WO2023062030A1 - Polynucleotides useful for correcting mutations in the rag1 gene - Google Patents
Polynucleotides useful for correcting mutations in the rag1 gene Download PDFInfo
- Publication number
- WO2023062030A1 WO2023062030A1 PCT/EP2022/078298 EP2022078298W WO2023062030A1 WO 2023062030 A1 WO2023062030 A1 WO 2023062030A1 EP 2022078298 W EP2022078298 W EP 2022078298W WO 2023062030 A1 WO2023062030 A1 WO 2023062030A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- identity
- region
- seq
- chr
- homology region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/31—Chemical structure of the backbone
- C12N2310/315—Phosphorothioates
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16041—Use of virus, viral particle or viral elements as a vector
- C12N2740/16043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- the present invention relates to methods for gene-editing cells to introduce a RAG1 polypeptide or a RAG1 polypeptide fragment, for example as a treatment for severe combined immunodeficiency.
- the present invention also relates to polynucleotides, vectors, guide RNAs, kits, compositions, and gene editing systems for use in said methods.
- the present invention also relates to genomes and cells obtained or obtainable by said methods.
- RAG1 and RAG2 proteins initiate V(D)J recombination, allowing generation of a diverse repertoire of T and B cells (Teng G, Schatz DG. Advances in Immunology. 2015;128:1 -39).
- RAG mutations in humans cause a broad spectrum of phenotypes, including T- B- SCID, Omenn syndrome (OS), atypical SCID (AS) and combined immunodeficiency with granuloma/autoimmunity (CID-G/AI) (Notarangelo LD, et al. Nat Rev Immunol. 2016;16(4):234-246).
- Hematopoietic stem cell transplantation is the mainstay for severe forms of RAG1 deficiency, including T- B- SCID, OS and AS with an overall survival of -80% after transplantation from donors other than matched siblings (Haddad E, et al. Blood. 2018 ; 132(17):1737-49).
- overall survival rate is lower in non-matched-sibling donors and a high rate of graft failure and poor T and B cell immune reconstitution are observed in the absence of myeloablative or reduced intensity conditioning.
- donor type and conditioning other factors associated with worse outcomes after HSCT include age (>3.5 months of life) and infections at the time of transplantation.
- HSCs gene-corrected hematopoietic stem cells
- the present inventors have developed gene editing strategies to correct mutations in the RAG1 gene at the endogenous locus by introducing nucleotide sequence inserts encoding a RAG1 polypeptide or a RAG1 polypeptide fragment.
- the present inventors have developed a gene editing strategy to correct mutations in the RAG1 gene at the endogenous locus by targeting the second exon, which contains the entire coding sequence of the gene.
- the present inventors have also developed a gene editing strategy to correct mutations in the RAG1 gene at the endogenous locus by targeting the first intron or the start of the second exon.
- the present inventors have designed and selected a panel of CRISPR-Cas9 nucleases and corrective donors for these strategies.
- the present invention provides a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, and a second homology region.
- the present invention provides a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a first region of the RAG1 exon 2 and the second homology region is homologous to a second region of the RAG1 exon 2.
- the first homology region is homologous to a region upstream of chr 11 : 36574368 and the second homology region is homologous to a region downstream of chr 11 : 36574369;
- the first homology region is homologous to a region upstream of chr 11 : 36574367 and the second homology region is homologous to a region downstream of chr 11 : 36574368;
- the first homology region is homologous to a region upstream of chr 11 : 36574394 and the second homology region is homologous to a region downstream of chr 11 : 36574395;
- the first homology region is homologous to a region upstream of chr 1 1 : 36574294 and the second homology region is homologous to a region downstream of chr 11 : 36574295;
- the first homology region is homologous to a region upstream of chr 1 1 : 36574109 and the second homology region is homologous to a region downstream of chr 11 : 36574110;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573910 and the second homology region is homologous to a region downstream of chr 11 : 3657391 1 ;
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879;
- the first homology region is homologous to a region upstream of chr 11 : 36573959 and the second homology region is homologous to a region downstream of chr 11 : 36573960;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573957 and the second homology region is homologous to a region downstream of chr 11 : 36573958;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573879 and the second homology region is homologous to a region downstream of chr 11 : 36573880;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573892 and the second homology region is homologous to a region downstream of chr 11 : 36573893;
- the first homology region is homologous to a region upstream of chr 11 : 36573955 and the second homology region is homologous to a region downstream of chr 11 : 36573956;
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879; or
- the first homology region is homologous to a region upstream of chr 1 1 : 36574406 and the second homology region is homologous to a region downstream of chr 11 : 36574407.
- the first homology region is homologous to a region upstream of chr 1 1 : 36574109 and the second homology region is homologous to a region downstream of chr 11 : 36574110; or
- the first homology region is homologous to a region upstream of chr 1 1 : 36573910 and the second homology region is homologous to a region downstream of chr 11 : 3657391 1 .
- the first homology region is homologous to a region upstream of chr 1 1 : 36573892 and the second homology region is homologous to a region downstream of chr 11 : 36573893; or
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879.
- the first homology region is homologous to a region upstream of chr 1 1 : 36573878 and the second homology region is homologous to a region downstream of chr 1 1 : 36573879.
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368; (ii) the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406.
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to a region comprising chr 11 : 36574369-36574418;
- the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367 and/or the second homology region is homologous to a region comprising chr 11 : 36574368-36574417;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to a region comprising chr 11 : 36574395-36574444;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to a region comprising chr 11 : 36574295-36574344;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36574110-36574159;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 3657391 1 -36573960;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36573879-36573928;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to a region comprising chr 11 : 36573960-36574009;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to a region comprising chr 11 : 36573958-36574007;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879 and/or the second homology region is homologous to a region comprising chr 11 : 36573880-36573929;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36573893-36573942;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to a region comprising chr 11 : 36573956-36574005;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36573879-36573928; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to a region comprising chr 11 : 36574407-36574456.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 ;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 ;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 ;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 45;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 46;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 47;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 48;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 49 or SEQ ID NO: 59;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 50 or SEQ ID NO: 60;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 51 ;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 52;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 53;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 54;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 55;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 56;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 58.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 69, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 77, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 71 , or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 78, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 80, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 155, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof.
- the first and second homology regions may each be 50-2000bp in length, 50-1800 bp in length, 50-1500 bp in length, 50-1000bp in length, 100-500 bp in length, or 200-400 bp in length.
- the present invention provides a polynucleotide comprising from 5’ to 3’: a first homology region, a splice acceptor sequence, a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a first region of the RAG1 intron 1 or exon 2 and the second homology region is homologous to a second region of the RAG1 exon 2.
- the splice acceptor site comprises or consists of a nucleotide sequence that has at least 70% identity to SEQ ID NO: 95.
- the first homology region is homologous to a region upstream of: (i) chr 1 1 : 36569295; (ii) chr 1 1 : 36573790; (iii) chr 1 1 : 36573641 ; (iv) chr 1 1 : 36573351 ; (v) chr 1 1 : 36569080; (vi) chr 11 : 36572472; (vii) chr 11 : 36571458; (viii) chr 11 : 36571366; (ix) chr 1 1 : 36572859 (x) chr 1 1 : 36571457; (xi) chr 11 : 36569351 ; or (xii) chr 1 1 : 36572375.
- the first homology region is homologous to a region upstream of: (i) chr 11 : 36569295; (ii) chr 11 : 36573351 ; (iii) chr 1 1 : 36571366, preferably wherein the first homology region is homologous to a region upstream of chr 1 1 : 36569295.
- the first homology region is homologous to a region comprising chr 1 1 : 36569245-chr 11 : 36569294, preferably wherein the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity to SEQ ID NO: 81 , more preferably wherein the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity to SEQ ID NO: 93.
- the second homology region is downstream of chr 11 : 36574557; downstream of chr 1 1 : 36574870; downstream of chr 1 1 : 36575183; downstream of chr 1 1 : 36575496; downstream of chr 1 1 : 36575810; downstream of chr 11 : 36576123; or downstream of chr 1 1 : 36576436.
- the second homology region is homologous to a region comprising chr 1 1 : 36576437-chr 1 1 : 36576536. In some embodiments:
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536.
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 79-80, 94 or 157, or a fragment thereof.
- the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67. In some embodiments:
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 73, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 74, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 75, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 76, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 93, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 94, or a fragment thereof.
- the first homology region is about 50-1000bp in length, 100-500 bp in length, or 200-400 bp in length; and/or wherein the second homology region is about 500- 2000bp in length, 1000-2000bp in length, or 1500-2000 bp in length.
- the nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence encoding an amino acid sequence that has at least 70% identity to SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 6.
- the nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence that has at least 70% identity to SEQ ID NO: 15.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence encoding a fragment of an amino acid sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 4, SEQ ID NO: 5, or SEQ ID NO: 6.
- the RAG1 polypeptide fragment is at least 500 amino acids in length, at least 550 amino acids in length, at least 600 amino acids in length, at least 650 amino acids in length, at least 700 amino acids in length, at least 750 amino acids in length, or at least 800 amino acids in length.
- the RAG1 polypeptide fragment comprises or consists of an amino acid sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any one of SEQ ID NOs: 7 to 14, 164 or 165.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a fragment of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 15.
- the nucleotide sequence encoding a RAG1 polypeptide fragment is at least 1500 bp in length, at least 1600 bp in length, at least 1700 bp in length, at least 1800 bp in length, at least 1900 bp in length, at least 2000 bp in length, at least 2100 bp in length, at least 2200 bp in length, at least 2300 bp in length, or at least 2400 bp in length.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any one of SEQ ID NOs: 17 to 24, 158 or 159.
- the polynucleotide comprises or consists of a nucleotide sequence that has at least 70% identity to any one of SEQ ID NOs: 106 to 115 or 160 to 163. In some embodiments, the polynucleotide comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 1 16.
- the present invention provides a vector comprising the polynucleotide of the invention.
- the vector is a viral vector, optionally an adeno -associated viral (AAV) vector such as an AAV6 vector.
- the vector is a lentiviral vector, such as an integration-defective lentiviral vector (IDLV).
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity to any of SEQ ID NOs: 117-130.
- the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 121 . In preferred embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 122. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 117. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 1 18. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 119.
- the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 120. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 123. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 124. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 125. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 126.
- the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 127. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 128. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 129. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 130.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity to any of SEQ ID NOs: 143-148.
- the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 143. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 144. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 145. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 146. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 147. In some embodiments, the guide RNA comprises or consists of a nucleotide sequence that has at least 90% identity to SEQ ID NO: 148.
- the guide RNA from one to five of the terminal nucleotides at 5’ end and/or 3’ end of the guide RNA are chemically modified to enhance stability, optionally wherein three terminal nucleotides at 5’ end and/or 3’ end if the guide RNA are chemically modified to enhance stability, optionally wherein the chemical modification is modification with 2'-O-methyl 3'phosphorothioate.
- the present invention provides a kit comprising the polynucleotide or the vector of the invention.
- the present invention provides a composition comprising the polynucleotide or the vector of the invention.
- the present invention provides a gene-editing system comprising the polynucleotide or the vector of the invention.
- the kit, composition, or gene-editing system further comprises a guide RNA of the invention. In some embodiments, the kit, composition, or gene-editing system further comprises a RNA-guided nuclease, optionally wherein the RNA-guided nuclease is a Cas9 endonuclease
- the present invention provides for use of the polynucleotide, the vector, the kit, the composition, or the gene-editing system, for gene editing a cell or a population of cells.
- the use is ex vivo or in vitro use.
- the present invention provides a genome comprising the polynucleotide of the invention.
- the present invention provides a cell comprising the polynucleotide, the vector, or the genome of the invention.
- the present invention provides a population of cells comprising one or more cells of the present invention.
- the present invention provides a method of gene editing a population of cells comprising delivering the polynucleotide or the vector of the invention to a population of cells to obtain a population of gene-edited cells.
- the method is an ex vivo or in vitro method.
- the present invention provides a method of treating immunodeficiency in a subject in need thereof, comprising delivering the polynucleotide or the vector of the invention to a population of cells to obtain a population of gene-edited cells and administering the population of gene-edited cells to the subject.
- the present invention provides a population of gene-edited cells obtainable by the method of the invention.
- the present invention provides the polynucleotide, the vector, the guide RNA, the kit, the composition, or the gene-editing system, for use in treating immunodeficiency in a subject.
- the present invention provides a method of treating a subject comprising administering a cell, a population of cells, or a population of gene edited cells of the present invention to the subject.
- the present invention provides a method of treating immunodeficiency in a subject in need thereof comprising administering a cell, a population of cells, or a population of gene edited cells of the present invention to the subject.
- the present invention provides a cell, a population of cells, or a population of gene edited cells of the present invention for use as a medicament.
- the present invention provides a cell, a population of cells, or a population of gene edited cells of the present invention for use in treating immunodeficiency in a subject.
- RAG1 gene editing strategies (A) the “exon 2 RAG1 gene targeting” strategy and (B) the “exon 2 RAG1 gene replacement” strategy.
- C Schematic representations of RAG1 gene, protein domains and gRNA positions mapping at the 5’ region of RAG1 exon 2 (C). Guide RNAs shown in the box are specific for the exon 2 RAG1 gene targeting and replacement strategies.
- D The box highlights the positions of gRNAs targeting the 3’ region of RAG1 exon 2 which can be optionally combined with gRNA targeting the 5’ region of RAG1 exon 2 or gRNA targeting the intron 1 for the exonic and intronic replacement strategies, respectively.
- HA homology arm
- coRAGI CDS codon optimized RAG1 coding sequence
- Ex. exon
- gRNA guide RNA
- 3’IITR 3’ untranslated region
- HDR homology directed repair.
- FIG. 1 Schematic representation of gene editing experiment performed in NALM6-WT cells edited by six gRNAs targeting RAG1 exon 2, guide9 (g9, targeting the intronic region) as negative control, and guide 14 (g 14, targeting the Methionine downstream Methionine 5 causing gene disruption) as positive control.
- FIG. 1 Schematic representation of gene editing experiment performed in NALM6-WT cells edited by six gRNAs targeting RAG1 exon 2, guide9 (g9, targeting the intronic region) as negative control, and guide 14 (g 14, targeting the Methionine downstream Methionine 5 causing gene disruption) as positive control.
- FIG. 1 Analysis of RAG1 protein expression and housekeeping protein p38 as control by Western blot assay.
- (D) Graph shows frequency of GFP+ cells as surrogate of RAG1 recombination activity in bulk NALM6-WT edited cells and in NALM6 cell line lacking RAG1 gene (NALM6.Rag1 -KO clone) assessed 7 days after serum-starvation by flow cytometry.
- (E) Graph shows frequency of insertion and deletion (indel) obtained from single edited clones by TIDE analysis of Sanger sequences.
