclear export of the mRNA that results from gene transcription.
- sequence elements include, e.g., 5’ and 3’ untranslated regions and a polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- the expression vectors suitable for use with the compositions and methods described herein may also contain a polynucleotide encoding a marker for selection of cells that contain such a vector. Examples of a suitable marker include genes that encode resistance to antibiotics, such as ampicillin, chloramphenicol, kanamycin, or nourseothricin.
- FIG. 8 is a series of micrographs from the organ of Corti of an adult mouse administered an AAV vector expressing GFP under control of the STRC promoter of SEQ ID NO: 1 derived from plasmid P1208.
- Panels A and B show composite serial sections from different planes of the organ of Corti oriented left to right from base to apex.
- Panels A, A’ and A” show staining for Myo7a.
- Panel A’ is a higher magnification of the area shown in a solid rectangle in panel A.
- Panel A” is a higher magnification of the area shown in a dashed square in panel A.
- Panels B, B’ and B” show staining for GFP.
- FIG. 11 is a plasmid map of plasmid P1016.
- FIGS. 12A-12C are a series of fluorescent images of stereocilin expression in the mouse organ of Corti in a 200 pm 2 ROI at 16 kHz.
- FIG. 12A shows stereocilin antibody staining at the tips of the outer hair cell (OHC) stereocilia in a wild-type CBA/CaJ mouse.
- FIG. 12B 232 bp STRC knockout (KO) animals lacked the signal for the antibody.
- FIG. 12A shows stereocilin antibody staining at the tips of the outer hair cell (OHC) stereocilia in a wild-type CBA/CaJ mouse.
- 232 bp STRC knockout (KO) animals lacked the signal for the antibody.
- FIG. 12A shows stereocilin antibody staining at the tips of the outer hair cell (OHC) stereocilia in a wild-type CBA/CaJ mouse.
- FIG. 12B 232 bp STRC knockout (KO) animals lacked the signal for the antibody.
- 12C shows stereocilin antibody staining in a 232 bp STRC KO mouse administered dual Anc80 vectors, in which the first vector carried a CMV promoter and nucleotides 1 -3200 of the murine STRC cDNA and the vector second carried nucleotides 2201 -5430, creating a 1000 bp overlap between the two cDNA in the two vectors.
- De-novo stereocilin protein expression could be observed at the tips of the OHC stereocilia and in the body of inner hair cells of the organ of Corti in treated 232 bp STRC KO mice.
- FIG. 15 is a graph showing stereocilin protein expression levels detected using a single plasmid vector or an AAV dual vector system in HEK293T cells.
- Full-length control was plasmid DNA containing the full murine STRC coding sequence.
- GFP was also expressed using a plasmid.
- the AAV dual hybrid vectors tested differed in the split site used to divide the murine STRC sequence between the first and second vectors.
- Dual hybrid 1800 is a dual hybrid vector system in which the 5’ vector contained nucleotides 1 -1800 of murine STRC, with the remaining nucleotides of the STRC coding sequence starting at nucleotide 1801 contained in the 3’ vector).
- Overlapping was an overlapping dual AAV vector system in which the 5’ and 3’ vectors shared 1 ,000 nucleotides in common from the STRC coding sequence (the 5’ vector carried nucleotides 79-3278 of NM_080459 (corresponding to nucleotides 1 -3200 of SEQ ID NO: 6) and the 3’ vector carried nucleotides 2279-5508 (corresponding to nucleotides 2201 -5430 of SEQ ID NO: 6)).
- FIGS. 16A-16B are a series of micrographs taken from mouse neonatal cochlear explants infected with AAV vectors expressing enhanced GFP under control of various STRC promoters.
- the top row shows staining for hair cell marker Myo7a and GFP.
- the middle row shows only Myo7a staining.
- the bottom row shows only GFP staining. Control micrographs were obtained from untreated (no AAV infection) explants.
- FIG. 18 is a bar graph separately quantifying the percent of inner and outer hair cells that were positive for GFP in mouse neonatal cochlear explants infected with AAV vectors expressing enhanced GFP under control of various STRC promoters.
- Hair cells are sensory cells of the auditory and vestibular systems that reside in the inner ear.
- Cochlear hair cells are the sensory cells of the auditory system and are made up of two main cell types: inner hair cells, which are responsible for sensing sound, and outer hair cells, which are thought to amplify low-level sound.
- Vestibular hair cells are located in the semicircular canal end organs and otolith organs of the inner ear and are involved in the sensation of movement that contributes to the sense of balance and spatial orientation. Hair cells are named for the stereocilia that protrude from the apical surface of the cell, forming a hair cell bundle.
- vestibular dysfunction Damage to or loss of vestibular hair cells and genetic mutations that disrupt vestibular hair cell function are implicated in vestibular dysfunction, such as dizziness, vertigo, balance loss, bilateral vestibulopathy (also known as bilateral vestibular hypofunction), oscillopsia, and balance disorders.
- Gene therapy has recently emerged as an attractive therapeutic approach for treating hearing loss and vestibular dysfunction; however, the field is in need of methods to specifically target the nucleic acid vectors used in gene therapy to hair cells.
- the present invention is based, in part, on the discovery of STRC promoter sequences that can be used to induce gene expression in hair cells that endogenously express STRC (e.g., cochlear and vestibular hair cells).
- STRC promoters are hair cell-specific promoters.
- Stereocilin also known as DFNB16 is a protein encoded by the STRC gene on chromosome 15q 15, which contains 29 exons spanning approximately 19 kb of the genome.
- the STRC gene is tandemly duplicated, where the second copy contains a premature stop codon in exon 20, thereby producing an STRC pseudogene.
- Previous studies have identified two frameshift mutations and a large deletion in the full-length copy of STRC in two families with autosomal recessive non-syndromic sensorineural hearing loss (Verpy et al., Nat. Genet. 29:345-9 (2001 )).
- Stereocilin protein expression is limited to stereocilia in hair bundles of hair cells and stereocilin is thought to form horizontal top connectors and tectorial membrane-attachment crowns, which are required for the normal functioning of the auditory apparatus (Avan et al., PNAS 116:25948-57 (2019); Verpy et al., J. Comp. Neurol. 519:194- 210 (2011 )). Mice lacking stereocilin have been shown to exhibit abnormal hair cell bundles with defective cohesion and impaired hearing (Verpy et al., Nature 456:255-8 (2008)).
- the present invention is based, in part, on the discovery of a 500 base pair (bp) region located upstream of the human STRC translation start site and a 537 bp region located upstream of the mouse STRC translation start site that can be used to induce gene expression in hair cells that endogenously express STRC.
- bp 500 base pair
- compositions and methods described herein include STRC promoters listed in Table 2 (e.g., SEQ ID NO: 1 , SEQ ID NO: 2, or SEQ ID NO: 48) and portions thereof that are capable of expressing a desired expression product (e.g., a transgene) specifically in hair cells that endogenously express STRC (e.g., cochlear and vestibular hair cells), such as polynucleotide sequences that have at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, or SEQ ID NO: 48 or a functional portion of SEQ ID NO: 2 or SEQ ID NO: 48.
- a desired expression product e.g., a transgene
- STRC e.g., cochlear and vestibular
- the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 252-537 or 35-530 of SEQ ID NO: 2.
- the functional portion of SEQ ID NO: 2 is a larger portion of SEQ ID NO: 2 that includes nucleotides 252-537 of SEQ ID NO: 2, such as a portion that includes nucleotides 120-537 of SEQ ID NO: 2.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 is a larger portion of SEQ ID NO: 48 that includes nucleotides 280-560 of SEQ ID NO: 48, such as a portion that includes nucleotides 280-564 of SEQ ID NO: 48, nucleotides 124-560 of SEQ ID NO: 48, nucleotides 124-564 of SEQ ID NO: 48, or nucleotides 1 -560 of SEQ ID NO: 48.
- the STRC promoter for use in the compositions and methods described herein includes a portion that has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, nucleotides 252-537 of SEQ ID NO: 2, nucleotides 120-537 of SEQ ID NO:2, nucleotides 35-530 of SEQ ID NO:2, nucleotides 280-560 of SEQ ID NO: 48, nucleotides 280-564 of SEQ ID NO: 48, nucleotides 124-560 of SEQ ID NO: 48, nucleotides 124-564 of SEQ ID NO: 48, or nucleotides 1 -560 of SEQ ID NO:
- the STRC promoter for use in the compositions and methods described herein has the sequence of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, nucleotides 252-537 of SEQ ID NO: 2, nucleotides 120-537 of SEQ ID NO:2, nucleotides 35-530 of SEQ ID NO:2, nucleotides 280- 560 of SEQ ID NO: 48, nucleotides 280-564 of SEQ ID NO: 48, nucleotides 124-560 of SEQ ID NO: 48, nucleotides 124-564 of SEQ ID NO: 48, or nucleotides 1 -560 of SEQ ID NO: 48.
- STRC promoter sequences are listed in Table 2.
- the foregoing promoter sequences can be included in a nucleic acid vector and operably linked to a polynucleotide encoding a desired expression product (e.g., a polynucleotide encoding a protein of interest or an inhibitory RNA) to express the expression product specifically in hair cells (e.g., in hair cells that endogenously express STRC, such as cochlear hair cells (e.g., outer hair cells and inner hair cells) and vestibular hair cells (e.g., type I and type II vestibular hair cells)).
- a desired expression product e.g., a polynucleotide encoding a protein of interest or an inhibitory RNA
- hair cells e.g., in hair cells that endogenously express STRC, such as cochlear hair cells (e.g., outer hair cells and inner hair cells) and vestibular hair cells (e.g., type I and type II vestibular hair cells)
- the polynucleotide operably linked to the STRC promoter is a transgene that encodes a protein implicated in hair cell function, hair cell development, hair cell fate specification, hair cell regeneration, hair cell survival, or hair cell maintenance, or a transgene corresponding to the wild-type version of a gene that has been found to be mutated in subjects having hearing loss, deafness, auditory neuropathy, tinnitus, or vestibular dysfunction (e.g., dizziness, vertigo, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder).