- (F) shows frequency of GFP+ cells as surrogate of RAG1 recombination activity in selected mono- and bi-allelic edited clones assessed 7 days after serum-starvation by flow cytometry.
- A Schematic representation of gene editing protocol performed to deliver gRNA in CD34+ cells derived from mobilized peripheral blood (MPB-CD34+) of a healthy donor (HD).
- B Graph shows frequency of cutting efficiency of the first six guides assessed ten days upon gRNA delivery by a T7 mismatch selective endonuclease assay.
- A-C Abbreviations: 5’ and 3’ ITR, inverted terminal repeat; L-HA, left homology arm; SA, splice acceptor; c.o., codon optimized; R-HA, right homology arm.
- D-E) Plots show the coverage of on-target reads (chromosome 11 ) of guide 9 (D) and guide 7 (E) and off -target reads identified for guide 7 by relaxed constraints (chromosome 20 and 9).
- F) Percentages of NHEJ induced indels in hCB-CD34 + cells treated with different doses of guides 3 and 9 as in vitro preassembled RNPs, n 2;
- A Schematic representation of gene editing experiment performed in NALM6.Rag1 -KO cells electroporated with gRNA 6 (g6)/Cas9 RNP and transduced with AAV6 donor for the exon 2 RAG1 gene targeting strategy or with AAV6 donor for the exon 2 RAG1 gene replacement strategy with long right homology arm (HAR).
- Bulk edited cells were subcloned and mono- and bi-allelic edited clones were selected by HDR analysis (ddPCR).
- B shows the proportion of edited alleles in single clones performed by ddPCR. Clone 11 showed a bi-allellic editing.
- (C) Graph shows the transduction efficiency of LV-invGFP measured as proportion of CD4+ cells by flow cytometry seven days after serum starvation.
- (D) Recombination activity was evaluated 7 days after serum-starvation as proportion of GFP+ cells gated on transduced cells by flow cytometry.
- NALM6-WT cells and NALM6.Rag1 -KO cells are used as positive and negative controls, respectively.
- E Graph summarizes the recombination activity of NALM6- WT cells as bulk or single clones, NALM6.Rag1 -KO cells and bi- and mono-allelic edited clones evaluated 4 days after serum-starvation as proportion of GFP+ cells gated on transduced cells by flow cytometry.
- A Schematic representation of gene editing experiment performed in human CD34 + cells isolated from mobilized peripheral blood (mPB) of two healthy donors (HDs). Cells were electroporated with gRNA 6 (g6)/Cas9 RNP and transduced with AAV6 donor for the exon 2 RAG1 gene targeting strategy or with AAV6 donor for the exon 2 RAG1 gene replacement strategy which carries the long right homology arm (HAR).
- B Proportion of edited alleles analyzed by ddPCR on bulk untreated and edited CD34 + cells 4 days after the editing.
- C Graph shows cell growth curves of untreated (UT) and edited cells with targeting (Target. AAV6) or replacement (Replac. AAV6) after the editing procedure.
- gRNA 14 (g14xKO) targeting the Methionine downstream Methionine 5 represents as positive control of RAG1 gene disruption.
- A Schematic representation of gene editing protocol performed to deliver nine gRNAs in CD34 + cells derived from mobilized peripheral blood (mPB-CD34 + ) of a healthy donors (HDs).
- gRNA 14 g14xKO
- Methionine downstream Methionine 5 represents as positive control of RAG1 gene disruption.
- gRNA 9 g9 targeting the intronic region represent the negative control.
- B Graph shows frequency of cutting efficiency of gRNAs assessed 7 days upon gRNA delivery by a T7 mismatch selective endonuclease assay (HD_A and B are shown).
- C Representative plots of the T cell differentiation stages analysed by flow cytometry 6 weeks after ATO seeding and editing of CD34 + cells with gRNAs (HD_A is shown).
- FIG. 1 Schematic representation of corrective donor templates specific for “g6 M2 ex2 RAG1” (g6), “g11 exon2 M2/3” (g11), and “g13 exon2 M2/3” (g13) gRNAs.
- Donors for the gene targeting and the replacement strategies have been shown for g6, g11 , and g13.
- An additional donor template has been designed for the replacement strategy exploiting g6 with a short right homology arm (shown in the first lane of g6 donors).
- A Schematic representation of gene editing experiment performed in NALM6.Rag1 -KO cells electroporated with g1 1/Cas9 RNP or g13/Cas9 RNP and transduced with AAV6 donor for the targeting strategy or for the replacement strategy.
- B Proportion of edited alleles was analyzed by ddPCR on bulk untreated and edited NALM6.Rag1 -KO cells 4 days after the editing.
- C shows frequency of GFP+ cells measured by flow cytometry as surrogate of RAG1 recombination activity in bulk NALM6-WT (WT) edited cells, in NALM6 cell line lacking RAG1 gene (KO) and in edited NALM6.Rag1 KO cells assessed 4 and 7 days after starvation induced by CDK4/6 inhibitor (CDK4/6i) or serum deprivation (no FBS).
- A Schematic representation of gene editing experiment performed in human CD34 + cells isolated from mobilized peripheral blood (mPB) of two healthy donors (HDs). Cells were electroporated with gRNA/Cas9 RNP and transduced with AAV6 donor for the targeting or the donor strategy.
- B Proportion of edited alleles was analyzed by ddPCR on bulk untreated and edited CD34 + cells four days after the editing.
- C Editing efficiency on bulk HSPC is shown in terms of HDR, analyzed by ddPCR, and NHEJ, analyzed by T7 mismatch selective endonuclease assay, four days upon gene editing.
- A Schematic representation of gene editing experiment performed in NALM6.Rag1 -KO cells electroporated with sgRNA 11 or 13 (g1 1 or g13)/Cas9 RNP and transduced with AAV6 donor for the exon 2 RAG1 gene targeting strategy or with AAV6 donor for the exon 2 RAG1 gene replacement strategy with long right homology arm (HAR).
- Bulk edited cells were subcloned and mono- and bi-allelic edited clones were selected by HDR analysis (ddPCR).
- B Recombination activity was evaluated 7 days after serum -starvation induced by CDK4/6 inhibitor as proportion of GFP+ cells gated on transduced cells by flow cytometry.
- NALM6-WT (WT) cells and NALM6.Rag1 -KO (KO) cells were used as positive and negative controls, respectively.
- Bi-allelic edited clone (clone 69 edited by g11 and targeting donor) was indicated by the asterisk.
- C Exogenous codon optimized RAG1 expression was measured in edited clones not starved or four days after starvation by RT-qPCR and shown as relative expression to beta-actin used as housekeeping gene. Wilcoxon matched-pairs signed rank test between not starved and starved samples; R values: * ⁇ 0.05; ** ⁇ 0.005; *** ⁇ 0.0005; **** ⁇ 0.0001 ; Mean ⁇ SD are shown.
- FIG. Editing and correction efficiency of exonic gene editing strategy exploiting g11-g13/AAV6 donor sets in human HSPCs
- A Schematic representation of gene editing experiment performed in human CD34 + cells isolated from mobilized peripheral blood (MPB) of healthy donors (HDs) and RAG1 -patient (RAG1 -PT). Cells were electroporated with sgRNA 1 1 or 13 (g11 or g13)/Cas9 RNPs and transduced with AAV6 targeting or replacement donor in presence of HDR enhancers.
- B Proportion of edited alleles analyzed by ddPCR on bulk untreated and edited CD34 + cells 4 days after the editing. Graph shows cumulative data of two independent experiments.
- C Distribution of the CD34 + cell subpopulations and CD34- cells measured by flow cytometry based on the expression of hCD133 and hCD90 analysed 4 days after the editing.
- D Representative plots of the T cell differentiation stages analysed by flow cytometry 6.5 weeks after ATO seeding.
- E Kinetics of TCRap + CD3 + cells analyzed by flow cytometry over time upon ATO seeding with untreated (UT) or edited HD (top panel) and RAG1 -patient cells (bottom panel).
- F-G Simpson complexity index measuring the clonal diversity of TRB repertoire (F) and frequency of top 10 productive rearrangements (G) were analyzed by ImmunoSEQ assay in ATO-derived TCRap + CD3 + cells sorted 6.5 weeks post-seeding and in bulk cells isolated from ATO 7.5 weeks post-seeding.
- A Kinetics of human cell engraftment measured by flow cytometry as frequency of hCD45+ cells in peripheral blood (PB) of NSG mice transplanted with untreated (UT) and edited hMPB- HSPCs derived from healthy donor (HD) and RAG1 -patient (Pt).
- B Kinetics of HDR efficiency in PB tested over time after the transplant (Tx) by ddPCR.
- C Immune cell distribution in PB of transplanted mice measured by flow cytometry according to the expression of hCD19 (B cells), hCD3 (T cells) and hCD13 (myeloid cells) in the hCD45+ gate.
- E Relative frequencies of stages of B cell differentiation were analyzed by flow cytometry in bone marrow cells according to the expression of hCD45, hCD45, hCD34, hCD19, hCD22, hCD10 and hCD20.
- F Molecular analysis of HDR on bone marrow cells analyzed by ddPCR.
- G Proportion of TCRap + CD3 + cells in thymus of transplanted mice analyzed 18 weeks after the transplant by flow cytometry.
- H Molecular analysis of HDR on thymocytes analyzed by ddPCR.
- A Schematic representations of editing of K562 cells co -electroporated with the sgRNA of interest (g11 or g13) and the double strand oligodeoxynucleotide (dsODN) to tag off-target integrations. Cutting efficiency, Tag integration and Guide-Seq analyses were performed 10 days upon electroporation.
- B-C Cutting efficiency measured as percentage of NHEJ (B) and dsODN tag integration (ODN) (C) on the on-target sites were evaluated by RFLP in K562 cells.
- D Summary table showing the total number of off-target sites (OT) identified for g11 and g13 sgRNAs.
- nucleic acid sequences are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
- RAG1 is located at chr 1 1 : 36510353 to 36579762 in assembly GRCh38.p13 and at chr 1 1 : 36532053 to 36601312 in assembly GRCh37.p13.
- Recombination activating gene 1 (RAG1)
- the present invention relates to methods for gene-editing cells to introduce a RAG1 polypeptide or a RAG1 polypeptide fragment, for example as a treatment for severe combined immunodeficiency.
- the present invention also relates to polynucleotides, vectors, guide RNAs, kits, compositions, and gene editing systems for use in said methods, and genomes and cells obtained or obtainable by said methods.
- RAG1 is the abbreviated name of the polypeptide encoded by recombination activating gene 1 and is also known as RAG-1 , RNF74, and recombination activating 1 .
- RAG1 is the catalytic component of the RAG complex, a multiprotein complex that mediates the DNA cleavage phase during V(D)J recombination.
- V(D)J recombination assembles a diverse repertoire of immunoglobulin and T-cell receptor genes in developing B and T- lymphocytes through rearrangement of different V (variable), in some cases D (diversity), and J (joining) gene segments.
- RAG1 mediates the DNA-binding to the conserved recombination signal sequences (RSS) and catalyses the DNA cleavage activities by introducing a double-strand break between the RSS and the adjacent coding segment.
- RAG2 is not a catalytic component but is required for all known catalytic activities.
- RAG1 (NCBI gene ID: 5896) is located in the human genome at chr 1 1 : 36510353 to 36579762.
- Transcript variant 1 (NM 000448) has two exons and one intron.
- the region of the RAG1 gene corresponding to the first exon of transcript variant 1 is called the “RAG1 exon 1”
- the region of the RAG1 gene corresponding to the intron of transcript variant 1 is called the “RAG1 intron 1”
- the region of the RAG1 gene corresponding to the second exon (which encodes a RAG1 polypeptide) is called the “RAG1 exon 2”.
- the RAG1 exon 1 is from chr 11 : 36568006 to chr 11 : 36568122; the RAG1 intron 1 is from chr 1 1 : 36568123 to chr 1 1 : 36573290; and/or the RAG1 exon 2 is from chr 1 1 : 36573291 to chr 1 1 : 36579762.
- the RAG1 exon 1 consists of the nucleotide sequence of SEQ ID NO: 1 , or variants thereof; the RAG1 intron 1 consists of the nucleotide sequence of SEQ ID NO: 2, or variants thereof; and/or the RAG1 exon 2 consists of the nucleotide sequence of SEQ ID NO: 3, or variants thereof.
- Illustrative RAG1 exon 1 (SEQ ID NO: 1 ) ag aaacaag ag g g caag g ag agcag ag acacactttg ccttctctttg g tattg ag taatatcaaccaaattg c ag acatctcaacactttg g ccag g cag cctg ctg ag caag
- RAG1 intron 1 (SEQ ID NO: 2) g taacactcatacttttcatg ccttg ag ccaaaatatttattacatttttat g tttctaactag aag tg cttg ag ctttttttccttcc ag g tg atg ag g g g g atg g aatg ag caaag ctacatcaatttttttttttaatg tatg aaaataaaaag g tacaag ag g cc aag tttag g g ccactg aag g ttcatag aaag atg caaaatatctg tcag ag atg caaaatatctg tcag ag atg caaaatatc
- RAG1 exon 2 (SEQ ID NO: 3) gtacctcagccagcATGGCAGCCTCTTTCCCACCCACCTTGGGACTCAGTTCTGCCCC AGATGAAATTCAGCACCCACATATTAAATTTTCAGAATGGAAATTTAAGCTGTTC CGGGTGAGATCCTTTGAAAAGACACCTGAAGAAGCTCAAAAGGAAAAGAAGGAT TCCTTTGAGGGGAAACCCTCTCTGGAGCAATCTCCAGCAGTCCTGGACAAGGC TGATGGTCAGAAGCCAGTCCCAACTCAGCCATTGTTAAAAGCCCACCCTAAGTT TTCAAAGAAATTTCACGACAACGAGAAAGCAAGAGGCAAAGCGATCCATCAAGC CAACCTTCGACATCTCTGCCGCATCTGTGGGAATTCTTTTAGAGCTGATGAGCA CAACAGGAGATATCCAGTCCATGGTCCTGTGGATGGTAAAACCCTAGGCCTTTT ACGAAAGAAGGAAAAGAGCTACTTCCTGGCCGGACCTCATT
- RAG1 exon 2 SEQ ID NO: 3
- upper case letters indicate a nucleotide sequence which encodes a RAG1 polypeptide.
- Isolated polynucleotides according to the present invention may comprise a nucleotide sequence encoding a RAG1 polypeptide, or a fragment thereof.
- the RAG1 polypeptide may be a human RAG1 polypeptide.
- the RAG1 polypeptide may comprise or consist of a polypeptide sequence of UniProtKB accession P15918, or a variant thereof.