- a transgene that encodes a protein implicated in hair cell function, hair cell development, hair cell fate specification, hair cell regeneration, hair cell survival, or hair cell maintenance
- a transgene corresponding to the wild-type version of a gene that has been found to be mutated in subjects having hearing loss, deafness, auditory neuropathy, tinnitus, or vestibular dysfunction (e.g., dizziness, ver
- the protein encoded by the transgene is Actin Gamma 1 (ACTG1 ), Fascin Actin-Bundling Protein 2, Retinal (FSCN2), Radixin (RDX), POU Class 4 Homeobox 3 (POU4F3), TRIO and F-Actin Binding Protein (TRIOBP), Taperin (TPRN), Xin Actin Binding Repeat Containing 2 (XIRP2), Atonal BHLH Transcription Factor 1 (ATOH1 ), Growth Factor Independent 1 Transcriptional Repressor (GFI1 ), Cholinergic Receptor Nicotinic Alpha 9 Subunit (CHRNA9), Cholinergic Receptor Nicotinic Alpha 10 Subunit (CHRNA10), Calcium and Integrin Binding Family Member 3 (CIB3), Cadherin 23 (CDH23), Protocadherin 15 (PCDH15), Kinocilin (KNCN), Pejvakin (DFNB59), MKRN2 Opposite Strand (MKRN2OS), LIM Home
- an STRC promoter described herein e.g., a polynucleotide having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48) is operably linked to a polynucleotide encoding an N-terminal portion of stereocilin (e.g., a polynucleotide encoding an N- terminal portion of SEQ ID NO: 3 or SEQ ID NO: 4) and incorporated into a first vector in a two-
- the full-length stereocilin coding sequence is too large to include in the type of vector that is commonly used for gene therapy (e.g., an AAV vector), but this problem can be solved by dividing the stereocilin coding sequence between two different nucleic acid vectors such that the full-length stereocilin sequence can be reconstituted in a cell (e.g., a hair cell).
- a cell e.g., a hair cell
- Such two-vector systems can be used to treat sensorineural hearing loss or vestibular dysfunction in a subject by administering to the inner ear of a subject a first nucleic acid vector containing a polynucleotide encoding an N-terminal portion of a stereocilin protein and a second nucleic acid vector containing a polynucleotide encoding a C-terminal portion of a stereocilin protein.
- These two-vector systems can be used to treat a subject having one or more mutations in the STRC gene, e.g., a STRC mutation that reduces stereocilin expression, reduces stereocilin function, or is associated with hearing loss or vestibular dysfunction.
- the polynucleotides encoding the N- terminal and C-terminal portions of stereocilin can combine within a cell (e.g., a human cell, e.g., a cochlear or vestibular hair cell) to form a single polynucleotide that contains the full-length stereocilin coding sequence (e.g., through homologous recombination and/or splicing).
- a cell e.g., a human cell, e.g., a cochlear or vestibular hair cell
- polynucleotides used in the two- vector systems described herein encode an N-terminal portion and a C-terminal portion of a stereocilin amino acid sequence in Table 3 below (e.g., two portions that, when combined, encode a full-length stereocilin amino acid sequence listed in Table 3, e.g., SEQ ID NO: 3 or SEQ ID NO: 4).
- no more than 10% of the amino acids in the N-terminal portion of the stereocilin protein and no more than 10% of the amino acids in the C- terminal portion of the stereocilin protein may be replaced with conservative amino acid substitutions.
- the stereocilin protein may be encoded by a polynucleotide having the sequence of SEQ ID NO: 5 or SEQ ID NO: 6.
- the stereocilin protein may also be encoded by a polynucleotide having single nucleotide polymorphisms (SNPs) that have been found to be non-pathogenic in human subjects.
- the nucleic acid vectors are designed such that the overlapping region is centered at or near a position within the stereocilin-encoding polynucleotide that corresponds to approximately half of the length of the stereocilin-encoding polynucleotide, with an equal amount of overlap on either side of the central position.
- the center of the overlapping region can also be chosen based on the size of the promoter and the locations of sequence elements of interest in the polynucleotide that encodes stereocilin.
- the stereocilin-encoding polynucleotide is split in two halves of approximately equal length with some degree of overlap (e.g., 200 b, 250 b, 300 b, 350 b, 400 b, 450 b, 500 b, 600 b, 700 b, 800 b, 900 b, 1 kb, 1 .1 kb, 1 .2 kb, 1 .3 kb, 1 .4 kb, 1 .5 kb, or more), in which the 5’ half of the polynucleotide encodes an N-terminal portion of the stereocilin protein and the 3’ half of the polynucleotide encodes a C- terminal portion of the stereocilin protein.
- some degree of overlap e.g. 200 b, 250 b, 300 b, 350 b, 400 b, 450 b, 500 b, 600 b, 700 b, 800 b, 900 b, 1 kb, 1 .1
- the first nucleic acid vector encodes an N-terminal portion of the stereocilin protein.
- the second nucleic acid vector encodes a C-terminal portion of the stereocilin protein.
- the stereocilin protein has the sequence of SEQ ID NO: 3 or at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity thereto.
- a second approach for expressing large proteins in mammalian cells involves the use of trans- splicing dual vectors.
- two nucleic acid vectors are used that contain distinct nucleic acid sequences, and the polynucleotide encoding the N-terminal portion of the protein of interest and the polynucleotide encoding the C-terminal portion of the protein of interest do not overlap.
- the first nucleic acid vector includes a splice donor sequence 3’ of the polynucleotide encoding the N-terminal portion of the protein of interest
- the second nucleic acid vector includes a splice acceptor sequence 5’ of the polynucleotide encoding the C-terminal portion of the protein of interest.
- the first and second nucleic acids When the first and second nucleic acids are present in the same cell, their ITRs can concatenate, forming a single nucleic acid structure in which the concatenated ITRs are positioned between the splice donor and splice acceptor. Trans-splicing then occurs during transcription, producing a nucleic acid molecule in which the polynucleotides encoding the N-terminal and C-terminal portions of the protein of interest are contiguous, thereby forming the full-length coding sequence.
- Trans-splicing dual vectors for use in the methods and compositions described herein are designed such that approximately half of the stereocilin coding sequence is contained within each vector (e.g., each vector contains a polynucleotide that encodes approximately half of the stereocilin protein, as is discussed above).
- the determination of how to split the polynucleotide sequence between the two nucleic acid vectors is made based on the size of the promoter and the locations of sequence elements of interest in the polynucleotide that encodes the stereocilin protein (e.g., exons of the STRC gene).
- the first vector in the trans-splicing dual vector system can contain a promoter sequence (e.g., an STRC promoter sequence, e.g., SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, or a functional portion of SEQ ID NO: 2 or SEQ ID NO: 48) 5’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein (e.g., an N-terminal portion of a stereocilin protein of SEQ ID NO: 3 or SEQ ID NO: 4).
- a promoter sequence e.g., an STRC promoter sequence, e.g., SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, or a functional portion of SEQ ID NO: 2 or SEQ ID NO: 48
- the nucleic acid vectors can optionally contain STRC UTRs (e.g., one or both of the 5’ and 3’ STRC UTRs, e.g., full-length UTRs) that are not part of the promoters described herein.
- STRC UTRs e.g., one or both of the 5’ and 3’ STRC UTRs, e.g., full-length UTRs
- One exemplary trans-splicing dual vector system for use in the compositions and methods described herein includes a first nucleic acid vector containing a STRC promoter described hereinabove (e.g., a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48) operably linked to a polynucleotide encoding an N-terminal portion of a stereocilin protein (e.g., a human stereocilin protein, e.g
- An alternative trans-splicing dual vector system includes a first nucleic acid vector containing a STRC promoter described hereinabove (e.g., a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48) operably linked to a polynucleotide encoding an N-terminal portion of the stereocilin protein (e.g., a murine stereocilin protein, e.g., an N-terminal portion of SEQ ID NO:
- the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 120-537 of SEQ ID NO: 2. In some embodiments, the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 35-530 of SEQ ID NO: 2.
- the STRC promoter is a polynucleotide having the sequence of SEQ ID NO: 48 or a functional portion thereof, or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity SEQ ID NO: 48 or a functional portion thereof.
- the STRC promoter is a functional portion of SEQ ID NO: 48 that is capable of controlling expression of the STRC gene.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 1 -560 of SEQ ID NO: 48.
- These nucleic acid vectors can also contain full-length 5’ and/or 3’ STRC UTRs that are not part of the promoters described herein in the first and second nucleic acid vectors, respectively (e.g., the first nucleic acid vector can contain the 5’ human STRC UTR in dual vector systems encoding human stereocilin, or the 5’ mouse UTR in dual vector systems encoding mouse stereocilin; and the second nucleic acid vector can contain the 3’ human STRC UTR in dual vector systems encoding human stereocilin, or the 3’ mouse STRC UTR in dual vector systems encoding mouse stereocilin).
- the stereocilin protein has the sequence of SEQ ID NO: 3 or at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity thereto.
- the stereocilin protein has the sequence of SEQ ID NO: 4 or at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity thereto.
- the polynucleotide that encodes a full-length murine stereocilin protein has the sequence of SEQ ID NO: 6 or is a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity SEQ ID NO: 6.
- the polynucleotide having at least 85% sequence identity to SEQ ID NO: 6 encodes the stereocilin protein of SEQ ID NO: 4.
- a third approach for expressing large proteins in mammalian cells involves the use of dual hybrid vectors.
- This approach combines elements of the overlapping dual vector strategy and the trans-splicing strategy in that it features both an overlapping region at which homologous recombination can occur and splice donor and splice acceptor sequences.
- the overlapping region is a recombinogenic region that is contained in both the first and second nucleic acid vectors, rather than a portion of the polynucleotide sequence encoding the protein of interest - the polynucleotide encoding the N-terminal portion of the protein of interest and the polynucleotide encoding the C-terminal portion of the protein of interest do not overlap in this approach.
- the recombinogenic region is 3’ of the splice donor sequence in the first nucleic acid vector and 5’ of the splice acceptor sequence in the second nucleic acid sequence.
- the first and second nucleic acid sequences can then join to form a single sequence based on one of two mechanisms: (1 ) recombination at the overlapping region; or (2) concatemerization of the ITRs.
- the remaining recombinogenic region(s) and/or the concatemerized ITRs can be removed by splicing, leading to the formation of a contiguous polynucleotide sequence that encodes the full-length protein of interest.
- Recombinogenic regions, splice donor sequences, and splice acceptor sequences that can be used in the compositions and methods described herein include those well-known to one of skill in the art.
- Exemplary recombinogenic regions include the F1 phage AK gene and alkaline phosphatase (AP) gene fragments as described in US Patent Nos.
- the AP gene fragment has the sequence of:
- the AP gene fragment has the sequence of:
- the AP gene fragment has the sequence of:
- the AP gene fragment has the sequence of:
- the AP gene fragment has the sequence of:
- the AP gene fragment has the sequence of:
- Dual hybrid vectors for use in the methods and compositions described herein are designed such that approximately half of the stereocilin coding sequence is contained within each vector (e.g., each vector contains a polynucleotide that encodes approximately half of the stereocilin protein).
- the determination of how to split the polynucleotide sequence between the two nucleic acid vectors is made based on the size of the promoter and the locations of sequence elements of interest in the polynucleotide that encodes the stereocilin protein (e.g., exons of the STRC gene).
- the first vector in the dual hybrid vector system can contain a promoter sequence 5’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein.
- the nucleic acid vectors can optionally contain STRC UTRs (e.g., full- length 5’ and/or 3’ UTRs) that are not part of the promoters described herein.
- One exemplary dual hybrid vector system includes a first nucleic acid vector containing a STRC promoter described hereinabove (e.g., a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48) operably linked to a polynucleotide
- the STRC promoter is a polynucleotide having the sequence of SEQ ID NO: 1 or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 1 .
- the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 120-537 of SEQ ID NO: 2. In some embodiments, the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 35-530 of SEQ ID NO: 2.
- the STRC promoter is a polynucleotide having the sequence of SEQ ID NO: 48 or a functional portion thereof, or a variant having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity SEQ ID NO: 48 or a functional portion thereof.
- the STRC promoter is a functional portion of SEQ ID NO: 48 that is capable of controlling expression of the STRC gene.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 1 -560 of SEQ ID NO: 48.
- the first and second nucleic acid vectors can also contain the full length 5’ and/or 3’ STRC UTRs, respectively (e.g., the human STRC 5’ UTR can be included in the first nucleic acid vector, and the human STRC 3’ UTR can be included in the second nucleic acid vector).
- Another exemplary dual hybrid vector system that includes a STRC promoter includes a first nucleic acid vector containing a STRC promoter described hereinabove (e.g., a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48) operably linked to polynucleotide encoding an N-terminal portion of a stereocilin protein (e.g., murine stereocilin, e.g., an N- terminal portion of SEQ ID NO:
- the first and second nucleic acid vectors can also contain the full length 5’ and/or 3’ STRC UTRs, respectively (e.g., the mouse STRC 5’ UTR can be included in the first nucleic acid vector, and the mouse STRC 3’ UTR can be included in the second nucleic acid vector).
- the stereocilin coding sequence can be divided at a different position than it would be in a dual hybrid vector system that does not include a STRC UTR.
- the first vector contains nucleotides 1 -2588 of a polynucleotide encoding stereocilin (e.g., nucleotides 1 -2588 of SEQ ID NO: 6), and the second vector contains the remaining nucleotides of the polynucleotide encoding stereocilin (e.g., nucleotides 2589-5430 of SEQ ID NO: 6).
- the sequence of the ITR in the transfer plasmid is not necessarily the same sequence that is found in the viral vector prepared therefrom.
- the splicing domain of inteins contains two subdomains, namely the N- and C-terminal splicing domains, which contain conserved motifs with conserved residues that mediate the splicing activity.
- the N-terminal splicing domain contains A, N2, B, and N4 structural motifs, whereas the C-terminal splicing domain contains F and G motifs.
- the A-motif contains Cys/Ser or Thr as conserved residues; the B motif includes His and Thr residues; F motif contains Asp and His residues; G motifs carry two conserved residues, which include a penultimate His and a terminal Asn.
- C, D, E, and H motifs are generally related to the HEG domain in maxi-inteins.
- Intein splicing falls within three distinct strategies: 1 ) class 1 (or classical/canonical) intein splicing which involves (a) a (N-S/N-O) acyl shift that transforms the peptide bond of an N-terminal splice junction to a thio(ester) linkage, (b) transesterification reaction that forms a branched intermediate, (c) Asn cyclization, which removes the branched intermediate by cleaving the C-terminal splice junction, and (d) a second (S-N/O-N) acyl shift that ligates the flanking extein segments through amide bond formation; 2) class 2 inteins (also known as Alanine-inteins) bypass step (a) of the classical splicing reaction; and 3) class 3 mechanism which involves the formation of two branched intermediates.
- class 1 or classical/canonical intein splicing which involves (a) a (N-S/N-O
- the present disclosure provides split intein trans-splicing systems for the packaging and delivery of a stereocilin coding sequence that is operably linked to a STRC promoter.
- This method allows for two separate polynucleotides, each containing approximately one half of the STRC gene and including a polynucleotide sequence encoding an N-intein fragment or a C-intein fragment, to be expressed from two separate expression vectors (e.g., any one of the nucleic acid vectors disclosed herein) and post- translationally reconstituted to produce a full-length stereocilin protein.
- Such systems may be incorporated into nucleic acid expression vectors disclosed herein, such as, e.g., rAAV vectors.
- the present disclosure provides a two-vector split intein system containing: a) a first nucleic acid vector containing a polynucleotide that includes a sequence encoding an N-terminal portion of a human stereocilin protein (e.g., an N-terminal portion of SEQ ID NO: 3 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to the amino acid sequence of SEQ ID NO: 3), in which the sequence encoding an N-terminal portion of a human stereocilin protein includes at its 3’ end an in-frame polynucleotide sequence encoding an N-intein; and b) a second vector containing a polynucleotide that includes a sequence encoding a C-terminal portion of a human stereocilin protein (e.
- the present disclosure provides a two-vector split intein system containing: a) a first vector containing a polynucleotide that includes a sequence encoding an N-terminal portion of a murine stereocilin protein (e.g., an N-terminal portion of SEQ ID NO: 4 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to the amino acid sequence of SEQ ID NO: 4), in which the sequence encoding an N-terminal portion of a murine stereocilin protein includes at its 3’ end an in-frame polynucleotide sequence encoding an N-intein; and b) a second vector containing a polynucleotide that includes a sequence encoding a C-terminal portion of a murine stereocilin protein (e.g.,
- the sequence of the N-terminal portion is nucleotides 1 -2190 of the polynucleotide encoding murine stereocilin (e.g., nucleotides 1 -2190 SEQ ID NO: 6) and the sequence of the C-terminal portion is from nucleotide 2191 to the 3’ end of the coding sequence of the polynucleotide encoding murine stereocilin (e.g., the remaining nucleotides of SEQ ID NO: 6, e.g., nucleotides 2191 - 5430).
- the sequence encoding an N-terminal portion of a murine stereocilin protein is a sequence encoding amino acids 1 -746 of the stereocilin protein (e.g., amino acids 1 -746 of SEQ ID NO: 4) and the sequence encoding the C-terminal portion of the murine stereocilin protein encodes the remaining amino acids of the stereocilin protein (e.g., amino acids 747-1809 of SEQ ID NO: 4).
- the sequence of the N-terminal portion is nucleotides 1 -2238 of the polynucleotide encoding murine stereocilin (e.g., nucleotides 1 -2238 SEQ ID NO: 6) and the sequence of the C-terminal portion is from nucleotide 2239 to the 3’ end of the coding sequence of the polynucleotide encoding murine stereocilin (e.g., the remaining nucleotides of SEQ ID NO: 6, e.g., nucleotides 2239- 5430).
- the sequence encoding an N-terminal portion of a murine stereocilin protein is a sequence encoding amino acids 1 -969 of the stereocilin protein (e.g., amino acids 1 -969 of SEQ ID NO: 4) and the sequence encoding the C-terminal portion of the murine stereocilin protein encodes the remaining amino acids of the stereocilin protein (e.g., amino acids 970-1809 of SEQ ID NO: 4).
- the sequence of the N-terminal portion is nucleotides 1 -2907 of the polynucleotide encoding murine stereocilin (e.g., nucleotides 1 -2907 SEQ ID NO: 6) and the sequence of the C-terminal portion is from nucleotide 2908 to the 3’ end of the coding sequence of the polynucleotide encoding murine stereocilin (e.g., the remaining nucleotides of SEQ ID NO: 6, e.g., nucleotides 2908- 5430).
- the sequence encoding an N-terminal portion of a murine stereocilin protein is a sequence encoding amino acids 1 -1002 of the stereocilin protein (e.g., amino acids 1 -1002 of SEQ ID NO: 4) and the sequence encoding the C-terminal portion of the murine stereocilin protein encodes the remaining amino acids of the stereocilin protein (e.g., amino acids 1003-1809 of SEQ ID NO: 4).
- the STRC promoter has the sequence of SEQ ID NO: 1 or is a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 1 .
- the STRC promoter has the sequence of SEQ ID NO: 2 or a portion thereof or is a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 2 or a portion thereof.
- the STRC promoter is a functional portion of SEQ ID NO: 2 that is capable of controlling expression of the STRC gene.
- the functional portion of SEQ ID NO: 2 includes or has the sequence of nucleotides 252-537 of SEQ ID NO: 2.
- the STRC promoter is a functional portion of SEQ ID NO: 48 that is capable of controlling expression of the STRC gene.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 280-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-560 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 124-564 of SEQ ID NO: 48.
- the functional portion of SEQ ID NO: 48 includes or has the sequence of nucleotides 1 -560 of SEQ ID NO: 48.
- the STRC promoter in the second nucleic acid vector is the same (i.e., has the same nucleotide sequence) as the STRC promoter in the first nucleic acid vector.