- a “RAG1 polypeptide” is a polypeptide having RAG1 activity, for example a polypeptide which is able to form a RAG complex, mediate DNA-binding to the RSS, and introduce a doublestrand break between the RSS and the adjacent coding segment.
- a RAG1 polypeptide may have the same or similar activity to a wild-type RAG1 , e.g. may have at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, or at least 150% of the activity of a wild-type RAG1 polypeptide.
- a “RAG1 polypeptide variant” may include an amino acid sequence or a nucleotide sequence which may be at least 50%, at least 55%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85% or at least 90% identical, optionally at least 95% or at least 97% or at least 99% identical to a wild-type RAG1 polypeptide.
- RAG1 variants may have the same or similar activity to a wild-type RAG1 polypeptide, e.g.
- the RAG1 polypeptide may have at least at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 100%, at least 1 10%, at least 120%, at least 130%, at least 140%, or at least 150% of the activity of a wildtype RAG1 polypeptide.
- Core RAG1 consists of multiple structural domains, termed the nonamer binding domain (NBD; residues 389-464), the central domain (residues 528-760), and the C-terminal domain (residues 761 - 980) domains.
- core RAG1 contains the essential acidic active site residues (Arbuckle, J.L., et al., 201 1. BMC biochemistry, 12(1 ), p.23).
- a variant of RAG1 comprises a nonamer binding domain, a central domain, and/or a C-terminal domain.
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 70% identical to SEQ ID NO: 4.
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 4.
- a RAG1 polypeptide comprises or consists of SEQ ID NO: 4.
- RAG1 polypeptide isoform 1 UniProtKB accession P15918 (SEQ ID NO: 4)
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 70% identical to SEQ ID NO: 5.
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 5.
- a RAG1 polypeptide comprises or consists of SEQ ID NO: 5.
- RAG1 polypeptide isoform 2 UniProtKB accession P15918 (SEQ ID NO: 5)
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 70% identical to SEQ ID NO: 6.
- a RAG1 polypeptide comprises or consists of an amino acid sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 6.
- a RAG1 polypeptide comprises or consists of SEQ ID NO: 6.
- RAG1 polypeptide (SEQ ID NO: 6) MAASFPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKTPEEAQKEKKDSFEGKP SLEQSPAVLDKADGQKPVPTQPLLKAHPKFSKKFHDNEKARGKAIHQANLRHLCRI CGNSFRADEHNRRYPVHGPVDGKTLGLLRKKEKRATSWPDLIAKVFRIDVKADVDS IHPTEFCHNCWSIMHRKFSSAPCEVYFPRNVTMEWHPHTPSCDICNTARRGLKRKS LQPNLQLSKKLKTVLDQARQARQRKRRAQARISSKDVMKKIANCSKIHLSTKLLAVD FPEHFVKSISCQICEHILADPVETNCKHVFCRVCILRCLKVMGSYCPSCRYPCFPTDL ESPVKSFLSVLNSLMVKCPAKECNEEVSLEKYNHHISSHKESKEIFVHINKGGRPRQ HLLSLTRRAQKHR
- Isolated polynucleotides according to the present invention may comprise a nucleotide sequence encoding a RAG1 polypeptide fragment.
- a “RAG1 polypeptide fragment” may refer to a portion or region of a full-length RAG1 polypeptide or variant thereof.
- a RAG1 polypeptide fragment may be at least 50 amino acids in length, at least 100 amino acids in length, at least 150 amino acids in length, at least 200 amino acids in length, at least 250 amino acids in length, at least 300 amino acids in length, at least 350 amino acids in length, at least 400 amino acids in length, at least 450 amino acids in length, at least 500 amino acids in length, at least 550 amino acids in length, at least 600 amino acids in length, at least 650 amino acids in length, at least 700 amino acids in length, at least 750 amino acids in length, at least 800 amino acids in length, at least 850 amino acids, or at least 900 amino acids in length.
- the RAG1 polypeptide fragment may comprise at least the final 50 amino acids, at least the final 100 amino acids, at least the final 150 amino acids, at least the final 200 amino acids, at least the final 250 amino acids, at least the final 300 amino acids, at least the final 350 amino acids, at least the final 400 amino acids, at least the final 450 amino acids, at least the final 500 amino acids, at least the final 550 amino acids, at least the final 600 amino acids, at least the final 650 amino acids, at least the final 700 amino acids, at least the final 750 amino acids, at least the final 800 amino acids, at least the final 850 amino acids, or at least the final 900 amino acids of a full-length RAG1 polypeptide or variant thereof, optionally wherein 1 to 20 amino acids (e.g. about 15 amino acids) are absent from the C-terminus of the full-length RAG1 polypeptide or variant thereof.
- 1 to 20 amino acids e.g. about 15 amino acids
- the RAG1 polypeptide fragment comprises or consists of an amino acid sequence which is at least 70% identical to any of SEQ ID NOs: 7-14 or 164- 165.
- the RAG1 polypeptide fragment comprises or consists of an amino acid sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to any of SEQ ID NOs: 7-14 or 164-165.
- the RAG1 polypeptide fragment comprises or consists of any of SEQ ID NOs: 7-14 or 164-165.
- RAG1 polypeptide fragment 1 SEQ ID NO: 7
- RAG1 polypeptide fragment 2 (SEQ ID NO: 8)
- RAG1 polypeptide fragment 3 (SEQ ID NO: 9)
- RAG1 polypeptide fragment 4 (SEQ ID NO: 10)
- RAG1 polypeptide fragment 5 (SEQ ID NO: 11 )
- RAG1 polypeptide fragment 6 SEQ ID NO: 12
- RAG1 polypeptide fragment 7 SEQ ID NO: 13
- RAG1 polypeptide fragment 8 SEQ ID NO: 14
- RAG1 polypeptide fragment 9 SEQ ID NO: 164
- RAG1 polypeptide fragment 10 SEQ ID NO: 165
- RAG1 polynucleotides
- a nucleotide sequence encoding a RAG1 polypeptide (or a variant of fragment thereof) may be codon-optimised.
- a nucleotide sequence encoding a RAG1 polypeptide (or a variant of fragment thereof) may be codon optimised for expression in a human cell.
- Codon usage tables are known in the art for mammalian cells (e.g. humans), as well as for a variety of other organisms.
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 15.
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 15.
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of the nucleotide sequence SEQ ID NO: 15.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 70% identical to a fragment of SEQ ID NO: 15.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to a fragment of SEQ ID NO: 15.
- a nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a fragment of the nucleotide sequence SEQ ID NO: 15.
- nucleotide sequence encoding a RAG1 polypeptide (SEQ ID NO: 15) atg g ccgcctccttcccacctacccttg g attg tcctccgcccctg acg aaattcaacatccccacatcaaattctcg g a g tg g aag ttcaag ctctttcg eg tgcg ctcg tteg aaaag acccccg ag g aag cccaaaag gag aag aaag actc atteg aag g aaaacccag cctcg aacag tccccg g ccg teetg g acaag g ccg acg g gcag aag
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 16.
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 16.
- a nucleotide sequence encoding a RAG1 polypeptide comprises or consists of the nucleotide sequence SEQ ID NO: 16.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 70% identical to a fragment of SEQ ID NO: 16.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to a fragment of SEQ ID NO: 16.
- a nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a fragment of the nucleotide sequence SEQ ID NO: 16.
- nucleotide sequence encoding a RAG1 polypeptide (SEQ ID NO: 16) atg g ccgccag ctttcctcctacactg g g actg tctag eg cccctg acg ag attcag caccctcacatcaag ttcag eg ag tg g aag ttcaag etg ttcag ag tg eg g agetteg ag aaaacccctg ag g aag cccag aaag ag ag ag g ac ag etteg ag g g g caag cccag cctg g aacag tctcctg etg tg etg etg g ataag g cc
- a nucleotide sequence encoding a RAG1 polypeptide fragment may be at least 100 bp in length, 200 bp in length, 300 bp in length, 400 bp in length, 500 bp in length, 600 bp in length, 700 bp in length, 800 bp in length, 900 bp in length, 1000 bp in length, 1 100 bp in length, 1200 bp in length, 1300 bp in length, 1400 bp in length, 1500 bp in length, at least 1600 bp in length, at least 1700 bp in length, at least 1800 bp in length, at least 1900 bp in length, at least 2000 bp in length, at least 2100 bp in length, at least 2200 bp in length, at least 2300 bp in length, at least 2400 bp in length , at least 2500 bp in length, at least 2600 bp in length, at least 2700 bp in length,
- a nucleotide sequence encoding a RAG1 polypeptide fragment may comprise at least the final 200 bp, at least the final 300 bp, at least the final 400 bp, at least the final 500 bp, at least the final 600 bp, at least the final 700 bp, at least the final 800 bp, at least the final 900 bp, at least the final 1000 bp, at least the final 1 100 bp, at least the final 1200 bp, at least the final 1300 bp, at least the final 1400 bp, at least the final 1500 bp, at least the final 1600 bp, at least the final 1700 bp, at least the final 1800 bp, at least the final 1900 bp, at least the final 2000 bp, at least the final 2100 bp, at least the final 2200 bp, at least the final 2300 bp, at least the final 2400 bp, at least the final 2500 bp, at least the final 200
- a nucleotide sequence encoding a RAG1 polypeptide fragment may be in -frame with the RAG1 gene.
- a person skilled in the art would be able to generate nucleotide sequences encoding a RAG1 polypeptide fragment which are in-frame with the RAG1 gene using techniques known in the art.
- a nucleotide sequence encoding a RAG1 polypeptide fragment may be used replace part of the RAG1 gene which encodes an endogenous RAG1 polypeptide.
- the nucleotide sequence encoding a RAG1 polypeptide fragment may be introduced in-frame with the remaining part of the RAG1 gene.
- a nucleotide sequence encoding a downstream portion of the RAG1 polypeptide fragment may be introduced into the RAG1 exon 2 in -frame with an upstream portion of the endogenous RAG1 gene, such that the edited RAG1 gene encodes a RAG1 polypeptide.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 70% identical any of SEQ ID NOs: 17-24 or 158-159.
- the nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to any of SEQ ID NOs: 17-24 or 158-159.
- a nucleotide sequence encoding a RAG1 polypeptide fragment comprises or consists of the nucleotide sequence of any of SEQ ID NOs: 17-24 or 158-159.
- nucleotide encoding a RAG1 polypeptide fragment 1 (SEQ ID NO: 17) g cag caag atccacctg ag caccaaactg ctg g ccg tg g acttccctg ag cacttcg tg aag tccatcag ctg ccag atctg eg ag cacatcctg g ccg atcctg tg g aaacaaactg caagcacg tg ttctg cag ag tg tg catcctg eg g tg c ctg aaag tg atg g g g cag ctactgcccctctgcag atacccttg cttcccaccg atctg g aaag ccctg tg tg
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 2 (SEQ ID NO: 18) g cag caag atccacctg ag caccaaactg ctg g ccg tg g acttccctg ag cacttcg tg aag tccatcag ctg ccag atctg egag cacatcctg g ccg atcctg tg g aaacaaactg caagcacg tg ttctg cag ag tg tg catcctg eg g tg c ctg aaag tg atg g g g cag ctactgcccctctgcag atacccttg cttcccaccg atctg g aaag ccctg tg a
- nucleotide encoding a RAG1 polypeptide fragment 3 (SEQ ID NO: 19) g aatg g caccctcacacacccag ctg eg acatctg caacacag ccag aag ag g cctg aagcg g aag tccctg ca g cctaatctg cag ctg ag caag aaactg aaaaeeg tg ctg g accag g ccag acag g cccg g caaag aaag ag agggcccaagccagaatcagcagcaaggacgtgatgaagaagatcgccaactgcagcaagatccacctgagca ccaaactg ctg g ccg tg g acttc
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 4 (SEQ ID NO: 20) g aatg g caccctcacacacccag etg eg acatctg caacacag ccag aag ag g cctg aagcg g aag tccctg ca g cctaatctg cag etg ag caag aaactg aaaaeeg tg etg g accag g ccag acag g cccg g caaag aaag ag ag g g g cccaag ccag aatcagcag caag g acg tg atg aag aag ateg ccaactgcagcaag atccacctg ag ca ccaa
- nucleotide encoding a RAG1 polypeptide fragment 5 (SEQ ID NO: 21 ) g eg aag tg tacttccccag aaacg tg accatg g aatg g caccctcacacacccag etg eg acatctg caacacag c cag aag ag g cctg aag eg g aag tccctg cag cctaatctg cagctg ag caag aaactg aaaaeeg tg etg g a cc ag g ccag acag g cccg g caaag aaag ag ag g g g cccaag aatcagcagcag g cccg g caaag a
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 6 (SEQ ID NO: 22) tag aag ag g cctg aag eg g aag tccctg cag cctaatctg cag ctg ag caag aaactg aaaaeeg tg ctg g acca g g ccag acag g cccg g caaag aag ag ag g gcccaag ccag aatcag cag caag g acg tg atg aag aag a teg ccaactg cag caag atccacctgag caccaaactg ctg g ccg tg g g acttccctg ag cacttcg tg aa
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 7 (SEQ ID NO: 23) cccag aaacg tg accatg g aatg g caccctcacacacccag etgeg acatctg caacacag ccag aag ag g cct g aag eg g aag tccctg cag cctaatctg cag ctg ag caag aaactg aaaaeeg tg ctg g accag g ccag acag g cccg g caaag aag ag ag g g cccaag ccag aatcagcag caag g acg tg atg aag aag ateg ccaactg ca g ca
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 8 (SEQ ID NO: 24) ccctag aaaag tacaaccaccacatcag cagccacaaag ag tccaaag aaatetteg tg cacatcaacaaag g c g g cag accccg gcag catctg ctg tctcttacaag acg g g cccag aag caccg g ctg agag aactg aag ctg caa g tg aag g cctttg ccg acaaag aggaaggeggeg acg tcaag ag eg tg tg catg accctg ttctg ctg g g ccctg ag a
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 9 (SEQ ID NO: 158) cccag aaacg tg accatg g aatg g caccctcacacacccag etgeg acatctg caacacag ccag aag ag g cct g aag eg g aag tccctg cag cctaatctg cag etg ag caag aaactg aaaaeeg tg etg g accag g ccag acag g cccg g caaag aag ag ag g gcccaag ccag aatcagcag caag g acg tg atg aag aag atcg ccaactg ca g caag
- Illustrative nucleotide encoding a RAG1 polypeptide fragment 10 (SEQ ID NO: 159) g eg aag tg tacttccccag aaacg tg accatg g aatg g caccctcacacacccag ctg eg acatctg caacacag c cag aag ag g cctg aag eg g aag tccctg cag cctaatctg cagctg ag caag aaactg aaaaeeg tg ctg g ace ag g ccag acag g cccg g caaagaaag ag ag g g g cccaag ccag aatcagcagcaag g acg tg atg aa
- the present invention provides a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, and a second homology region.