- the STRC promoter in the second nucleic acid vector has a different nucleotide sequence than the STRC promoter in the first nucleic acid vector.
- the N-intein of the first fusion protein and the C-intein of the second fusion protein selectively bind to produce a third fusion protein containing from N-terminus to C- terminus: an N-terminal portion of the stereocilin protein, an N-intein bound at its C-terminus to the C- intein, and the C-terminal portion of the stereocilin protein.
- the N-intein bound to the C-intein is capable of performing a trans-splicing reaction that excises the N-intein and the C-intein and ligates the C-terminus of the N-terminal portion and the N-terminus of the C-terminal portion of the stereocilin protein.
- Split inteins of the disclosed compositions and methods may be derived from the DnaE gene (e.g., DNA polymerase III subunit alpha) from cyanobacteria, such as, e.g., Nostoc punctiforme (Npu), Synechocystis sp. PCC6803 (Ssp), Fischerella sp.
- DnaE gene e.g., DNA polymerase III subunit alpha
- cyanobacteria such as, e.g., Nostoc punctiforme (Npu), Synechocystis sp. PCC6803 (Ssp), Fischerella sp.
- PCC9605 Fsp
- Scytonema tolypothrichoides Sto
- Nodularia spumigena Nsp
- Nostoc flagelliforme Nfl
- Crocosphaera watsonii Cwa
- Chroococcidiopsis cubana Ccu
- Trichodesmium erythraeum Ter
- Rhodothermus marines Rma
- Saccharomyces cerevisiae See
- Saccharomyces castellii Sea
- Saccharomyces unisporus Sun
- Zygosaccharomyces bisporus Zbi
- Torulaspora pretoriensis Tpr
- Mycobacteria tuberculosis Mtu
- Mycobacterium leprae Mie
- Mycobacterium smegmatis Msm
- the two-vector split intein system of the disclosure includes: a) a first vector containing from 5’ to 3’: i) optionally, a 5’ ITR (e.g., AAV2 5’ ITR); ii) a polynucleotide containing a STRC promoter (e.g., a STRC promoter of any one of SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 that includes nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to the nucleic acid
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 7 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 7, as is shown below.
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO: 8 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 8, as is shown below.
- VKIISRKSLGTQNVYDIGVEKDHNFLLKNGLVASN (SEQ ID NO: 8)
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO: 10 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 10, as is shown below.
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 7 or SEQ ID NO: 9 (e.g., positioned 3’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein) and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 8, SEQ ID NO: 10, or SEQ ID NO: 11 (e.g., positioned 5’ of a polynucleotide encoding a C-terminal portion of a stereocilin protein).
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 9 and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 10.
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 9 and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 11.
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 12 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 12, as is shown below.
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO: 13 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 13, as is shown below.
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 12 (e.g., positioned 3’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein) and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 13 (e.g., positioned 5’ of a polynucleotide encoding a C-terminal portion of a stereocilin protein).
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 14 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 14, as is shown below.
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of SEQ ID NO: 15 or having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to SEQ ID NO: 15, as is shown below.
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 14 (e.g., positioned 3’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein) and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 15 (e.g., positioned 5’ of a polynucleotide encoding a C-terminal portion of a stereocilin protein).
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CFSGDTLVALTD (SEQ ID NO: 16). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLAGDTLITLA (SEQ ID NO: 17). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLQNGTRLLR (SEQ ID NO: 18).
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLTGDSQVLTR (SEQ ID NO: 19). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLTYETEIMTV (SEQ ID NO: 20). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence of CLSGNTKVRFRY (SEQ ID NO: 21 ).
- the two-vector split intein system of the disclosure includes a polynucleotide encoding an N-intein peptide having an amino acid sequence that has least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to any one of SEQ ID NOs: 16-21 .
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of GVFVHN (SEQ ID NO: 22). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of GLLVHN (SEQ ID NO: 23). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding a C- intein peptide having an amino acid sequence of GLIASN (SEQ ID NO: 24).
- the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence of GLVVHN (SEQ ID NO: 25). In some embodiments, the two-vector split intein system of the disclosure includes a polynucleotide encoding a C-intein peptide having an amino acid sequence that has least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to any one of SEQ ID NOs: 22-25.
- the two-vector split intein system includes a first vector including a polynucleotide encoding an N-intein peptide having an amino acid sequence of SEQ ID NO: 19 (e.g., positioned 3’ of a polynucleotide encoding an N-terminal portion of a stereocilin protein) and a second vector including a polynucleotide encoding a C-intein polypeptide having an amino acid sequence of SEQ ID NO: 23 (e.g., positioned 5’ of a polynucleotide encoding a C-terminal portion of a stereocilin protein).
- the Npu C-intein of SEQ ID NO: 27 may be encoded by a polynucleotide having the DNA sequence of SEQ ID NO: 41 , as is shown below. ATCAAGATCGCCACAAGAAAGTACCTGGGCAAGCAGAACGTGTACGACATCGGCGT
- a split intein of the disclosure can include nucleophile amino acid at or near its N- or C- terminus that is capable of performing the trans-splicing reaction.
- the nucleophile amino acid is selected from serine, threonine, cysteine, or alanine.
- the first vector and/or the second vector further include one or more additional regulatory sequences, such as, e.g., a WPRE sequence, an enhancer sequence, a poly(A) sequence, a terminator sequence, or a degradation signal, among others.
- additional regulatory sequences such as, e.g., a WPRE sequence, an enhancer sequence, a poly(A) sequence, a terminator sequence, or a degradation signal, among others.
- the split intein system described herein includes a ligand-dependent intein, which performs protein splicing upon contact with a ligand (e.g., small molecules such as 4- hydroxytamoxifen, peptides, proteins, polynucleotides, amino acids, nucleotides, etc.).
- a ligand e.g., small molecules such as 4- hydroxytamoxifen, peptides, proteins, polynucleotides, amino acids, nucleotides, etc.
- ligand e.g., small molecules such as 4- hydroxytamoxifen, peptides, proteins, polynucleotides, amino acids, nucleotides, etc.
- the N-intein protein includes one or more (e.g., 2, 3, 4, 5, or more) degrons.
- the C-intein protein includes one or more (e.g., 2, 3, 4, 5, or more) degrons.
- the degron is a CL1 degron, which is a C-terminal destabilizing peptide that shares structural similarity with misfolded proteins and is recognized by the ubiquitination system.
- the degron is a PB29, SMN, CIITA, or ODC degron.
- Such degradation signals are described in WO 2016/13932, which is incorporated by reference herein as it relates to degradation signals.
- Another example of a degradation signal includes the E.
- Proteins that can be expressed in connection with the compositions described herein are proteins that are expressed in healthy hair cells (e.g., cochlear and/or vestibular hair cells, e.g., proteins that play a role in hair cell development, function, regeneration,
- an STRC promoter e.g., a polynucleotide having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48 are proteins that are expressed in healthy hair cells (e.g., cochlear and
- Proteins that can be expressed in hair cells using the compositions and methods described herein include ACTG1 , FSCN2, RDX, POU4F3, TRIOBP, TPRN, XIRP2, ATOH1 , GFI1 , CHRNA9, CHRNA10, CIB3, CDH23, PCDH15, KNCN, DFNB59, MKRN2OS, LHX3, TMC1 , MYO15, MYO7A, MYO6, MYO3A, MYO3B, GRXCR1 , PTPRQ, LCE6A, LOXHD1 , ART1 , ATP2B2, CIB2, CACNA2D4, EPS8, EPS8L2, ESPN, ESPNL, PRPH2, SLC8A2, ZCCHC12, LRTOMT2, LRTOMT1 , USH1 C, SLC26A5, PIEZO2, ELFN1 , TTC24, DYTN, CCER2, LRTM2, KC
- One platform that can be used to achieve therapeutically effective intracellular concentrations of proteins of interest in mammalian cells is via the stable expression of the gene encoding the protein of interest (e.g., by integration into the nuclear or mitochondrial genome of a mammalian cell, or by episomal concatemer formation in the nucleus of a mammalian cell).
- the gene is a polynucleotide that encodes the primary amino acid sequence of the corresponding protein.
- genes can be incorporated into a vector.
- Vectors can be introduced into a cell by a variety of methods, including transformation, transfection, transduction, direct uptake, projectile bombardment, and by encapsulation of the vector in a liposome.
- the transcription of this polynucleotide can be induced by methods known in the art.
- expression can be induced by exposing the mammalian cell to an external chemical reagent, such as an agent that modulates the binding of a transcription factor and/or RNA polymerase to the mammalian promoter and thus regulates gene expression.
- the chemical reagent can serve to facilitate the binding of RNA polymerase and/or transcription factors to the mammalian promoter, e.g., by removing a repressor protein that has bound the promoter.
- the reporter sequences When associated with regulatory elements that drive their expression, such as an STRC promoter, the reporter sequences provide signals detectable by conventional means, including enzymatic, radiographic, colorimetric, fluorescence or other spectrographic assays, fluorescent activating cell sorting assays and immunological assays, including enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and immunohistochemistry.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- immunohistochemistry for example, where the marker sequence is the LacZ gene, the presence of the vector carrying the signal is detected by assays for p-galactosidase activity. Where the transgene is green fluorescent protein or luciferase, the vector carrying the signal may be measured visually by color or light production in a luminometer.
- transgene such as a transgene operably linked to an STRC promoter described herein
- a target cell e.g., a mammalian cell
- electroporation can be used to permeabilize mammalian cells (e.g., human target cells) by the application of an electrostatic potential to the cell of interest.
- mammalian cells such as human cells, subjected to an external electric field in this manner are subsequently predisposed to the uptake of exogenous polynucleotides.
- Electroporation of mammalian cells is described in detail, e.g., in Chu et al., Nucleic Acids Research 15:1311 (1987), the disclosure of which is incorporated herein by reference.
- a similar technique, NucleofectionTM utilizes an applied electric field in order to stimulate the uptake of exogenous polynucleotides into the nucleus of a eukaryotic cell.