- the first homology region may be homologous to a first region of the RAG1 intron 1 or exon 2 and the second homology region may be homologous to a second region of the RAG1 exon 2.
- the polynucleotide may be an isolated polynucleotide.
- the polynucleotide may be a DNA molecule, e.g. a double-stranded DNA molecule.
- the polynucleotide of the invention may be limited to a size suitable to be inserted into a vector (e.g. an adeno-associated viral (AAV) vector, such as AAV6).
- a vector e.g. an adeno-associated viral (AAV) vector, such as AAV6
- the polynucleotide of the invention may be 5.0 kb or less, 4.9 kb or less, 4.8 kb or less, 4.7 kb or less, 4.6 kb or less, 4.5 kb or less, 4.4 kb or less, 4.3 kb or less, 4.2 kb or less, 4.1 kb or less, 4.0 kb or less in total size.
- the polynucleotide of the invention is 4.1 kb or less or 4.0 kb or less in size.
- the present invention provides a genome comprising a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment.
- the genome may comprise the polynucleotide of the present invention.
- the genome may be an isolated genome.
- the genome may be a mammalian genome, e.g. a human genome.
- a “homology region” (also known as “homology arm”) is a nucleotide sequence which is located upstream or downstream of a nucleotide sequence to be inserted (a “nucleotide sequence insert” e.g. a splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide).
- the polynucleotide of the present invention comprises two homology regions, one upstream of the nucleotide sequence insert (the “first homology region”) and one downstream of the nucleotide insert (the “second homology region”).
- Each “homology region” is designed such that the nucleotide sequence insert can be introduced into a genome at a site of a double strand break (DSB) by homology-directed repair (HDR).
- HDR homology-directed repair
- One of skill in the art will be able to design homology arms depending on the desired insertion site (i.e. the site of the DSB) (see e.g. Ran, F.A., et al., 2013. Nature protocols, 8(1 1 ), pp.2281 -2308).
- Each “homology region” is homologous to a region either side of the DSB.
- the first homology region may be homologous to a region upstream of the DSB and the second homology region may be homologous to a region downstream of the DSB.
- the term “homologous” means that the nucleotide sequences are similar or identical.
- the nucleotide sequences may be at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, at least 98% identical, at least 99% identical, or 100% identical.
- upstream and downstream both refer to relative positions in DNA or RNA.
- Each strand of DNA or RNA has a 5’ end and a 3’ end and, by convention, “upstream” and “downstream” relate to the 5' to 3' direction respectively in which RNA transcription takes place.
- upstream is toward the 5' end of the coding strand for the gene in question (e.g. RAG1 ) and downstream is toward the 3' end of the coding strand for the gene in question (e.g. RAG1 ).
- the homology regions may be any length suitable for HDR.
- the homology regions may be the same or different lengths.
- the homology regions are each independently 50-2000 bp in length, 50-1800 bp in length, 50-1500 bp in length, 50-1000 bp in length, 100-500 bp in length, or 200-400 bp in length.
- the first homology region may be 50-2000 bp in length and homologous to a region upstream of a DSB and the second homology region may be 50-2000 bp in length and homologous to a region downstream of the DSB.
- the first homology region is about 50-1000bp in length, 100-500 bp in length, or 200-400 bp in length and the second homology region is about 50-1 OOObp in length, 100-500 bp in length, or 200-400 bp in length. In other embodiments, the first homology region is about 50-1 OOObp in length, 100-500 bp in length, or 200-400 bp in length and the second homology region is about 500-2000bp in length, 800-2000bp in length, 1000-2000bp in length, or 1500-2000 bp in length.
- the first homology region is homologous to a first region of the RAG1 exon 2 and the second homology region is homologous to a second region of the RAG1 exon 2;
- the first homology region is homologous to a first region of the RAG1 intron 1 or the start of the RAG1 exon 2 (e.g. the first 200 bp of the RAG1 exon 2) and the second homology region is homologous to a second region of the RAG1 exon 2, preferably wherein the first homology region is homologous to a region of the RAG1 intron 1 and the second homology region is homologous to a region of the RAG1 exon 2.
- embodiment (i) may be referred to as an “exon 2 RAG1 gene strategy” and embodiment (ii) may be referred to as an “intron 1 RAG1 gene strategy”.
- the first homology region is homologous to a first region of the RAG1 exon 2 and the second homology region is homologous to a second region of the RAG1 exon 2.
- the first homology region is homologous to a region upstream of chr 11 : 36574368 and the second homology region is homologous to a region downstream of chr 11 : 36574369;
- the first homology region is homologous to a region upstream of chr 11 : 36574367 and the second homology region is homologous to a region downstream of chr 11 : 36574368;
- the first homology region is homologous to a region upstream of chr 11 : 36574394 and the second homology region is homologous to a region downstream of chr 11 : 36574395;
- the first homology region is homologous to a region upstream of chr 1 1 : 36574294 and the second homology region is homologous to a region downstream of chr 11 : 36574295;
- the first homology region is homologous to a region upstream of chr 1 1 : 36574109 and the second homology region is homologous to a region downstream of chr 11 : 36574110;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573910 and the second homology region is homologous to a region downstream of chr 11 : 3657391 1 ;
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879;
- the first homology region is homologous to a region upstream of chr 11 : 36573959 and the second homology region is homologous to a region downstream of chr 11 : 36573960;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573957 and the second homology region is homologous to a region downstream of chr 11 : 36573958;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573879 and the second homology region is homologous to a region downstream of chr 11 : 36573880;
- the first homology region is homologous to a region upstream of chr 1 1 : 36573892 and the second homology region is homologous to a region downstream of chr 11 : 36573893;
- the first homology region is homologous to a region upstream of chr 11 : 36573955 and the second homology region is homologous to a region downstream of chr 11 : 36573956;
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879; or
- the first homology region is homologous to a region upstream of chr 1 1 : 36574406 and the second homology region is homologous to a region downstream of chr 11 : 36574407.
- the first homology region is homologous to a region upstream of chr 1 1 : 36574109 and the second homology region is homologous to a region downstream of chr 11 : 36574110; or
- the first homology region is homologous to a region upstream of chr 11 : 36573910 and the second homology region is homologous to a region downstream of chr 11 : 3657391 1 .
- the first homology region is homologous to a region upstream of chr 1 1 : 36573892 and the second homology region is homologous to a region downstream of chr 11 : 36573893; or
- the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879.
- the first homology region is homologous to a region upstream of chr 1 1 : 36573878 and the second homology region is homologous to a region downstream of chr 1 1 : 36573879.
- the first homology region may be homologous to a region immediately upstream of the DSB.
- the second homology region is: (a) homologous to a region immediately downstream of the DSB; or (b) homologous to a region distantly downstream of the DSB.
- embodiment (a) may be referred to as an “exon 2 RAG1 gene targeting strategy” and embodiment (b) may be referred to as an “exon 2 RAG1 gene replacement strategy”.
- immediate upstream or “immediately downstream” may mean the region is 100bp or less, 50bp or less, 40bp or less, 30bp or less, 20bp or less, 10bp or less, 5bp or less, 4bp or less, 3bp or less, 2bp or less, or 1 bp upstream of the DSB.
- disantly downstream may mean the region is 150bp or more, 200bp or more, 250bp or more, 300bp or more, 350bp or more, 400bp or more, 450bp or more, 500bp or more, 600bp or more, 700bp or more, 800bp or more, 900bp or more, 1000bp or more, 1500bp or more, or 2000bp or more downstream of the DSB.
- a distantly downstream region may be downstream of chr 1 1 : 36574557; downstream of chr 11 : 36574870; downstream of chr 11 : 36575183; downstream of chr 11 : 36575496; downstream of chr 11 : 36575810; downstream of chr 11 : 36576123; or downstream of chr 11 : 36576436
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574369-36574418; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 11 : 36574871 -36574970, a region comprising chr 11 : 36575184-36575283, a region comprising chr 11 : 36575497-36575596, a region comprising chr 11 : 36575811 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574318- 36574367 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574368-36574417; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 11 : 36574871 -36574970, a region comprising chr 11 : 36575184-36575283, a region comprising chr 11 : 36575497-36575596, a region comprising chr 11 : 36575811 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574395-36574444; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 11 : 36574871 -36574970, a region comprising chr 11 : 36575184-36575283, a region comprising chr 11 : 36575497-36575596, a region comprising chr 11 : 36575811 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574295-36574344; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 11 : 36574871 -36574970, a region comprising chr 11 : 36575184-36575283, a region comprising chr 11 : 36575497-36575596, a region comprising chr 11 : 36575811 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574110-36574159; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573911 -36573960; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573960-36574009; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573958-36574007; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536; (x) the first homology region is homologous to a region comprising chr 11 : 36573
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573893-36573942; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573956-36574005; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574407-36574456; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574110-36574159; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573911 -36573960; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573893-36573942; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36574558- 36574657, a region comprising chr 1 1 : 36574871 -36574970, a region comprising chr 1 1 : 36575184-36575283, a region comprising chr 1 1 : 36575497-36575596, a region comprising chr 11 : 3657581 1 -36575910, a region comprising chr 11 : 36576124- 36576223, or a region comprising chr 1 1 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574369-36574418; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574368-36574417; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574395-36574444; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574295-36574344; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574110-36574159; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573911 -36573960; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573960-36574009; or (b) a region comprising chr 11 : 36576437- 36576536; (ix) the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573958-36574007; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573880-36573929; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573893-36573942; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573956-36574005; or (b) a region comprising chr 11 : 36576437- 36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36576437- 36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574407-36574456; or (b) a region comprising chr 11 : 36576437- 36576536.
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36574110-36574159; or (b) a region comprising chr 11 : 36576437- 36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573911 -36573960; or (b) a region comprising chr 11 : 36576437- 36576536.
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573893-36573942; or (b) a region comprising chr 11 : 36576437- 36576536; or
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to: (a) a region comprising chr 11 : 36573879-36573928; or (b) a region comprising chr 11 : 36576437- 36576536.
- the first homology region is homologous to a region comprising chr 1 1 : 36573829-36573878 and/or the second homology region is homologous to: (a) a region comprising chr 1 1 : 36573879-36573928; or (b) a region comprising chr 11 : 36576437- 36576536.
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to a region comprising chr 11 : 36574369-36574418;
- the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367 and/or the second homology region is homologous to a region comprising chr 11 : 36574368-36574417;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to a region comprising chr 11 : 36574395-36574444;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to a region comprising chr 11 : 36574295-36574344;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36574110-36574159;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 3657391 1 -36573960;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36573879-36573928;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to a region comprising chr 11 : 36573960-36574009;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to a region comprising chr 11 : 36573958-36574007;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879 and/or the second homology region is homologous to a region comprising chr 11 : 36573880-36573929;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36573893-36573942;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to a region comprising chr 11 : 36573956-36574005;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36573879-36573928; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to a region comprising chr 11 : 36574407-36574456.
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36574110-36574159; or (vi) the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 3657391 1 -36573960.
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36573893-36573942; or
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36573879-36573928.
- the first homology region is homologous to a region comprising chr 1 1 : 36573829-36573878 and/or the second homology region is homologous to a region comprising chr 1 1 : 36573879-36573928.
- the first homology region is homologous to a region comprising chr 11 : 36574319- 36574368 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36574318- 36574367 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574345- 36574394 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574245- 36574294 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573910- 36573959 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573908- 36573957 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573830- 36573879 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 11 : 36573906- 36573955 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536;
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 11 : 36574357- 36574406 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 11 : 36574060- 36574109 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536; or (vi) the first homology region is homologous to a region comprising chr 11 : 36573861 - 36573910 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 11 : 36573843- 36573892 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536; or
- the first homology region is homologous to a region comprising chr 1 1 : 36573829- 36573878 and/or the second homology region is homologous to a region comprising chr 11 : 36576437-36576536.
- the first homology region is homologous to a region comprising chr 1 1 : 36573829-36573878 and/or the second homology region is homologous to a region comprising chr 1 1 : 36576437-36576536.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 25-44.
- Table 1 Exemplary first homology regions for exon 2 strategies
- Table 2 Exemplary first homology regions for exon 2 strategies
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 45-60.
- Table 3 Exemplary second homology regions for exon 2 targeting strategies
- Table 4 Exemplary second homology regions for exon 2 targeting strategies
- the first and second homology regions comprise or consist of nucleotide sequences that have at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to first and second homology regions in Tables 1 to 4, which are designed for the same guide RNAs.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 25-44 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to the corresponding nucleotide sequence in Tables 3 or 4 (i.e. SEQ ID NOs: 45-60).
- SEQ ID NOs: 45-60 i.e. SEQ ID NOs:
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 45;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 46;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 47;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 48;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 49 or SEQ ID NO: 59;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 50 or SEQ ID NO: 60;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 51 ;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 52;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 53;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 54;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 55;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 56;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 58.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 49 or SEQ ID NO: 59; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 50 or SEQ ID NO: 60.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 55; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57.
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 25-44 and/or the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 45-60.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 44-60 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to the corresponding nucleotide sequence Tables 3 or 4 (i.e. SEQ ID NOs: 45-60).
- SEQ ID NOs: 45-60 i.e. SEQ ID NOs:
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 45;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 46;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 47;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 48;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 49 or SEQ ID NO: 59;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 50 or SEQ ID NO: 60;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 51 ;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 52; (ix) the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 54;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 55;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 56;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 58.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 49 or SEQ ID NO: 59; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 50 or SEQ ID NO: 60.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 57.
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least at least 90% identity
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 61 -68.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 25 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 26 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 27 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 28 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 31 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 32 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 33 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 34 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 36 or SEQ ID NO: 42 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67;
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 38 or SEQ ID NO: 44 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 29 or SEQ ID NO: 39 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 30 or SEQ ID NO: 40 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 35 or SEQ ID NO: 41 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67; or
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67.
- the 3’ terminal sequence of the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 37 or SEQ ID NO: 43 and the 5’ terminal sequence of the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 67.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 69-76 or 153-154, or a fragment thereof.
- the fragments are at least 50 bp in length, for example 50- 1000 bp or 100-500 bp in length.
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 77-78 or 155-156, or a fragment thereof.
- the fragments are at least 50 bp in length, for example 50- 1000 bp or 100-500 bp in length.
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 79-80 or 157, or a fragment thereof.
- the fragments are at least 500 bp in length, for example 500-2000 bp or 900-1800 bp in length.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 69, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 77, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 71 , or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 78, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 73, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 74, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 75, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 76, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 79, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 155, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 156, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 69, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 77, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 70, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 71 , or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 78, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 72, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 80, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 73, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 74, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 75, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof; or
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 76, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 79, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 155, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 153, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 157, or a fragment thereof;
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 156, or a fragment thereof; or
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 157, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 156, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 154, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 157, or a fragment thereof.