- NucleofectionTM and protocols useful for performing this technique are described in detail, e.g., in Distler et al., Experimental Dermatology 14:315 (2005), as well as in US 2010/0317114, the disclosures of each of which are incorporated herein by reference.
- Impalefection is another technique that can be used to deliver genetic material to target cells. It relies on the use of nanomaterials, such as carbon nanofibers, carbon nanotubes, and nanowires. Needle-like nanostructures are synthesized perpendicular to the surface of a substrate. DNA containing the gene, intended for intracellular delivery, is attached to the nanostructure surface. A chip with arrays of these needles is then pressed against cells or tissue. Cells that are impaled by nanostructures can express the delivered gene(s).
- An example of this technique is described in Shalek et al., PNAS 107: 1870 (2010), the disclosure of which is incorporated herein by reference.
- Vectors that can contain an STRC promoter operably linked to polynucleotide encoding a desired expression product include plasmids (e.g., circular DNA molecules that can autonomously replicate inside a cell), cosmids (e.g., pWE or sCos vectors), artificial chromosomes (e.g., a human artificial chromosome (HAC), a yeast artificial chromosome (YAC), a bacterial artificial chromosome (BAC), or a P1 -derived artificial chromosome (PAC)), and viral vectors.
- plasmids e.g., circular DNA molecules that can autonomously replicate inside a cell
- cosmids e.g., pWE or sCos vectors
- artificial chromosomes e.g., a human artificial chromosome (HAC), a yeast artificial chromosome (YAC), a bacterial artificial chromosome (BAC), or a P1 -derived artificial chromos
- vectors that can be used for the expression of a desired expression product include plasmids that contain regulatory sequences, such as enhancer regions, which direct gene transcription.
- Other useful vectors for expression of a desired expression product e.g., a protein of interest
- sequence elements include, e.g., 5’ and 3’ untranslated regions, an internal ribosomal entry site (IRES), and polyadenylation signal site in order to direct efficient transcription of the gene carried on the expression vector.
- Viral genomes provide a rich source of vectors that can be used for the efficient delivery of a gene of interest into the genome of a target cell (e.g., a mammalian cell, such as a human cell).
- a target cell e.g., a mammalian cell, such as a human cell.
- Viral genomes are particularly useful vectors for gene delivery because the polynucleotides contained within such genomes are typically incorporated into the nuclear genome of a mammalian cell by generalized or specialized transduction. These processes occur as part of the natural viral replication cycle, and do not require added proteins or reagents in order to induce gene integration.
- viral vectors examples include a retrovirus (e.g., Retroviridae family viral vector), adenovirus (e.g., Ad5, Ad26, Ad34, Ad35, and Ad48), parvovirus (e.g., adeno-associated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e.g., influenza virus), rhabdovirus (e.g., rabies and vesicular stomatitis virus), paramyxovirus (e.g.
- RNA viruses such as picornavirus and alphavirus
- double stranded DNA viruses including adenovirus, herpesvirus (e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus), and poxvirus (e.g., vaccinia, modified vaccinia Ankara (MVA), fowlpox and canarypox).
- herpesvirus e.g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomegalovirus
- poxvirus e.g., vaccinia, modified vaccinia Ankara (MVA), fowlpox and canarypox
- Other viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, human papilloma virus, human foamy virus, and hepatitis virus, for example.
- retroviruses examples include avian leukosis-sarcoma, avian C-type viruses, mammalian C-type, B-type viruses, D-type viruses, oncoretroviruses, HTLV-BLV group, lentivirus, alpharetrovirus, gammaretrovirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, Virology, Third Edition (Lippincott-Raven, Philadelphia, 1996)).
- murine leukemia viruses include murine leukemia viruses, murine sarcoma viruses, mouse mammary tumor virus, bovine leukemia virus, feline leukemia virus, feline sarcoma virus, avian leukemia virus, human T-cell leukemia virus, baboon endogenous virus, Gibbon ape leukemia virus, Mason Pfizer monkey virus, simian immunodeficiency virus, simian sarcoma virus, Rous sarcoma virus and lentiviruses.
- vectors are described, for example, US Patent No. 5,801 ,030, the disclosure of which is incorporated herein by reference as it pertains to viral vectors for use in gene therapy.
- polynucleotides of the compositions and methods described herein are incorporated into rAAV vectors and/or virions in order to facilitate their introduction into a cell.
- rAAV vectors useful in the compositions and methods described herein are recombinant polynucleotide constructs that include (1 ) an STRC promoter described herein (e.g., a polynucleotide having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 , SEQ ID NO: 2, SEQ ID NO: 48, a functional portion of SEQ ID NO: 2 containing nucleotides 252-537 or 35-530 of SEQ ID NO: 2, or a functional portion of SEQ ID NO: 48 containing nucleotides 280-560 of SEQ ID NO: 48
- the viral sequences may include those sequences of AAV that are required in cis for replication and packaging (e.g., functional ITRs) of the DNA into a virion.
- the sequence to be expressed encodes a protein that can promote hair cell development, hair cell function, hair cell regeneration, hair cell fate specification, hair cell survival, or hair cell maintenance, or a wild-type form of a hair cell protein that is mutated in subjects with forms of hereditary hearing loss or vestibular dysfunction that may be useful for improving hearing or vestibular function in subjects carrying mutations that have been associated with hearing loss, deafness, or vestibular dysfunction (e.g., dizziness, vertigo, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder).
- Such rAAV vectors may also contain marker or reporter genes.
- Useful rAAV vectors have one or more of the AAV WT genes deleted in whole or in part but retain functional flanking ITR sequences.
- the AAV ITRs may be of any serotype suitable for a particular application.
- the ITRs can be AAV2 ITRs. Methods for using rAAV vectors are described, for example, in Tai et al., J. Biomed. Sci. 7:279 (2000), and Monahan and Samulski, Gene Delivery 7:24 (2000), the disclosures of each of which are incorporated herein by reference as they pertain to AAV vectors for gene delivery.
- the polynucleotides and vectors described herein can be incorporated into a rAAV virion in order to facilitate introduction of the polynucleotide or vector into a cell.
- the capsid proteins of AAV compose the exterior, non-nucleic acid portion of the virion and are encoded by the AAV cap gene.
- the cap gene encodes three viral coat proteins, VP1 , VP2 and VP3, which are required for virion assembly.
- rAAV virions useful in conjunction with the compositions and methods described herein include those derived from a variety of AAV serotypes including AAV 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ/8, DJ/9, 7m8, PHP.B, PHP. eb, and PHP.S.
- AAV1 , AAV2, AAV2quad(Y-F), AAV6, AAV8, AAV9, Anc80, Anc80L65, DJ/9, 7m8, and PHP.B may be particularly useful.
- Serotypes evolved for transduction of the retina may also be used in the methods and compositions described herein.
- AAV vectors and AAV proteins of different serotypes are described, for instance, in Chao et al., Mol. Ther. 2:619 (2000); Davidson et al., Proc. Natl. Acad. Sci. USA 97:3428 (2000); Xiao et al., J. Virol. 72:2224 (1998); Halbert et al., J. Virol. 74:1524 (2000); Halbert et al., J. Virol. 75:6615 (2001 ); and Auricchio et al., Hum. Molec. Genet. 10:3075 (2001 ), the disclosures of each of which are incorporated herein by reference as they pertain to AAV vectors for gene delivery.
- Treatment may include administration of a composition containing a nucleic acid vector (e.g., an AAV vector) containing an STRC promoter described herein in various unit doses.
- a nucleic acid vector e.g., an AAV vector
- Each unit dose will ordinarily contain a predetermined quantity of the therapeutic composition.
- the quantity to be administered, and the particular route of administration and formulation, are within the skill of those in the clinical arts.
- a unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time. Dosing may be performed using a syringe pump to control infusion rate in order to minimize damage to the inner ear (e.g., the cochlea and/or vestibular system).
- nucleic acid vectors are AAV vectors (e.g., AAV1 , AAV2, AAV2quad(Y-F), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ/8, DJ/9, 7m8, PHP.B, PHP.
- AAV vectors e.g., AAV1 , AAV2, AAV2quad(Y-F), AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, rh10, rh39, rh43, rh74, Anc80, Anc80L65, DJ/8, DJ/9, 7m8, PHP.B, PHP.
- the viral vectors may be administered to the patient at a dose of, for example, from about 1 x 10 9 vector genomes (VG)/mL to about 1 x 10 16 VG/mL (e.g., 1 x 10 9 VG/mL, 2 x 10 9 VG/mL, 3 x 10 9 VG/mL, 4 x 10 9 VG/mL, 5 x 10 9 VG/mL, 6 x 10 9 VG/mL, 7 x 10 9 VG/mL, 8 x 10 9 VG/mL, 9 x 10 9 VG/mL, 1 x 10 10 VG/mL, 2 x 10 10 VG/mL, 3 x 10 10 VG/mL, 4 x 10 10 VG/mL, 5 x 10 10 VG/mL, 6 x 10 10 VG/mL, 7 x 10 10 VG/mL, 8 x 10 10 VG/mL, 9 x 10 9 VG/mL, 1 x
- VG/mL VG/mL, or 1 x 10 16 VG/mL in a volume of 1 pL to 200 pL (e.g., 1 , 2, 3, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pL).
- 1 pL to 200 pL e.g., 1 , 2, 3, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pL.
- Vestibular function may be evaluated using standard tests for balance and vertigo (e.g., eye movement testing (e.g., ENG or VNG), posturography, VOR testing (e.g., head impulse testing (Halmagyi-Curthoys testing, e.g., VHIT), or caloric reflex testing), rotary-chair testing, ECOG, VEMP, and specialized clinical balance tests) and may be improved by 5% or more (e.g., 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 200% or more) compared to measurements obtained prior to treatment.
- vertigo e.g., eye movement testing (e.g., ENG or VNG), posturography, VOR testing (e.g., head impulse testing (Halmagyi-Curthoys testing, e.g., VHIT), or caloric reflex testing), rotary-chair testing, ECOG, VE
- N-Strc DNA encoding amino acids 1 -746 of stereocilin
- the tested intein designs produced a full-length stereocilin band.