- Illustrative first homology region for g5 exon 2 (SEQ ID NO: 69) g atccatcaag ccaaccttcg acatctctg ccg c atctg tg g g aattcttttag ag ctg atg ag cacaacag g ag atatc cag tccatg g tcctg tg g atg g taaaccctag g ccttttacg aaag aag g aaaag ag ag ctacttcctg g ccg g actcattg ccaag g ttttccg g atcg atg tg aag g cag atg ttg actcg atccaccccactg ag ttctg ccataactgcg
- Illustrative first homology region for g5 exon 2 (SEQ ID NO: 70) aaaaccctag g ccttttacg aaag aag g aaaag ag ag ctacttcctg g ccg g acctcattg ccaag g ttttccg g ate g atg tg aag g cag atg ttg actcg atccaccccactg ag ttctg ccataactg ctg g agcatcatg cacag g aag ttta g cag tg ccccatg tg ag g tttacttccccgag g aacg tttacttccccgag g aacg tg tg accatg g a
- Illustrative first homology region for g6 exon 2 (SEQ ID NO: 71 ) tg ag atcctttg aaaag acacctg aag aag ctcaaag g aaaag aag gattcctttg ag g g g aaaccctctctg g a g caatctccagcag tcctg g acaag g ctg atg g tcag aag ccag tcccaactcag ccattg ttaaaag cccacccta ag ttttcaaag aaatttcacg acaacg ag aaag caaaag eg atccatcaag ccaaccttcg acatctctg acatctcg
- Illustrative first homology region for g6 exon 2 (SEQ ID NO: 72) g ag cacaacag g ag atatccag tccatg g tcctg tg g atg g taaaccctag g cctttttacg aaag aag g aaaag a g ag ctacttcctg g ccg g acctcattg ccaag g ttttccg g atcg atg tg aag g cag atg ttg actcg atccaccccact g ag ttctg ccataactg ctg g ag catcatgcacag g aag tttag cag tg ccccatg tg ag g tttacttccccg ag
- Illustrative first homology region forg7, g10, g13 exon 2 (SEQ ID NO: 73) g aattcttttag ag ctg atg agcacaacag g ag atatccag tccatg g tcctg tg g atg g taaaccctag g cctttttac g aaag ag g aaag ag agctacttcctg g ccg g acctcattg ccaag g ttttccg g atcg atg tg aag g cag atg tt g actcg atccaccccactg ag ttctg ccataactgc tg g ag catcatg cacag g aag tttag cag tg caccat
- Illustrative first homology region for g8, g9, g12 exon 2 (SEQ ID NO: 74) ccag tccatg g tcctg tg g atg g taaaccctag g ccttttacg aaag aag g aaag ag ag ctacttcctg g ccg g a cctcattg ccaag g ttttccg g atcg atg tg aag g cag atg ttg actcg atccaccccactg ag ttctg ccataactg ctg g ag catcatg cacag g aag tttag cag tg ccccatg tg ag g tttacttccccg ag g ag catcatg ca
- Illustrative first homology region for g1 1 exon 2 (SEQ ID NO: 75) ctg atg ag cacaacag g ag atatccag tccatg g tcctg tg g atg g taaaccctag g ccttttt acg aaag aag g aag ag ag ctacttcctg g ccg g g acctcattg ccaag g ttttccg g atcg atg tg aag g cag atg ttg actcg atccacc ccactg ag ttctg ccataactg ctg g agcatcatg cacag g aag tttag cag tg ccccatg tg ag g tttacttctg
- Illustrative first homology region for g14 exon 2 (SEQ ID NO: 76) catg g ag tg g cacccccacacaccatcctg tg acatctg caacactg cccg teg g g g g actcaag ag g aag ag tette ag ccaaacttg cag ctcagcaaaaaactcaaaactg tg ettg accaag caag acaagcccg teageg caag ag a ag ag ctcag g caag g atcag cag caag g atg tcatg aag aag atcg ccaactg cag taag atacatcttag tacca ag ctccttg cag tg acttcccag agcactttg
- Illustrative first homology region forg7, g10, g13 exon 2 (SEQ ID NO: 154) ttcag cacccacatattaaattttcag aatg g aaatttaag ctg ttccg g g tg ag atcctttg aaaag acacctg aag aa g ctcaaaag g aaaag aag g attcctttg ag g g g aaaccctctctg g ag caatctccagcag tcctg g acaag g ctg atg g tcag aag ccag tcccaactcagccattg ttaaaag ccaccctaag ttttcaaag aatttcacgg
- Illustrative second homology region for g6 exon 2 - targeting strategy (SEQ ID NO:
- Illustrative second homology region for exon 2 - replacement strategy (SEQ ID NO: 80) aggcatagagg actctctg g aaag ccaag attcaatg g aattttaag tag g g caaccacttatg ag ttg g tttttg caatt g ag tttccctctg g g ttg cattg ag gg cttctctag caccctttactg ctg tg tatg g g g g cttcaccatccaag ag g tg g ta g g ttg g ag tag atg ctacag atg ctctcaag tcag g aatag aaactg atg ag ctg attg cttg attg
- the first homology region is homologous to a first region of the RAG1 intron 1 or the start of the RAG1 exon 2 (e.g. the first 200 bp of the RAG1 exon 2) and the second homology region is homologous to a second region of the RAG1 exon 2.
- the first homology region is homologous to a region of the RAG1 intron 1 and the second homology region is homologous to a region of the RAG1 exon 2.
- the first homology region is homologous to a region upstream of: (i) chr 1 1 : 36569295; (ii) chr 1 1 : 36573790; (iii) chr 11 : 36573641 ; (iv) chr 1 1 : 36573351 ; (v) chr 1 1 : 36569080; (vi) chr 11 : 36572472; (vii) chr 11 : 36571458; (viii) chr 11 : 36571366; (ix) chr 1 1 : 36572859 (x) chr 1 1 : 36571457; (xi) chr 11 : 36569351 ; or (xii) chr 1 1 : 36572375.
- the first homology region is homologous to a region upstream of: (i) chr 11 : 36569295; (ii) chr 11 : 36573351 ; (iii) chr 11 : 36571366
- the first homology region is homologous to a region upstream of chr 1 1 : 36569295.
- the first homology region is homologous to a region comprising chr 1 1 : 36569245-36569294; (ii) the first homology region is homologous to a region comprising chr 11 : 36573740-36573789; (iii) the first homology region is homologous to a region comprising chr 11 : 36573591 -36573640; (iv) the first homology region is homologous to a region comprising chr 11 : 36573301 -36573350; (v) the first homology region is homologous to a region comprising chr 1 1 : 36569030-36569079; (vi) the first homology region is homologous to a region comprising chr 1 1 : 36572422-36572471 ; (vii) the first homology region is homologous to a region comprising chr 1 1 : 36571408-36571457; (viii)
- the first homology region is homologous to a region comprising chr 1 1 : 36569245-36569294; (ii) the first homology region is homologous to a region comprising chr 11 : 36573301 -36573350; or (iii) the first homology region is homologous to a region comprising chr 1 1 : 36571316-36571365.
- the first homology region is homologous to a region comprising chr 1 1 : 36569245-36569294.
- Exemplary first homology regions for intron 1 strategies are shown below in Table 7.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 81 -92.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 81 ;
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 84; or
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 88.
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 81 .
- the first homology region comprises or consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 81 .
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 81 .
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to any of SEQ ID NOs: 81 -92.
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 81 ;
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 84; or
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 88.
- the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 81 . In some embodiments, the 3’ terminal sequence of the first homology region consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 81 .
- the 3’ terminal sequence of the first homology region consists of the nucleotide sequence of SEQ ID NO: 81 .
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 93, or a fragment thereof.
- the fragment is at least 50 bp in length, for example 50-250 bp or 100-200 bp in length.
- the first homology region comprises or consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 93, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 93.
- Illustrative first homology region for guide RNA 9 (SEQ ID NO: 93) tg ag cacacag ttattacttg g aaattg tg tacag actaag ttg aag atg ttag g ag g g aag attg tg g g ccaa g taac ggggtgtatgtgtgtgggtatagggtgggcagctgggatggaaatggggggctgctgctgctgcaccctggcctc ctg aactaatg atatcactcaccag aaactactg ttcctg cactg tccaag ccaccccaaactag tttg tcaaaatg aat aat ctg tg tg tg tg g ag g g ag g
- the second homology region may be homologous to a region distantly downstream of the DSB.
- Suitable second homology regions which are homologous to a region distantly downstream of the DSB are described above for the “exon 2 RAG1 gene replacement strategy” (see e.g. Table 6). Any suitable second homology region described above may be used in the “exon 2 RAG1 gene replacement strategy” may also be used in the “intron 1 RAG1 gene replacement strategy” and vice versa
- the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 94, or a fragment thereof.
- the fragment is at least 500 bp in length, for example 500-2000 bp or 900-1800 bp in length.
- the second homology region comprises or consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 94, or a fragment thereof.
- the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 94, or a fragment thereof.
- Illustrative second homology region for intron 1 - replacement strategy (SEQ ID NO: 94) aggcatagagg actctctg g aaag ccaag attcaatg g aattttaag tag g g caaccacttatg ag ttg g tttttg c aatt g ag tttccctctg g g ttg cattg ag gg cttctctag caccctttactg ctg tg tatg g g g g cttcaccatccaag ag g tg g ta g g ttg g ag tag atg ctctcaag tcag g aatag aaactg atg ag ctg attg cttg attg ctt
- the first homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 93, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 70% identity, at least 80% identity, at least 90% identity, at least 95% identity, at least 98% identity, or 100% identity to SEQ ID NO: 94, or a fragment thereof.
- the first homology region comprises or consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 93, or a fragment thereof and the second homology region comprises or consists of a nucleotide sequence that has at least 98% identity to SEQ ID NO: 94, or a fragment thereof.
- the first homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 93, or a fragment thereof and the second homology region comprises or consists of the nucleotide sequence of SEQ ID NO: 94, or a fragment thereof.
- the site of the double-strand break can be introduced specifically by any suitable technique, for example using a CRISPR/Cas9 system and the guide RNAs disclosed herein.
- the DSB is introduced into the RAG1 intron 1 or RAG1 exon 2.
- a DSB may be introduced at any of the sites recited in Tables 8 or 1 1 below.
- each homology region is homologous to a fragment of the RAG1 gene either side of the DSB.
- the first homology region may be homologous to a region upstream of the DSB and the second homology region may be homologous to a region downstream of the DSB.
- the first homology region may be homologous to a region immediately upstream of the DSB and the second homology region may be homologous to either (a) a region immediately downstream of the DSB; or (b) a region distantly downstream of the DSB.
- the nucleotide sequence insert (e.g. a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment) may be introduced at the DSB site by homology-directed repair (HDR).
- HDR homology-directed repair
- the nucleotide insert (e.g. a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment) may replace the region of the genome flanked by the homology regions and comprising the DSB.
- nucleotide sequence insert may consist of the region of the polynucleotide flanked by the first homology region and the second homology region.
- the nucleotide sequence insert may comprise a nucleotide sequence encoding a RAG1 polypeptide fragment.
- the nucleotide sequence insert may comprise a splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment.
- a DSB is introduced into the RAG1 exon 2 (e.g. in the exon 2 strategies discussed above).
- a DSB may be introduced at any of the sites recited in Table 8 below.
- the nucleotide sequence insert may be introduced into a genome at any of the sites recited in Table 8 above.
- the genome of the present invention may comprise the nucleotide sequence insert at any of the sites recited in Table 8 above.
- a nucleotide sequence insert comprising a nucleotide sequence encoding a RAG1 polypeptide fragment is introduced into a genome at any of the sites recited in Table 8 above.
- the nucleotide sequence insert is introduced between chr 11 : 36574109 and 36574110 or between chr 11 : 36573910 and 36573911.
- the nucleotide sequence insert is introduced between chr 11 : 36573892 and 36573893 or between chr 11 : 36573878 and 36573879.
- the nucleotide sequence insert may replace any of the regions recited in Table 9 below.
- the genome of the present invention may comprise the nucleotide sequence insert replacing any of the regions recited in Table 9. Table 9- Exemplary insertion sites in RAG 1 exon 2 (targeting strategy)
- the nucleotide sequence insert replaces chr 11 : 36574108 to 3657411 1 or chr 11 : 36573909 to 36573912. In some embodiments, the nucleotide sequence insert replaces chr 11 : 36573891 to 36573894 or chr 11 : 36573877 to 36573880.
- the genome of the present invention comprises a nucleotide sequence comprising a nucleotide sequence encoding a RAG1 polypeptide fragment, which replaces chr 11 : 36574108 to 365741 11 or chr 1 1 : 36573909 to 36573912.
- the genome of the present invention comprises a nucleotide sequence comprising a nucleotide sequence encoding a RAG1 polypeptide fragment, which replaces chr 11 : 36573891 to 36573894 or chr 11 : 36573877 to 36573880.
- the nucleotide sequence insert may replace any of the regions recited in Table 10 below.
- the genome of the present invention may comprise the nucleotide sequence insert replacing any of the regions recited in Table 10.
- “about chr 11 : 36576436” may refer to the end of the exon 2 CDS region or the start of the 3’IITR.
- “about chr 11 : 36576436” may refer to chr 11 : 36576436 ⁇ 1000, chr 11 : 36576436 ⁇ 500, chr 1 1 : 36576436 ⁇ 400, chr 11 : 36576436 ⁇ 300, chr 11 : 36576436 ⁇ 200, chr 1 1 : 36576436 ⁇ 100, chr 11 : 36576436 ⁇ 50, chr 11 : 36576436 ⁇ 40, chr 11 :
- the nucleotide sequence insert replaces chr 11 : 36574108 to about 36576436 or chr 11 : 36573909 to about 36576436. In some embodiments, the nucleotide sequence insert replaces chr 1 1 : 36573891 to about 36576436 or chr 11 : 36573877 to about 36576436.
- the genome of the present invention comprises a nucleotide sequence comprising a nucleotide sequence encoding a RAG1 polypeptide fragment, which replaces chr 11 : 36574108 to about 36576436 or chr 11 : 36573909 to about 36576436. In some embodiments, the genome of the present invention comprises a nucleotide sequence comprising a nucleotide sequence encoding a RAG1 polypeptide fragment, which replaces chr 11 : 36573891 to about 36576436 or chr 11 : 36573877 to about 36576436.
- a DSB is introduced into the RAG1 intron 1 or the start of the exon 2 (e.g. the first 200 bp of the RAG1 exon 2), for example in the intron 1 strategies discussed above.
- a DSB may be introduced at any of the sites recited in Table 11 below.