- the two-vector system may be a split intein trans-splicing system that includes a first AAV vector and a second AAV vector.
- the split intein trans-splicing two-vector system may include a first AAV vector that includes the STRC promoter operably linked to a polynucleotide encoding an N-terminal portion of a stereocilin protein (e.g., an N-terminal portion of SEQ ID NO: 3 or a variant thereof having at least 85% (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more) sequence identity to the amino acid sequence of SEQ ID NO: 3) and a polynucleotide encoding an N- terminal intein (N-intein) 3’ thereto, and a second AAV vector that includes the STRC promoter operably linked to a polynucleotide
- the aforementioned two-vector systems may additionally include regulatory sequences such as, e.g., enhancers, poly(A) sequences, and STRC untranslated regions (UTRs, e.g., a 5’ UTR and/or a 3’ UTR) that are not part of the promoters described herein.
- the composition containing the AAV vectors may be administered to the patient, for example, by local administration to the inner ear (e.g., injection to a semicircular canal, e.g., the horizontal canal), to treat vestibular dysfunction.
- a finding that the patient exhibits improved vestibular function in one or more of the tests following administration of the composition compared to vestibular function test results prior to administration of the composition indicates that the patient is responding favorably to the treatment. Subsequent doses can be determined and administered as needed.
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E5. The polynucleotide of E1 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-560 of SEQ ID NO: 48.
- E6 The polynucleotide of E1 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-564 of SEQ ID NO: 48.
- E8 The polynucleotide of E1 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 124-564 of SEQ ID NO: 48.
- E9. The polynucleotide of E1 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- E10 The polynucleotide of E2, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 .
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E12 The polynucleotide of E2, wherein the STRC promoter has at least 85% sequence identity (e.g.,
- SEQ ID NO: 2 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252- 537 or 35-530 of SEQ ID NO: 2.
- E14 The polynucleotide of E2 or E12, wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 120-537 of SEQ ID NO: 2.
- E17 The polynucleotide of any one of E1 -E16, wherein the heterologous expression product is a protein, a short hairpin RNA (shRNA), an antisense oligonucleotide (ASO), a component of a gene editing system (e.g., a nuclease, such as a CRISPR Associated Protein 9 (Cas9), Transcription Activator-Like Effector Nuclease (TALEN), or Zinc Finger Nuclease (ZFN), or a guide RNA (gRNA)), or a microRNA.
- a nuclease such as a CRISPR Associated Protein 9 (Cas9), Transcription Activator-Like Effector Nuclease (TALEN), or Zinc Finger Nuclease (ZFN)
- gRNA guide RNA
- E18 The polynucleotide of E17, wherein the protein is Actin Gamma 1 (ACTG1 ), Fascin Actin- Bundling Protein 2, Retinal (FSCN2), Radixin (RDX), POU Class 4 Homeobox 3 (POU4F3), TRIO and F-Actin Binding Protein (TRIOBP), Taperin (TPRN), Xin Actin Binding Repeat Containing 2 (XIRP2), Atonal BHLH Transcription Factor 1 (ATOH1 ), Growth Factor Independent 1 Transcriptional Repressor (GFI1 ), Cholinergic Receptor Nicotinic Alpha 9 Subunit (CHRNA9), Cholinergic Receptor Nicotinic Alpha 10 Subunit (CHRNA10), Calcium and Integrin Binding Family Member 3 (CIB3), Cadherin 23 (CDH23), Protocadherin 15 (PCDH15), Kinocilin (KNCN), Pejvakin (DFNB59), MKRN2 Opposite Strand (MKRN2
- a nucleic acid vector comprising a STRC promoter having at least 85% sequence identity e.g.,
- SEQ ID NO: 48 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof comprising nucleotides 280- 560 of SEQ ID NO: 48.
- a nucleic acid vector comprising a STRC promoter having: (i) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 ; or (ii) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252-537 or 35- 530 of SEQ ID NO: 2.
- E23 The nucleic acid vector of E20 or E22, wherein the STRC promoter has the sequence of SEQ ID NO: 48.
- nucleic acid vector of E20, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-560 of SEQ ID NO: 48.
- E25 The nucleic acid vector of E20, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-564 of SEQ ID NO: 48.
- E26 The nucleic acid vector of E20, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 124-560 of SEQ ID NO: 48.
- E28 The nucleic acid vector of E20, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- E29 The nucleic acid vector of E21 , wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 .
- E30 The nucleic acid vector of E21 or E29, wherein the STRC promoter consists of SEQ ID NO: 1 .
- E31 The nucleic acid vector of E21 , wherein the STRC promoter has at least 85% sequence identity
- SEQ ID NO: 2 (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252-537 or 35-530 of SEQ ID NO: 2.
- nucleic acid vector of E21 or E31 wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 252-537 of SEQ ID NO: 2.
- nucleic acid vector of E21 or E31 wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 120-537 of SEQ ID NO: 2.
- nucleic acid vector of E21 or E31 wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 35-530 of SEQ ID NO: 2.
- E35 The nucleic acid vector of E20 or E31 , wherein the STRC promoter consists of SEQ ID NO: 2.
- E36 The nucleic acid vector of any one of E20-E35, wherein the STRC promoter is operably linked to a polynucleotide encoding a heterologous expression product.
- E37 The nucleic acid vector of E36, wherein the heterologous expression product is a protein, a short hairpin RNA (shRNA), an antisense oligonucleotide (ASO), a component of a gene editing system (e.g., a nuclease, such as a CRISPR Associated Protein 9 (Cas9), Transcription Activator-Like Effector Nuclease (TALEN), or Zinc Finger Nuclease (ZFN), or a guide RNA (gRNA)), or a microRNA.
- a nuclease such as a CRISPR Associated Protein 9 (Cas9), Transcription Activator-Like Effector Nuclease (TALEN), or Zinc Finger Nuclease (ZFN)
- gRNA guide RNA
- E38 The nucleic acid vector of E37, wherein the protein is ACTG1 , FSCN2, RDX, POU4F3, TRIOBP, TPRN, XIRP2, ATOH1 , GFI1 , CHRNA9, CHRNA10, CIB3, CDH23, PCDH15, KNCN, DFNB59, MKRN2OS, LHX3, TMC1 , MYO15, MYO7A, MYO6, MYO3A, MYO3B, GRXCR1 , PTPRQ, LCE6A, LOXHD1 , ART1 , ATP2B2, CIB2, CACNA2D4, EPS8, EPS8L2, ESPN, ESPNL, PRPH2, SLC8A2, ZCCHC12, LRTOMT2, LRTOMT1 , USH1 C, SLC26A5, PIEZO2, ELFN1 , TTC24, DYTN, CCER2, LRTM2, KCNA10
- E39 The nucleic acid vector of any one of E20-E35, wherein the STRC promoter is operably linked to a polynucleotide encoding an N-terminal portion of a stereocilin protein that does not encode a full-length stereocilin protein.
- E40 The nucleic acid vector of E39, wherein the nucleic acid vector is a first nucleic acid vector in a two-vector system that further comprises a second nucleic acid vector comprising a polynucleotide encoding a C-terminal portion of a stereocilin protein that does not encode a full- length stereocilin protein.
- E41 The nucleic acid vector of any one of E19-E40, wherein the nucleic acid vector is a viral vector, plasmid, cosmid, or artificial chromosome.
- E42 The nucleic acid vector of E41 , wherein the nucleic acid vector is a viral vector selected from the group consisting of an adeno-associated virus (AAV), an adenovirus, and a lentivirus.
- AAV adeno-associated virus
- adenovirus an adenovirus
- a lentivirus a viral vector selected from the group consisting of an adeno-associated virus (AAV), an adenovirus, and a lentivirus.
- AAV adeno-associated virus
- E43 The nucleic acid vector of E42, wherein the viral vector is an AAV vector.
- E44 The nucleic acid vector of E43, wherein the AAV vector has an AAV1 , AAV2, AAV2quad(Y-F),
- a composition comprising the nucleic acid vector of any one of E19-E44.
- composition of E45 further comprising a pharmaceutically acceptable carrier, diluent, or excipient.
- E47 A cell comprising the polynucleotide of any one of E1 -E18 or the nucleic acid vector of any one of E19-E44.
- E48 The cell of E47, wherein the cell is a hair cell.
- E49 The cell of E48, wherein the hair cell is a mammalian hair cell.
- E50 The cell of E49, wherein the mammalian hair cell is a human hair cell.
- E51 The cell of any one of E48-E50, wherein the hair cell is a cochlear hair cell.
- E52 The cell of E51 , wherein the cochlear hair cell is an outer hair cell.
- E53 The cell of E51 , wherein the cochlear hair cell is an inner hair cell.
- E54 The cell of any one of E48-E50, wherein the hair cell is a vestibular hair cell.
- E55 The cell of E54, wherein the vestibular hair cell is a type II vestibular hair cell.
- E56 The cell of E54, wherein the vestibular hair cell is a type I vestibular hair cell.
- a method of expressing a heterologous expression product in a hair cell comprising contacting the hair cell with the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E58 The method of E57, wherein the expression product is specifically expressed in hair cells.
- a method of treating a subject having or at risk of developing hearing loss comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- hearing loss e.g., sensorineural hearing loss, auditory neuropathy, or deafness
- E60 A method of treating a subject having or at risk of developing tinnitus, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- a method of treating a subject having or at risk of developing vestibular dysfunction comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E62 A method of treating a subject having or at risk of developing bilateral vestibulopathy, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E63 The method of E62, wherein the bilateral vestibulopathy is ototoxic drug-induced bilateral vestibulopathy.
- a method of treating a subject having or at risk of developing oscillopsia comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E66 A method of treating a subject having or at risk of developing a balance disorder, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E67 A method of inducing or increasing hair cell regeneration in a subject in need thereof, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E68 A method of increasing hair cell maintenance in a subject in need thereof, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- a method of increasing hair cell survival in a subject in need thereof comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E70 A method of inducing or increasing hair cell maturation in a subject in need thereof, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- a method of preventing or reducing ototoxic drug-induced hair cell damage or death in a subject in need thereof comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E72 A method of preventing or reducing hair cell damage or death in a subject in need thereof, comprising administering to an inner ear of the subject an effective amount of the nucleic acid vector of any one of E19-E44 or the composition of E45 or E46.