- the nucleotide sequence insert may be introduced into a genome at any of the sites recited in Table 11 above.
- the genome of the present invention may comprise the nucleotide sequence insert at any of the sites recited in Table 11 above.
- the nucleotide sequence insert is introduced: (i) between chr 11 : 36569296 and 36569297;
- the nucleotide sequence insert is introduced between chr 11 : 36569296 and 36569297.
- the genome of the present invention comprises a nucleotide sequence comprising a splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, which is introduced:
- the genome of the present invention comprises a nucleotide sequence comprising a splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, which is introduced between chr 11 : 36569296 and 36569297.
- the nucleotide sequence insert may replace any of the regions recited in Table 12 below.
- the genome of the present invention may comprise the nucleotide sequence insert replacing any of the regions recited in Table 10.
- chr 11 : 36576436 may refer to the C-terminal region of the exon 2 CDS region or the start of the 3’IITR.
- the nucleotide sequence insert replaces: (i) chr 11 : 36569295 to about 36576436;
- chr 11 36571366 to about 36576436.
- the nucleotide sequence insert replaces chr 11 : 36569295 to about 36576436.
- the genome of the present invention comprises a nucleotide sequence comprising splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, which replaces:
- the genome of the present invention comprises a nucleotide sequence comprising splice acceptor sequence and a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, which replaces chr 1 1 : 36569295 to about 36576436.
- RNA splicing is a form of RNA processing in which a newly made precursor messenger RNA (pre-mRNA) transcript is transformed into a mature messenger RNA (mRNA). During splicing, introns (non-coding regions) are removed and exons (coding regions) are joined together.
- pre-mRNA precursor messenger RNA
- mRNA mature messenger RNA
- a donor site (5' end of the intron), a branch site (near the 3' end of the intron) and an acceptor site (3' end of the intron) are required for splicing.
- the splice donor site includes an almost invariant sequence GU at the 5' end of the intron, within a larger, less highly conserved region.
- the splice acceptor site at the 3' end of the intron terminates the intron with an almost invariant AG sequence.
- Upstream (5'-ward) from the AG there is a region high in pyrimidines (C and U), or polypyrimidine tract. Further upstream from the polypyrimidine tract is the branchpoint.
- a “splice acceptor sequence” is a nucleotide sequence which can function as an acceptor site at the 3’ end of the intron. Consensus sequences and frequencies of human splice site reg ions are described in Ma, S.L., et al., 2015. PLoS One, 10(6), p.e0130729.
- a splice acceptor sequence may comprise the nucleotide sequence (Y) n NYAG, where n is 10-20, or a variant with at least 90% or at least 95% sequence identity.
- a splice acceptor sequence may comprise the sequence (Y) n NCAG, where n is 10-20, or a variant with at least 90% or at least 95% sequence identity.
- a splice acceptor sequence comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 95 or a fragment thereof.
- a splice acceptor sequence comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 95 or a fragment thereof.
- a splice acceptor sequence comprises or consists of the nucleotide sequence SEQ ID NO: 95 or a fragment thereof.
- Exemplary splice acceptor sequence (SEQ ID NO: 95) ctg acctcttctcttcctcccacag
- the polynucleotide of the invention does not comprise a splice acceptor sequence (e.g. in exon 2 strategies).
- the polynucleotide of the invention may comprise a splice donor sequence.
- the genome may comprise a splice donor sequence in the RAG1 intron 1 .
- the splice donor sequence nucleotide sequence is 3’ of the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment.
- the splice donor sequence may be used to provide an mRNA comprising a RAG1 polypeptide.
- a “splice donor sequence” is a nucleotide sequence which can function as a donor site at the 5’ end of the intron. Consensus sequences and frequencies of human splice site regions are describe in Ma, S.L., et al., 2015. PLoS One, 10(6), p.e0130729.
- the splice donor sequence comprises or consists of a nucleotide sequence which is at least 85% identical to SEQ ID NO: 96 or a fragment thereof. In some embodiments of the invention, the splice donor sequence comprises or consists of the nucleotide sequence SEQ ID NO: 96 or a fragment thereof.
- Exemplary splice donor sequence (SEQ ID NO: 96) aggtaagt
- the polynucleotide of the invention does not comprise a splice donor sequence.
- the polynucleotide of the invention may comprise one or more regulatory elements which may act pre- or post-transcriptionally.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to one or more regulatory elements which may act pre- or post-transcriptionally.
- the one or more regulatory elements may facilitate expression of a RAG1 polypeptide in the cells of the invention.
- a “regulatory element” is any nucleotide sequence which facilitates expression of a polypeptide, e.g. acts to increase expression of a transcript or to enhance mRNA stability. Suitable regulatory elements include for example promoters, enhancer elements, post- transcriptional regulatory elements and polyadenylation sites.
- the polynucleotide of the invention does not comprise a regulatory element. Endogenous regulatory elements may be sufficient to drive expression of the RAG1 polypeptide following the introduction of the nucleotide sequence insert.
- the polynucleotide of the invention does not comprise a polyadenylation sequence.
- the polynucleotide of the invention may comprise a polyadenylation sequence.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to a polyadenylation sequence.
- the polyadenylation sequence may improve gene expression.
- Suitable polyadenylation sequences will be well known to those of skill in the art. Suitable polyadenylation sequences include a bovine growth hormone (BGH) polyadenylation sequence or an early SV40 polyadenylation signal. In some embodiments of the invention, the polyadenylation sequence is a BGH polyadenylation sequence.
- BGH bovine growth hormone
- the polyadenylation sequence comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 97, 98 or 99 or a fragment thereof.
- the polyadenylation sequence comprises or consists of a nucleotide sequence which is at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to SEQ ID NO: 97, 98 or 99 or a fragment thereof.
- the polyadenylation sequence comprises or consists of the nucleotide sequence SEQ ID NO: 97, 98 or 99 or a fragment thereof.
- Exemplary BGH polyadenylation sequence (SEQ ID NO: 97) Gctg tg ccttctag ttg ccag ccatctg ttg tttg cccctccccg tg ccttccttg accctg g aag g tg ccactcccactg t cctttcctaataaatg ag g aaattg catcg cattg tctg ag tag g tg tcattctattctg gggggtggggtggggcagga cagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggtgggctctatggggggggtggatggggggagga cagcaagggggaggattgggaagacaatagcaggcatgct
- Exemplary BGH polyadenylation sequence (SEQ ID NO: 98)
- Exemplary BGH polyadenylation sequence (SEQ ID NO: 99) ctg tg ccttctag ttg ccag ccatctg ttg tttg cccctcccg tg ccttccttg accctg g aag g tg ccactcccactg tc ctttcctaataaatg ag g aaattg catcg cattg tctg ag tag g tg tcattctattctg gggggtggggtggggggcaggac agcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggtgggctctatgggggggtgggctatggggggtggtggatggggggctatgg
- the polynucleotide of the invention does not comprise a Kozak sequence.
- the polynucleotide of the invention may comprise a Kozak sequence.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to a Kozak sequence.
- a Kozak sequence may be inserted before the start codon of the RAG1 polypeptide or RAG1 polypeptide fragment to improve the initiation of translation.
- the Kozak sequence comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 100 or a fragment thereof.
- the Kozak sequence comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 100 or a fragment thereof.
- the Kozak sequence comprises or consists of the nucleotide sequence SEQ ID NO: 100 or a fragment thereof.
- the polynucleotide of the invention does not comprise a post- transcriptional regulatory element.
- the polynucleotide of the invention may comprise a post- transcriptional regulatory element.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to a post-transcriptional regulatory element.
- the post-transcriptional regulatory element may improve gene expression.
- Suitable post-transcriptional regulatory elements will be well known to those of skill in the art.
- the polynucleotide of the invention may comprise a Woodchuck Hepatitis Virus Post- transcriptional Regulatory Element (WPRE).
- WPRE Woodchuck Hepatitis Virus Post- transcriptional Regulatory Element
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to a WPRE.
- the WPRE comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 101 or a fragment thereof.
- the WPRE comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 101 or a fragment thereof.
- the WPRE comprises or consists of the nucleotide sequence SEQ ID NO: 101 or a fragment thereof.
- Exemplary WPRE (SEQ ID NO: 101 ) aatcaacctctg g attacaaaatttg tg aaag attg actg g tattcttaactatg ttg ctccttttacg ctatg tg g atacg ct g ctttaatg cctttg tatcatg ctattgctttccccg tatg g ctttcattttctctcctcttg tataaatcctg g ttgctg tctcttatg ag g ag ttg tg g cccg ttg tcag g caacg tg g eg tg g tg tg tg cactg tg tttg etg
- the RAG1 polypeptide or the RAG1 polypeptide fragment is not operably linked to a post-transcriptional regulatory element. In some embodiments of the invention, the RAG1 polypeptide or the RAG1 polypeptide fragment is not operably linked to a WPRE.
- the polynucleotide of the invention does not comprise an endogenous RAG1 3’ UTR.
- the polynucleotide of the invention may comprise an endogenous RAG1 3’UTR.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to an endogenous RAG1 3’UTR.
- the RAG1 3’UTR comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 102 or a fragment thereof.
- the RAG1 3’UTR comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 102 or a fragment thereof.
- the RAG1 3’UTR comprises or consists of the nucleotide sequence SEQ ID NO: 102 or a fragment thereof.
- RAG 1 3’UTR (SEQ ID NO: 102) g tag g g caaccacttatg ag ttg g tttttg caattg ag tttccctctg g g ttg cattg ag g g cttctcctag caccctttactg ctg tg tatg g g g cttcaccatccaag ag g tg g tag g ttg g ag taag atg ctacag atg ctctcaag tcag g aatag aaactg atg ag ctg attg cttg ag g cttttag tg aaaag ctg attg ctttg tcag g aatag aaa actg atg
- the polynucleotide of the invention may comprise a further coding sequence.
- the polynucleotide of the invention may comprise an internal ribosome entry site sequence (IRES).
- IRES may increase or allow expression of the further coding sequence.
- the IRES may be operably linked to the further coding sequence.
- the IRES comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 103 or a fragment thereof.
- the IRES comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 103 or a fragment thereof.
- the IRES comprises or consists of the nucleotide sequence SEQ ID NO: 103 or a fragment thereof.
- IRES (SEQ ID NO: 103) g aattaactcg ag g aatteeg Cccctctccccccccccctaacg ttactg g ccg aag ccg ettg g aataag g ccg g tg tg eg tttg tetatatg ttatttttccaccatattg ccg tcttttg g caatg tg ag g gcccg g aaacctg g ccctg tettettg acg ag cattctag g g g tctttcccctctcg ccaaag g aatgcaag g tctg tg aatg teg tg aag
- the further coding sequence may encode a selector, for example a NGFR receptor, e.g. a low affinity NGFR, such as a C-terminal truncated low affinity NGFR.
- the selector may be used for enrichment of cells.
- the NGFR-encoding sequence comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 104 or a fragment thereof.
- the NGFR-encoding sequence comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 104 or a fragment thereof.
- the NGFR-encoding sequence comprises or consists of the nucleotide sequence SEQ ID NO: 104 or a fragment thereof.
- Exemplary NGFR-encoding sequence (SEQ ID NO: 104) atg g g ag etg g tg etaeeg g cag ag ctatg g atg g acctag aetgetg ctcctg etgetg ctcg g ag tttctcttg g eg g g ag ccaag ag g cctg tcctaccg g cctg tatacacactctg g eg ag tg etg caag g cctg caatcttg g ag aag g eg tggcacagccttgcggcgctaatcagacagtgtgcgagccttgctggacagcgtggtggtgtctggacagcgt
- the further coding sequence may encode a destabilisation domain, for example a peptide sequence rich in proline (P), glutamic acid (E), serine (S), and threonine (T) (PEST).
- Endogenous RAG1 protein may be destabilized by the destabilisation domain, e.g. PEST signal peptide via proteasome degradation.
- the PEST -encoding sequence comprises or consists of a nucleotide sequence which is at least 70% identical to SEQ ID NO: 105 or a fragment thereof.
- the PEST-encoding sequence comprises or consists of a nucleotide sequence which is at least 80%, or at least 90% identical to SEQ ID NO: 105 or a fragment thereof.
- the PEST-encoding sequence comprises or consists of the nucleotide sequence SEQ ID NO: 105 or a fragment thereof.
- Exemplary PEST-encoding sequence (SEQ ID NO: 105) atg ag g accg ag g cccccg ag g gcaccg ag ag eg ag atg g ag acccccag eg ccatcaacg g caaccccag c tggcac
- the polynucleotide of the invention does not comprise a promoter or an enhancer element.
- T ranscription of a nucleotide sequence encoding a RAG1 polypeptide may be driven by an endogenous promoter.
- transcription of a nucleotide sequence encoding a RAG1 polypeptide may be driven by the endogenous RAG1 promoter.
- the nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment is operably linked to a promoter and/or enhancer element.
- a “promoter” is a region of DNA that leads to initiation of transcription of a gene. Promoters are located near the transcription start sites of genes, upstream on the DNA (towards the 5' region of the sense strand). Any suitable promoter may be used, the selection of which may be readily made by the skilled person.
- Enhancers are cis-acting. They can be located up to 1 Mbp (1 ,000,000 bp) away from the gene, upstream or downstream from the start site. Any suitable enhancer may be used, the selection of which may be readily made by the skilled person.
- the polynucleotide of the invention comprises, essentially consists of, or consists of from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, and a second homology region.
- the polynucleotide of the invention comprises, essentially consists of, or consists of from 5’ to 3’: a first homology region, a nucleotide sequence a RAG1 polypeptide fragment, and a second homology region.
- the polynucleotide of the invention comprises, essentially consists of, or consists of from 5’ to 3’: a first homology region, a splice acceptor sequence, a nucleotide sequence encoding a RAG1 polypeptide or a RAG1 polypeptide fragment, and a second homology region.
- the polynucleotide of the invention comprises, essentially consists of, or consists of from 5’ to 3’: a first homology region, a splice acceptor sequence, a nucleotide sequence encoding a RAG1 polypeptide, and a second homology region.
- the polynucleotide of the invention comprises or consists of a nucleotide sequence that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identity to any of SEQ ID NOs: 106-116 or 160-163.
- the polynucleotide of the invention comprises or consists of the nucleotide sequence any of SEQ ID NOs: 106-116 or 160-163.
- the genome of the invention comprises a nucleotide sequence that has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identity to any of SEQ ID NOs: 106-116 or 160-163.
- the genome of the invention comprises the nucleotide sequence of any of SEQ ID NOs: 106-1 16 or 160-163.
- Exemplary polynucleotide specific for “g5 M3 ex2 RAG1" gRNA for the exon 2 RAG1 gene targeting strategy (SEQ ID NO: 106) g atccatcaag ccaaccttcg acatctctg ccg catctg tg g g aattcttttag ag ctg atg ag cacaacag g ag atatc cag tccatg g tcctg tg g atg g taaaccctag g ccttttacg aaag aag g aaag ag ag ctacttcctg g ccg g ac ctcattg ccaag g ttttccg atcg atg tg aag g cag atg ttg actcg atccaccccac
- Exemplary polynucleotide specific for “g5 M3 ex2 RAG1" gRNA for the exon 2 RAG1 gene replacement strategy with long right HA (SEQ ID NO: 107) aaaaccctag g ccttttacg aaag aag g aaaag ag ag ctacttcctg g ccg g acctcattg ccaag g g ttttccg g ate g atg tg aag g cag atg ttg actcg atccaccccactg ag ttctg ccataactg etg g agcatcatg cacag g aag ttta g cag tg ccccatg tg ag g tttacttccccgag g aacg tg tg
- Exemplary polynucleotide specific for “g5 M3 ex2 RAG1" gRNA for the exon 2 RAG1 gene replacement strategy with short right HA (SEQ ID NO: 108) aaaaccctag g ccttttacg aaag aag g aaaag ag ag ctacttcctg g ccg g acctcattg ccaag gttttccg g ate g atg tg aag g cag atg ttg actcg atccaccccactg ag ttctg ccataactg ctg g ag catcatgcacag g aag ttta g cag tg ccccatg tg ag g tttacttccccgag g aacg tg tg tg
- Exemplary polynucleotide specific for “g6 M2 ex2 RAG1" gRNA for the exon 2 RAG1 gene targeting strategy (SEQ ID NO: 109) tg ag atcctttg aaaag acacctg aag aag ctcaaag g aaaag aag g attcctttg ag g g g aaaccctctctg g ag g caatctccagcag tcctg g acaag g ctg atg g tcag aag ccag tcccaactcag ccattg ttaaaag cccacccta ag ttttcaaag aaatttcacg acaacg ag aaag caaaag eg atcca
- Exemplary polynucleotide specific for “g6 M2 ex2 RAG1" gRNA for the exon 2 RAG1 gene replacement strategy with short right HA (SEQ ID NO: 11 1 ) g ag cacaacag g ag atatccag tccatg g teetg tg g atg g taaaccctag g ccttt tacg aaag aag g aaag a g ag ctacttcctg g ccg g acctcattg ccaag g ttttccg g ateg atg tg aag g cag atg ttg actcg atccaccccact g ag ttctg ccataactg ctg g ag catcatgcacag g aag tttag cag tg cccca
- Exemplary polynucleotide specific for “g11 exon2 M2/3" gRNA for the exon 2 RAG 1 gene replacement strategy with long right HA (SEQ ID NO: 114) ctg atg ag cacaacag g ag atatccag tccatg g teetg tg g atg g taaaccctag g cctttttacg aaag ag g aaag ag ag ag ctacttcctg g ccg g acctcattg ccaag g ttttccg g ateg atg tg aag g cag atg ttg actcg atccacc ccactg ag ttctg ccataactg ctg g agcatcatg cacag g aag tttag cag tg
- Exemplary polynucleotide specific for g9 gRNA for the intron 1 RAG1 gene replacement strategy with long right HA (SEQ ID NO: 1 16) tg ag cacacag ttattacttg g aaattg tg tacag actaag ttg aag atg ttag g ag g g aag attg tg g g ccaag tac ggggtgtatgtgtgggtatagggtgggcagctgggatggaaatggggggctgctgctgctgcaccctggcctc ctg aactaatg atatcactcaccag aaactactg ttcctg cactg tccaag ccaccccaaactag tttg tcaaaatg aat aat ctg tg ctg
- Exemplary polynucleotide specific for “g11 exon2 M2/M3” gRNA for the exon 2 RAG 1 gene targeting strategy (SEQ ID NO: 160) ttcag cacccacatattaaattttcag aatg g aaatttaag ctg tteeg g g tg ag atcctttg aaaag acacctg aag aaag ag g attcctttg ag g g g aaaccctctctg g ag g g g aaaccctctctg g ag caatctccagcag teetg g acaag g ctg atg g tcag aag ccag tcccaactcagccattg taaaag ccaccctaag
- Exemplary polynucleotide specific for “g11 exon2 M2/M3” gRNA for the exon 2 RAG 1 gene replacement strategy (SEQ ID NO: 161 ) ttcag cacccacatattaaattttcag aatg g aaatttaag etg tteeg g g tg ag atcctttg aaaag acacctg aag aaag ag g attcctttg ag g g g aaaccctctctg g ag g g g aaaccctctctg g ag caatctccagcag teetg g acaag g etg atg g tcag aag ccag tcccaactcagccattg taaaag ccaccctaa
- Exemplary polynucleotide specific for “g13 exon2 M2/M3" gRNA for the exon 2 RAG 1 gene targeting strategy (SEQ ID NO: 162) ttcag cacccacatattaaattttcag aatg g aaatttaag etg tteeg g g tg ag atcctttg aaaag acacctg aag aaag ag g attcctttg ag g g g aaaccctctctg g ag g g g aaaccctctctg g ag caatctccagcag teetg g acaag g etg atg g tcag aag ccag tcccaactcagccattg taaaag ccaccctaag
- the invention also encompasses variants, derivatives, and fragments thereof.
- a “variant” of any given sequence is a sequence in which the specific sequence of residues (whether amino acid or nucleic acid residues) has been modified in such a manner that the polypeptide or polynucleotide in question retains at least one of its endogenous functions.
- a variant of RAG1 may retain the ability to form a RAG complex, mediate DNA-binding to the RSS, and introduce a double-strand break between the RSS and the adjacent coding segment.
- a variant sequence can be obtained by addition, deletion, substitution, modification, replacement and/or variation of at least one residue present in the naturally occurring polypeptide or polynucleotide.
- derivative as used herein in relation to proteins or polypeptides of the invention includes any substitution of, variation of, modification of, replacement of, deletion of and/or addition of one (or more) amino acid residues from or to the sequence, providing that the resultant protein or polypeptide retains at least one of its endogenous functions.
- a derivative of RAG1 may retain the ability to form a RAG complex, mediate DNA-binding to the RSS, and introduce a double-strand break between the RSS and the adjacent coding segment.
- amino acid substitutions may be made, for example from 1 , 2 or 3, to 10 or 20 substitutions, provided that the modified sequence retains the required activity or ability.
- Amino acid substitutions may include the use of non-naturally occurring analogues.
- Proteins used in the invention may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein.
- Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues as long as the endogenous function is retained.
- negatively charged amino acids include aspartic acid and glutamic acid
- positively charged amino acids include lysine and arginine
- amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine.
- a variant may have a certain identity with the wild type amino acid sequence or the wild type nucleotide sequence.
- a variant sequence is taken to include an amino acid sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, suitably at least 95%, 96% or 97% or 98% or 99% identical to the subject sequence.
- a variant can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express in terms of sequence identity.
- a variant sequence is taken to include a nucleotide sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, suitably at least 95%, 96% or 97% or 98% or 99% identical to the subject sequence.
- a variant can also be considered in terms of similarity, in the context of the present invention it is preferred to express it in terms of sequence identity.
- reference to a sequence which has a percent identity to any one of the SEQ ID NOs detailed herein refers to a sequence which has the stated percent identity over the entire length of the SEQ ID NO referred to.
- Sequence identity comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percent identity between two or more sequences.
- Percent identity may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an “ungapped” alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix (the default matrix for the BLAST suite of programs).
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- the software typically does this as part of the sequence comparison and generates a numerical result.
- the percent sequence identity may be calculated as the number of identical residues as a percentage of the total residues in the SEQ ID NO referred to.
- “Fragments” are also variants and the term typically refers to a selected region of the polypeptide or polynucleotide that is of interest. “Fragment” thus refers to an amino acid or nucleic acid sequence that is a portion of a full-length polypeptide or polynucleotide. Such variants, derivatives, and fragments may be prepared using standard recombinant DNA techniques such as site-directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5’ and 3’ flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made.
- flanking regions will contain convenient restriction sites corresponding to sites in the naturally- occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut.
- the DNA is then expressed in accordance with the invention to make the encoded protein.
- the present invention provides a vector comprising the polynucleotide of the invention.
- the vector may be suitable for editing a genome using the polynucleotide of the invention.
- the vector may be used to deliver the polynucleotide into the cell.
- the nucleotide sequence insert can be introduced into a genome at a site of a double strand break (DSB) by homology-directed repair (HDR).
- DLB double strand break
- HDR homology-directed repair
- the vector of the present invention may be capable of transducing mammalian cells, for example human cells.
- the vector of the present invention is capable of transducing HSCs, HPCs, and/or LPCs.
- the vector of the present invention is capable of transducing CD34+ cells.
- the vector of the present invention is capable of transducing NALM6, K562, and/or other human cell lines (e.g. Molt4, U937, etc.).
- the vector of the present invention is capable of transducing T cells.
- the vector of the present invention is a viral vector.
- the vector of the invention may be an adeno-associated viral (AAV) vector, although it is contemplated that other viral vectors may be used e.g. lentiviral vectors (e.g. IDLV vectors), or single or double stranded DNA.
- AAV adeno-associated viral
- the vector of the present invention may be in the form of a viral vector particle.
- the viral vector of the present invention is in the form of an AAV vector particle.
- the viral vector of the present invention is in the form of a lentiviral vector particle, for example an IDLV vector particle.
- AAV Adeno-associated viral
- the vector of the present invention may be an adeno-associated viral (AAV) vector.
- the vector is an AAV6 vector.
- the vector of the present invention may be in the form of an AAV vector particle.
- the vector is in the form of an AAV6 vector particle.
- the AAV vector or AAV vector particle may comprise an AAV genome or a fragment or derivative thereof.
- An AAV genome is a polynucleotide sequence, which may encode functions needed for production of an AAV particle. These functions include those operating in the replication and packaging cycle of AAV in a host cell, including encapsidation of the AAV genome into an AAV particle.
- Naturally occurring AAVs are replication -deficient and rely on the provision of helper functions in trans for completion of a replication and packaging cycle. Accordingly, the AAV genome of the AAV vector of the invention is typically replication - deficient.
- the AAV genome may be in single-stranded form, either positive or negative-sense, or alternatively in double-stranded form.
- the use of a double-stranded form allows bypass of the DNA replication step in the target cell and so can accelerate transgene expression.
- AAVs occurring in nature may be classified according to various biological systems.
- the AAV genome may be from any naturally derived serotype, isolate or clade of AAV.
- AAV may be referred to in terms of their serotype.
- a serotype corresponds to a variant subspecies of AAV which, owing to its profile of expression of capsid surface antigens, has a distinctive reactivity which can be used to distinguish it from other variant subspecies.
- an AAV vector particle having a particular AAV serotype does not efficiently crossreact with neutralising antibodies specific for any other AAV serotype.
- AAV serotypes include AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10 and AAV1 1 .
- the AAV vector of the invention may be an AAV6 serotype.
- AAV may also be referred to in terms of clades or clones. This refers to the phylogenetic relationship of naturally derived AAVs, and typically to a phylogenetic group of AAVs which can be traced back to a common ancestor, and includes all descendants thereof. Additionally, AAVs may be referred to in terms of a specific isolate, i.e. a genetic isolate of a specific AAV found in nature. The term genetic isolate describes a population of AAVs which has undergone limited genetic mixing with other naturally occurring AAVs, thereby defining a recognisably distinct population at a genetic level.
- the AAV genome of a naturally derived serotype, isolate or clade of AAV comprises at least one inverted terminal repeat sequence (ITR).
- ITR sequence acts in cis to provide a functional origin of replication and allows for integration and excision of the vector from the genome of a cell.
- ITRs may be the only sequences required in cis next to the therapeutic gene.
- one or more ITR sequences flank the polynucleotide of the invention.
- the AAV genome may also comprise packaging genes, such as rep and/or cap genes which encode packaging functions for an AAV particle.
- a promoter may be operably linked to each of the packaging genes. Specific examples of such promoters include the p5, p19 and p40 promoters. For example, the p5 and p19 promoters are generally used to express the rep gene, while the p40 promoter is generally used to express the cap gene.
- the rep gene encodes one or more of the proteins Rep78, Rep68, Rep52 and Rep40 or variants thereof.
- the cap gene encodes one or more capsid proteins such as VP1 , VP2 and VP3 or variants thereof.
- the AAV genome may be the full genome of a naturally occurring AAV.
- a vector comprising a full AAV genome may be used to prepare an AAV vector or vector particle.
- the AAV genome is derivatised for the purpose of administration to patients. Such derivatisation is standard in the art and the invention encompasses the use of any known derivative of an AAV genome, and derivatives which could be generated by applying techniques known in the art.
- the AAV genome may be a derivative of any naturally occurring AAV.
- the AAV genome is a derivative of AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11 .
- the AAV genome is a derivative of AAV6.
- Derivatives of an AAV genome include any truncated or modified forms of an AAV genome which allow for expression of a transgene from an AAV vector of the invention in vivo.
- a derivative will include at least one inverted terminal repeat sequence (ITR), optionally more than one ITR, such as two ITRs or more.
- ITRs may be derived from AAV genomes having different serotypes, or may be a chimeric or mutant ITR.
- a suitable mutant ITR is one having a deletion of a trs (terminal resolution site). This deletion allows for continued replication of the genome to generate a single-stranded genome which contains both coding and complementary sequences, i.e. a self-complementary AAV genome. This allows for bypass of DNA replication in the target cell, and so enables accelerated transgene expression.
- the AAV genome may comprise one or more ITR sequences from any naturally derived serotype, isolate or clade of AAV or a variant thereof.
- the AAV genome may comprise at least one, such as two, AAV1 , AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV1 1 ITRs, or variants thereof.
- the one or more ITRs may flank the nucleotide sequence of the invention at either end.
- the inclusion of one or more ITRs is can aid concatamer formation of the AAV vector in the nucleus of a host cell, for example following the conversion of single-stranded vector DNA into doublestranded DNA by the action of host cell DNA polymerases.
- the formation of such episomal concatamers protects the AAV vector during the life of the host cell, thereby allowing for prolonged expression of the transgene in vivo.
- ITR elements will be the only sequences retained from the native AAV genome in the derivative.
- a derivative may not include the rep and/or cap genes of the native genome and any other sequences of the native genome. This may reduce the possibility of integration of the vector into the host cell genome. Additionally, reducing the size of the AAV genome allows for increased flexibility in incorporating other sequence elements (such as regulatory elements) within the vector in addition to the transgene.
- derivatives may additionally include one or more rep and/or cap genes or other viral sequences of an AAV genome.