- E73 The method of any one of E57, E58, and E67-E72, wherein the hair cell is a mammalian hair cell.
- E74 The method of E73, wherein the mammalian hair cell is a human hair cell.
- E75 The method of any one of E57, E58, and E67-E74, wherein the hair cell is a cochlear hair cell.
- E76 The method of E75, wherein the cochlear hair cell is an outer hair cell.
- E77 The method of E75, wherein the cochlear hair cell is an inner hair cell.
- E78 The method of any one of E57, E58, and E67-E74, wherein the hair cell is a vestibular hair cell.
- E80 The method of E78, wherein the vestibular hair cell is a type I vestibular hair cell.
- E81 The method of any one of E67-E77, wherein the subject has or is at risk of developing hearing loss (e.g., sensorineural hearing loss).
- hearing loss e.g., sensorineural hearing loss
- E82 The method of E59 or E81 , wherein the hearing loss is genetic hearing loss.
- E83 The method of E82, wherein the genetic hearing loss is autosomal dominant hearing loss, autosomal recessive hearing loss, or X-linked hearing loss.
- E84 The method of E59 or E81 , wherein the hearing loss is acquired hearing loss.
- E85 The method of E84, wherein the acquired hearing loss is noise-induced hearing loss, age-related hearing loss, disease or infection-related hearing loss, head trauma-related hearing loss, or ototoxic drug-induced hearing loss.
- E86 The method of any one of E67-E72, wherein the subject has or is at risk of developing vestibular dysfunction.
- E87 The method of E61 or E86, wherein the vestibular dysfunction comprises vertigo, dizziness, imbalance, bilateral vestibulopathy, oscillopsia, or a balance disorder.
- E88 The method of any one of E61 , E86, and E87, wherein the vestibular dysfunction is age-related vestibular dysfunction, head trauma-related vestibular dysfunction, disease or infection-related vestibular dysfunction, or ototoxic drug-induced vestibular dysfunction.
- E89 The method of any one of E61 and E86-E88, wherein the vestibular dysfunction is associated with a genetic mutation.
- E90 The method of any one of E61 , E86, and E87, wherein the vestibular dysfunction is idiopathic vestibular dysfunction.
- E91 The method of any one of E63, E65, E71 , E85, and E88, wherein the ototoxic drug is an aminoglycoside, an antineoplastic drug, ethacrynic acid, furosemide, a salicylate, or quinine.
- the ototoxic drug is an aminoglycoside, an antineoplastic drug, ethacrynic acid, furosemide, a salicylate, or quinine.
- E92 The method of any one of E59, E60, E67-E77, and E81 -E85, wherein the method further comprises evaluating the hearing of the subject prior to administering the nucleic acid vector or composition.
- E93 The method of any one of E59, E60, E67-E77, E81 -E85, and E92, wherein the method further comprises evaluating the hearing of the subject after administering the nucleic acid vector or composition.
- E94 The method of any one of E61 -E74, E78-E80, and E86-E93, wherein the method further comprises evaluating the vestibular function of the subject prior to administering the nucleic acid vector or composition.
- E95 The method of any one of E61 -E74, E78-E80, and E86-E94, wherein the method further comprises evaluating the vestibular function of the subject after administering the nucleic acid vector or composition.
- E96 The method of any one of E59-E95, wherein the nucleic acid vector or composition is locally administered.
- E97 The method of E96, wherein the nucleic acid vector or composition is administered to the inner ear.
- E98 The method of E96, wherein the nucleic acid vector or composition is administered to the middle ear.
- E99 The method of E96, wherein the nucleic acid vector or composition is administered to a semicircular canal.
- E100 The method of E96, wherein the nucleic acid vector or composition is administered transtympanically or intratympanically.
- E101 The method of E96, wherein the nucleic acid vector or composition is administered into the perilymph.
- E102 The method of E96, wherein the nucleic acid vector or composition is administered into the endolymph.
- E103 The method of E96, wherein the nucleic acid vector or composition is administered to or through the oval window.
- E104 The method of E96, wherein the nucleic acid vector or composition is administered to or through the round window.
- E105 The method of any one of E59-E104, wherein the nucleic acid vector or composition is administered in an amount sufficient to prevent or reduce vestibular dysfunction, delay the development of vestibular dysfunction, slow the progression of vestibular dysfunction, improve vestibular function, prevent or reduce hearing loss, prevent or reduce tinnitus, delay the development of hearing loss, slow the progression of hearing loss, improve hearing, increase hair cell numbers, increase hair cell maturation, increase hair cell regeneration, improve hair cell function, prevent or reduce hair cell damage, prevent or reduce hair cell death, or promote or increase hair cell survival.
- E106 The method of E57 or E58, wherein the contacting is in vivo (in a subject).
- E107 The method of any one of E59-E106, wherein the subject is a human subject.
- a two-vector system comprising: a) a first nucleic acid vector comprising a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof comprising nucleotides 280-560 of SEQ ID NO: 48 operably linked to a first polynucleotide encoding an N-terminal portion of a stereocilin protein; and b) a second nucleic acid vector comprising a second polynucleotide encoding a C-terminal portion of a stereocilin protein.
- a first nucleic acid vector comprising a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%
- a two-vector system comprising: a) a first nucleic acid vector comprising a STRC promoter having: (i) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 ; or (ii) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252- 537 or 35-530 of SEQ ID NO: 2, operably linked to a first polynucleotide encoding an N-terminal portion of a stereocilin protein; and b) a second nucleic acid vector comprising
- E110 The two-vector system of E108, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48.
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E111 The two-vector system of E108 or E110, wherein the STRC promoter has the sequence of SEQ ID NO: 48.
- E112. The two-vector system of E108, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-560 of SEQ ID NO: 48.
- E113 The two-vector system of E108, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-564 of SEQ ID NO: 48.
- E114 The two-vector system of E108, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 124-560 of SEQ ID NO: 48.
- E115 The two-vector system of E108, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 124-564 of SEQ ID NO: 48.
- E116 The two-vector system of E108, wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- E117 The two-vector system of E109, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 .
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E118 The two-vector system of E109 or E117, wherein the STRC promoter consists of SEQ ID NO: 1 .
- E119 The two-vector system of E109, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252-537 or 35-530 of SEQ ID NO: 2.
- E120 The two-vector system of E109 or E119, wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 252-537 of SEQ ID NO: 2.
- E121 The two-vector system of E109 or E119, wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 120-537 of SEQ ID NO: 2.
- E122 The two-vector system of E109 or E119, wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 35-530 of SEQ ID NO: 2.
- E123 The two-vector system of E109 or E119, wherein the STRC promoter consists of SEQ ID NO: 2.
- E124 The two-vector system of any one of E108-E123, wherein the first polynucleotide partially overlaps with the second polynucleotide.
- E125 The two-vector system of any one of E108-E124, wherein the first polynucleotide and the second polynucleotide have a region of overlap having a length of at least 200 bases (b).
- E126 The two-vector system of any one of E108-E125, wherein when introduced into a mammalian cell, the first and second nucleic acid vectors undergo homologous recombination to form a recombined polynucleotide that encodes a full-length stereocilin protein.
- E127 The two-vector system of any one of E108-E123, wherein the first nucleic acid vector comprises a splice donor signal sequence positioned 3’ of the first polynucleotide and the second nucleic acid vector comprises a splice acceptor signal sequence positioned 5’ of the second polynucleotide.
- E128 The two-vector system of any one of E108-E123, wherein the first nucleic acid vector comprises a splice donor signal sequence positioned 3’ of the first polynucleotide and a first recombinogenic region positioned 3’ of the splice donor signal sequence and the second nucleic acid vector comprises a second recombinogenic region, a splice acceptor signal sequence positioned 3’ of the recombinogenic region, and the second polynucleotide positioned 3’ of the splice acceptor signal sequence.
- E129 The two-vector system of any one of E108-E123, E127, and E128, wherein the first and second polynucleotides do not overlap.
- E130 The two-vector system of E128 or E129, wherein the first nucleic acid vector further comprises a degradation signal sequence positioned 3’ of the recombinogenic region; and wherein the second nucleic acid vector further comprises a degradation signal sequence positioned between the recombinogenic region and the splice acceptor signal sequence.
- E131 The two-vector system of any one of E108-E123, wherein the second nucleic acid vector further comprises a STRC promoter having at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 48 or a functional portion thereof comprising nucleotides 280-560 of SEQ ID NO: 48 operably linked to the second polynucleotide, wherein the STRC promoter is positioned 5’ of the second polynucleotide.
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E132 The two-vector system of any one of E108-E123, wherein the second nucleic acid vector further comprises a STRC promoter having: (i) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 ; or (ii) at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252-537 or 35-530 of SEQ ID NO: 2, operably linked to the second polynucleotide, wherein the STRC promoter is positioned 5’ of the second polynucleotide.
- E134 The two-vector system of E131 or E133, wherein the STRC promoter has the sequence of SEQ ID NO: 48.
- E135. The two-vector system of E131 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 280-560 of SEQ ID NO: 48.
- E137 The two-vector system of E131 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 124-560 of SEQ ID NO: 48.
- E139 The two-vector system of E131 , wherein the functional portion of SEQ ID NO: 48 comprises or consists of nucleotides 1 -560 of SEQ ID NO: 48.
- E140 The two-vector system of E132, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 1 .
- sequence identity e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity
- E141 The two-vector system of E132 or £140, wherein the STRC promoter consists of SEQ ID NO: 1 .
- E142 The two-vector system of E132, wherein the STRC promoter has at least 85% sequence identity (e.g., 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or more, sequence identity) to SEQ ID NO: 2 or a functional portion thereof comprising nucleotides 252-537 or 35-530 of SEQ ID NO: 2.
- E144 The two-vector system of E132 or E142, wherein the functional portion of SEQ ID NO: 2 comprises or consists of nucleotides 120-537 of SEQ ID NO: 2.
- E149 The two-vector system of E148, wherein the N-intein and C-intein are components of a split intein trans-splicing system.
- E150 The two-vector system of E149, wherein the split intein trans-splicing system is derived from a DnaE gene of one or more bacteria.
- E154 The two-vector system of E149, wherein the N-intein has the sequence of SEQ ID NO: 7 and the C-intein has the sequence of SEQ ID NO: 11 .
- E175. The two-vector system of E149, wherein the N-intein has the sequence of SEQ ID NO: 55 and the C-intein has the sequence of SEQ ID NO: 56.
- E176 The two-vector system of E149, wherein the N-intein has the sequence of SEQ ID NO: 57 and the C-intein has the sequence of SEQ ID NO: 58.
- E180 The two-vector system of E178 wherein the cochlear hair cell is an inner hair cell.
- E186 The two-vector system of any one of E108-E185, wherein the first and second vectors are viral vectors, plasmids, cosmids, or artificial chromosomes.
- E187 The two-vector system of E186, wherein the first and second vectors are viral vectors selected from the group consisting of AAV vectors, adenovirus vectors, and lentivirus vectors.
- E195 The cell of E194, wherein the mammalian hair cell is a human hair cell.
- E196 The cell of any one of E192-E195, wherein the hair cell is a cochlear hair cell.
- E206 A method of treating a subject having or at risk of developing vestibular dysfunction, comprising administering to an inner ear of the subject an effective amount of the two-vector system of any one of E108-E189 or the composition of E190 or E191 .
- E210 The method of any one of E202-E204 and E207-E209, wherein the hair cell is a mammalian hair cell.
- E216 The method of E215, wherein the vestibular hair cell is a type II vestibular hair cell.
- E219. The method of any one of E207-E214 and E218, wherein the subject has or is at risk of developing hearing loss (e.g., sensorineural hearing loss).
- hearing loss e.g., sensorineural hearing loss
- E224 The method of any one of E206, E222, and E223, wherein the vestibular dysfunction is associated with a genetic mutation.
- E225 The method of any one of E205-E224, wherein the subject has a mutation in STRC.
- E226 The method of any one of E205-E225, wherein the subject has been identified as having a mutation in STRC.
- E227 The method of any one of E205-E225, wherein the method further comprises identifying the subject as having a mutation in STRC prior to administering the two-vector system or composition.
- E228 The method of any one of E205-E227, wherein the subject has DFNB16.
- E231 The method of any one of E205-E230, wherein the method further comprises evaluating the hearing of the subject after administering the nucleic acid vector or composition.
- E233 The method of any one of E205-E232, wherein the method further comprises evaluating the vestibular function of the subject after administering the nucleic acid vector or composition.
- E234 The method of any one of E205-E233, wherein the nucleic acid vector or composition is administered locally to the inner ear.
- E235 The method of E234, wherein the nucleic acid vector or composition is administered to a semicircular canal.
- E236 The method of E234, wherein the nucleic acid vector or composition is administered transtympanically or intratympanically.
- E237 The method of E234, wherein the nucleic acid vector or composition is administered into the perilymph.
- E244 The method of any one of E205-E243, wherein the subject is a human subject.
- a kit comprising the polynucleotide of any one of E1 -E18, the nucleic acid vector of any one of E19-E44, the two-vector system of any one of E108-E189, or the composition of E45, E46, E190, or E191.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3235268A CA3235268A1 (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
| JP2024522122A JP2024538076A (ja) | 2021-10-12 | 2022-10-12 | ステレオシリンプロモーター及びその使用 |
| KR1020247015287A KR20240109294A (ko) | 2021-10-12 | 2022-10-12 | 스테레오실린 프로모터 및 이의 용도 |
| AU2022364798A AU2022364798A1 (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
| CN202280081921.8A CN118591631A (zh) | 2021-10-12 | 2022-10-12 | 硬纤毛蛋白启动子及其用途 |
| IL312056A IL312056A (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
| EP22881724.3A EP4416294A2 (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
| US18/699,454 US20240401079A1 (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
| MX2024004443A MX2024004443A (es) | 2021-10-12 | 2022-10-12 | Promotores de estereocilina y usos de estos. |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163254930P | 2021-10-12 | 2021-10-12 | |
| US63/254,930 | 2021-10-12 | ||
| US202263307484P | 2022-02-07 | 2022-02-07 | |
| US63/307,484 | 2022-02-07 | ||
| US202263338605P | 2022-05-05 | 2022-05-05 | |
| US63/338,605 | 2022-05-05 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023064388A2 true WO2023064388A2 (en) | 2023-04-20 |
| WO2023064388A3 WO2023064388A3 (en) | 2023-08-24 |
Family
ID=85988783
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/046444 Ceased WO2023064388A2 (en) | 2021-10-12 | 2022-10-12 | Stereocilin promoters and uses thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20240401079A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4416294A2 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024538076A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240109294A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022364798A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3235268A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL312056A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024004443A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023064388A2 (cg-RX-API-DMAC7.html) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116925239A (zh) * | 2023-07-17 | 2023-10-24 | 苏州星奥拓维生物技术有限公司 | 双载体系统表达Otof基因的组合物和方法 |
| WO2024250774A1 (zh) * | 2023-06-07 | 2024-12-12 | 苏州星奥拓维生物技术有限公司 | 耳蜗外毛细胞特异性启动子及其应用 |
| US12226493B2 (en) | 2018-07-13 | 2025-02-18 | Akouos, Inc. | Methods of treating non-syndromic sensorineural hearing loss |
| EP4502158A4 (en) * | 2022-03-25 | 2026-02-25 | Shanghai Emaygene Tech Co Ltd | SPECIFIC COCHLEAR AND/OR VESTIBULAR CELL PROMOTER AND ITS USE |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070161031A1 (en) * | 2005-12-16 | 2007-07-12 | The Board Of Trustees Of The Leland Stanford Junior University | Functional arrays for high throughput characterization of gene expression regulatory elements |
| WO2020014625A1 (en) * | 2018-07-13 | 2020-01-16 | Akouos, Inc. | Methods of treating non-syndromic sensorineural hearing loss |
| WO2020077295A1 (en) * | 2018-10-11 | 2020-04-16 | Decibel Therapeutics, Inc. | Aav1 vectors and uses thereof for treatment of otic indications |
-
2022
- 2022-10-12 EP EP22881724.3A patent/EP4416294A2/en active Pending
- 2022-10-12 CA CA3235268A patent/CA3235268A1/en active Pending
- 2022-10-12 KR KR1020247015287A patent/KR20240109294A/ko active Pending
- 2022-10-12 US US18/699,454 patent/US20240401079A1/en active Pending
- 2022-10-12 MX MX2024004443A patent/MX2024004443A/es unknown
- 2022-10-12 AU AU2022364798A patent/AU2022364798A1/en active Pending
- 2022-10-12 WO PCT/US2022/046444 patent/WO2023064388A2/en not_active Ceased
- 2022-10-12 IL IL312056A patent/IL312056A/en unknown
- 2022-10-12 JP JP2024522122A patent/JP2024538076A/ja active Pending
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12226493B2 (en) | 2018-07-13 | 2025-02-18 | Akouos, Inc. | Methods of treating non-syndromic sensorineural hearing loss |
| EP4502158A4 (en) * | 2022-03-25 | 2026-02-25 | Shanghai Emaygene Tech Co Ltd | SPECIFIC COCHLEAR AND/OR VESTIBULAR CELL PROMOTER AND ITS USE |
| WO2024250774A1 (zh) * | 2023-06-07 | 2024-12-12 | 苏州星奥拓维生物技术有限公司 | 耳蜗外毛细胞特异性启动子及其应用 |
| CN116925239A (zh) * | 2023-07-17 | 2023-10-24 | 苏州星奥拓维生物技术有限公司 | 双载体系统表达Otof基因的组合物和方法 |
| CN116925239B (zh) * | 2023-07-17 | 2024-10-18 | 苏州星奥拓维生物技术有限公司 | 双载体系统表达Otof基因的组合物和方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2024538076A (ja) | 2024-10-18 |
| EP4416294A2 (en) | 2024-08-21 |
| MX2024004443A (es) | 2024-07-01 |
| AU2022364798A1 (en) | 2024-05-02 |
| KR20240109294A (ko) | 2024-07-10 |
| CA3235268A1 (en) | 2023-04-20 |
| US20240401079A1 (en) | 2024-12-05 |
| IL312056A (en) | 2024-06-01 |
| WO2023064388A3 (en) | 2023-08-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240401079A1 (en) | Stereocilin promoters and uses thereof | |
| US20250319205A1 (en) | Myosin 15 promoters and uses thereof | |
| US12252520B2 (en) | Myosin 15 promoters and uses thereof | |
| CA3159549A1 (en) | Compositions and methods for treating sensorineural hearing loss using otoferlin dual vector systems | |
| US20220288236A1 (en) | Cochlear outer hair cell promoters and uses thereof | |
| US20240216540A1 (en) | Compositions and methods for treating sensorineural hearing loss using stereocilin dual vector systems | |
| US20220348965A1 (en) | Cochlear inner hair cell promoters and uses thereof | |
| US20260034248A1 (en) | Slc26a4 regulatory elements and uses thereof | |
| US20250127928A1 (en) | Gjb2 regulatory elements and uses thereof | |
| EA053066B1 (ru) | Промоторы стереоцилина и варианты их применения | |
| CN118591631A (zh) | 硬纤毛蛋白启动子及其用途 | |
| WO2024238890A1 (en) | Compositions and methods for treating gjb2-related hearing loss | |
| US20240218391A1 (en) | Vestibular supporting cell promoters and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22881724 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 809928 Country of ref document: NZ Ref document number: AU2022364798 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 312056 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2024522122 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2024/004443 Country of ref document: MX Ref document number: 202490722 Country of ref document: EA Ref document number: 3235268 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024006710 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2022364798 Country of ref document: AU Date of ref document: 20221012 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202447036057 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022881724 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022881724 Country of ref document: EP Effective date: 20240513 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280081921.8 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112024006710 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240405 |