- Naturally occurring AAV integrates with a high frequency at a specific site on human chromosome 19, and shows a negligible frequency of random integration, such that retention of an integrative capacity in the AAV vector may be tolerated in a therapeutic setting.
- the invention additionally encompasses the provision of sequences of an AAV genome in a different order and configuration to that of a native AAV genome.
- the invention also encompasses the replacement of one or more AAV sequences or genes with sequences from another virus or with chimeric genes composed of sequences from more than one virus.
- Such chimeric genes may be composed of sequences from two or more related viral proteins of different viral species.
- the AAV vector particle may be encapsidated by capsid proteins.
- the AAV vector particles may be transcapsidated forms wherein an AAV genome or derivative having an ITR of one serotype is packaged in the capsid of a different serotype.
- the AAV vector particle also includes mosaic forms wherein a mixture of unmodified capsid proteins from two or more different serotypes makes up the viral capsid.
- the AAV vector particle also includes chemically modified forms bearing ligands adsorbed to the capsid surface. For example, such ligands may include antibodies for targeting a particular cell surface receptor.
- a derivative comprises capsid proteins i.e. VP1 , VP2 and/or VP3
- the derivative may be a chimeric, shuffled or capsid-modified derivative of one or more naturally occurring AAVs.
- the invention encompasses the provision of capsid protein sequences from different serotypes, clades, clones, or isolates of AAV within the same vector (i.e. a pseudotyped vector).
- the AAV vector may be in the form of a pseudotyped AAV vector particle.
- Chimeric, shuffled or capsid-modified derivatives will be typically selected to provide one or more desired functionalities for the AAV vector.
- these derivatives may display increased efficiency of gene delivery and/or decreased immunogenicity (humoral or cellular) compared to an AAV vector comprising a naturally occurring AAV genome.
- Increased efficiency of gene delivery may be effected by improved receptor or co -receptor binding at the cell surface, improved internalisation, improved trafficking within the cell and into the nucleus, improved uncoating of the viral particle and improved conversion of a single-stranded genome to double-stranded form.
- Chimeric capsid proteins include those generated by recombination between two or more capsid coding sequences of naturally occurring AAV serotypes. This may be performed for example by a marker rescue approach in which non-infectious capsid sequences of one serotype are co-transfected with capsid sequences of a different serotype, and directed selection is used to select for capsid sequences having desired properties.
- the capsid sequences of the different serotypes can be altered by homologous recombination within the cell to produce novel chimeric capsid proteins.
- Chimeric capsid proteins also include those generated by engineering of capsid protein sequences to transfer specific capsid protein domains, surface loops or specific amino acid residues between two or more capsid proteins, for example between two or more capsid proteins of different serotypes.
- Hybrid AAV capsid genes can be created by randomly fragmenting the sequences of related AAV genes e.g. those encoding capsid proteins of multiple different serotypes and then subsequently reassembling the fragments in a self-priming polymerase reaction, which may also cause crossovers in regions of sequence homology.
- a library of hybrid AAV genes created in this way by shuffling the capsid genes of several serotypes can be screened to identify viral clones having a desired functionality.
- error prone PCR may be used to randomly mutate AAV capsid genes to create a diverse library of variants which may then be selected for a desired property.
- capsid genes may also be genetically modified to introduce specific deletions, substitutions or insertions with respect to the native wild-type sequence.
- capsid genes may be modified by the insertion of a sequence of an unrelated protein or peptide within an open reading frame of a capsid coding sequence, or at the N- and/or C-terminus of a capsid coding sequence.
- the unrelated protein or peptide may advantageously be one which acts as a ligand for a particular cell type, thereby conferring improved binding to a target cell or improving the specificity of targeting of the vector to a particular cell population.
- the unrelated protein may also be one which assists purification of the viral particle as part of the production process, i.e. an epitope or affinity tag.
- the site of insertion will typically be selected so as not to interfere with other functions of the viral particle e.g. internalisation, trafficking of the viral particle.
- the capsid protein may be an artificial or mutant capsid protein.
- artificial capsid as used herein means that the capsid particle comprises an amino acid sequence which does not occur in nature or which comprises an amino acid sequence which has been engineered (e.g. modified) from a naturally occurring capsid amino acid sequence.
- the artificial capsid protein comprises a mutation or a variation in the amino acid sequence compared to the sequence of the parent capsid from which it is derived where the artificial capsid amino acid sequence and the parent capsid amino acid sequences are aligned.
- the AAV vector particle may comprise an AAV6 capsid protein.
- the vector of the present invention may be a retroviral vector or a lentiviral vector.
- the vector of the present invention may be a retroviral vector particle or a lentiviral vector particle.
- a retroviral vector may be derived from or may be derivable from any suitable retrovirus.
- retroviruses include murine leukaemia virus (MLV), human T-cell leukaemia virus (HTLV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukaemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukaemia virus (A-MLV), avian myelocytomatosis virus-29 (MC29) and avian erythroblastosis virus (AEV).
- MMV murine leukaemia virus
- HTLV human T-cell leukaemia virus
- MMTV mouse mammary tumour virus
- RSV Rous sarcoma virus
- Fujinami sarcoma virus FuSV
- Retroviruses may be broadly divided into two categories, “simple” and “complex”. Retroviruses may be even further divided into seven groups. Five of these groups represent retroviruses with oncogenic potential. The remaining two groups are the lentiviruses and the spumaviruses.
- retrovirus and lentivirus genomes share many common features such as a 5’ LTR and a 3’ LTR. Between or within these are located a packaging signal to enable the genome to be packaged, a primer binding site, integration sites to enable integration into a host cell genome, and gag, pol and env genes encoding the packaging components - these are polypeptides required for the assembly of viral particles.
- Lentiviruses have additional features, such as rev and RRE sequences in HIV, which enable the efficient export of RNA transcripts of the integrated provirus from the nucleus to the cytoplasm of an infected target cell.
- LTRs long terminal repeats
- the LTRs themselves are identical sequences that can be divided into three elements: U3, R and U5.
- U3 is derived from the sequence unique to the 3’ end of the RNA.
- R is derived from a sequence repeated at both ends of the RNA.
- U5 is derived from the sequence unique to the 5’ end of the RNA.
- the sizes of the three elements can vary considerably among different retroviruses.
- gag, pol and env may be absent or not functional.
- a retroviral vector In a typical retroviral vector, at least part of one or more protein coding regions essential for replication may be removed from the virus. This makes the viral vector replication -defective. Portions of the viral genome may also be replaced by a library encoding candidate modulating moieties operably linked to a regulatory control region and a reporter moiety in the vector genome in order to generate a vector comprising candidate modulating moieties which is capable of transducing a target host cell and/or integrating its genome into a host genome.
- Lentivirus vectors are part of the larger group of retroviral vectors.
- lentiviruses can be divided into primate and non-primate groups.
- primate lentiviruses include but are not limited to human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS); and simian immunodeficiency virus (SIV).
- non-primate lentiviruses examples include the prototype “slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis-encephalitis virus (CAEV), equine infectious anaemia virus (EIAV), and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
- VMV visna/maedi virus
- CAEV caprine arthritis-encephalitis virus
- EIAV equine infectious anaemia virus
- FIV feline immunodeficiency virus
- BIV bovine immunodeficiency virus
- the lentivirus family differs from retroviruses in that lentiviruses have the capability to infect both dividing and non-dividing cells.
- other retroviruses such as MLV, are unable to infect non-dividing or slowly dividing cells such as those that make up, for example, muscle, brain, lung and liver tissue.
- a lentiviral vector is a vector which comprises at least one component part derivable from a lentivirus.
- that component part is involved in the biological mechanisms by which the vector infects cells, expresses genes or is replicated.
- the lentiviral vector may be a “primate” vector.
- the lentiviral vector may be a “non -primate” vector (i.e. derived from a virus which does not primarily infect primates, especially humans).
- non-primate lentiviruses may be any member of the family of lentiviridae which does not naturally infect a primate.
- HIV-1 - and HIV-2-based vectors are described below.
- the HIV-1 vector contains cis-acting elements that are also found in simple retroviruses. It has been shown that sequences that extend into the gag open reading frame are important for packaging of HIV-1 . Therefore, HIV-1 vectors often contain the relevant portion of gag in which the translational initiation codon has been mutated. In addition, most HIV-1 vectors also contain a portion of the env gene that includes the RRE. Rev binds to RRE, which permits the transport of full-length or singly spliced mRNAs from the nucleus to the cytoplasm. In the absence of Rev and/or RRE, full-length HIV-1 RNAs accumulate in the nucleus. Alternatively, a constitutive transport element from certain simple retroviruses such as Mason -Pfizer monkey virus can be used to relieve the requirement for Rev and RRE. Efficient transcription from the HIV-1 LTR promoter requires the viral protein Tat.
- HIV-2-based vectors are structurally very similar to HIV-1 vectors. Similar to HIV-1 -based vectors, HIV-2 vectors also require RRE for efficient transport of the full-length or singly spliced viral RNAs.
- the viral vector used in the present invention has a minimal viral genome.
- minimal viral genome it is to be understood that the viral vector has been manipulated so as to remove the non-essential elements and to retain the essential elements in order to provide the required functionality to infect, transduce and deliver a nucleotide sequence of interest to a target host cell. Further details of this strategy can be found in WO 1998/017815.
- the plasmid vector used to produce the viral genome within a host cell/packaging cell will have sufficient lentiviral genetic information to allow packaging of an RNA genome, in the presence of packaging components, into a viral particle which is capable of infecting a target cell, but is incapable of independent replication to produce infectious viral particles within the final target cell.
- the vector lacks a functional gag-pol and/or env gene and/or other genes essential for replication.
- the plasmid vector used to produce the viral genome within a host cell/packaging cell will also include transcriptional regulatory control sequences operably linked to the lentiviral genome to direct transcription of the genome in a host cell/packaging cell.
- transcriptional regulatory control sequences may be the natural sequences associated with the transcribed viral sequence (i.e. the 5’ U3 region), or they may be a heterologous promoter, such as another viral promoter (e.g. the CMV promoter).
- the vectors may be self-inactivating (SIN) vectors in which the viral enhancer and promoter sequences have been deleted.
- SIN vectors can be generated and transduce non -dividing cells in vivo with an efficacy similar to that of wild-type vectors.
- the transcriptional inactivation of the long terminal repeat (LTR) in the SIN provirus should prevent mobilisation by replication- competent virus. This should also enable the regulated expression of genes from internal promoters by eliminating any cis-acting effects of the LTR.
- LTR long terminal repeat
- the vectors may be integration-defective.
- Integration defective lentiviral vectors can be produced, for example, either by packaging the vector with catalytically inactive integrase (such as an HIV integrase bearing the D64V mutation in the catalytic site) or by modifying or deleting essential att sequences from the vector LTR, or by a combination of the above.
- the vector of the present invention may be an adenoviral vector.
- the vector of the present invention may be an adenoviral vector particle.
- the adenovirus is a double-stranded, linear DNA virus that does not go through an RNA intermediate.
- adenovirus There are over 50 different human serotypes of adenovirus divided into 6 subgroups based on the genetic sequence homology.
- the natural targets of adenovirus are the respiratory and gastrointestinal epithelia, generally giving rise to only mild symptoms.
- Serotypes 2 and 5 (with 95% sequence homology) are most commonly used in adenoviral vector systems and are normally associated with upper respiratory tract infections in the young.
- Adenoviruses have been used as vectors for gene therapy and for expression of heterologous genes.
- the large (36 kb) genome can accommodate up to 8 kb of foreign insert DNA and is able to replicate efficiently in complementing cell lines to produce very high titres of up to 10 12 .
- Adenovirus is thus one of the best systems to study the expression of genes in primary non- replicative cells.
- Adenoviral vectors enter cells by receptor mediated endocytosis. Once inside the cell, adenovirus vectors rarely integrate into the host chromosome. Instead, they function episomally (independently from the host genome) as a linear genome in the host nucleus. Hence the use of recombinant adenovirus alleviates the problems associated with random integration into the host genome.
- the vector of the present invention may be a herpes simplex viral vector.
- the vector of the present invention may be a herpes simplex viral vector particle.
- Herpes simplex virus is a neurotropic DNA virus with favorable properties as a gene delivery vector.
- HSV is highly infectious, so HSV vectors are efficient vehicles for the delivery of exogenous genetic material to cells.
- Viral replication is readily disrupted by null mutations in immediate early genes that in vitro can be complemented in trans, enabling straightforward production of high-titre pure preparations of non-pathogenic vector.
- the genome is large (152 Kb) and many of the viral genes are dispensable for replication in vitro, allowing their replacement with large or multiple transgenes.
- Latent infection with wild-type virus results in episomal viral persistence in sensory neuronal nuclei for the duration of the host lifetime.
- the vectors are non-pathogenic, unable to reactivate and persist long-term.
- HSV vectors transduce a broad range of tissues because of the wide expression pattern of the cellular receptors recognized by the virus. Increasing understanding of the processes involved in cellular entry has allowed targeting the tropism of HSV vectors.
- the vector of the present invention may be a vaccinia viral vector.
- the vector of the present invention may be a vaccinia viral vector particle.
- Vaccinia virus is large enveloped virus that has an approximately 190 kb linear, doublestranded DNA genome. Vaccinia virus can accommodate up to approximately 25 kb of foreign DNA, which also makes it useful for the delivery of large genes.
- a number of attenuated vaccinia virus strains are known in the art that are suitable for gene therapy applications, for example the MVA and NYVAC strains.
- the vector of the present invention may be used to deliver a polynucleotide into a cell. Subsequently, a nucleotide sequence insert can be introduced into the cell’s genome at a site of a double strand break (DSB) by homology-directed repair (HDR).
- the site of the doublestrand break (DSB) can be introduced specifically by any suitable technique, for example by using an RNA-guided gene editing system.
- RNA-guided gene editing system can be used to introduce a DSB and typically comprises a guide RNA and a RNA-guided nuclease.
- a CRISPR/Cas9 system is an example of a commonly used RNA-guided gene editing system, but other RNA-guided gene editing systems may also be used.
- a “guide RNA” confers target sequence specificity to a RNA-guided nuclease.
- Guide RNAs are non-coding short RNA sequences which bind to the complementary target DNA sequences. For example, in the CRISPR/Cas9 system, guide RNA first binds to the Cas9 enzyme and the gRNA sequence guides the resulting complex via base-pairing to a specific location on the DNA, where Cas9 performs its nuclease activity by cutting the target DNA strand.
- guide RNA encompasses any suitable gRNA that can be used with any RNA- guided nuclease, and not only those gRNAs that are compatible with a particular nuclease such as Cas9.
- the guide RNA may comprise a trans-activating CRISPR RNA (tracrRNA) that provides the stem loop structure and a target-specific CRISPR RNA (crRNA) designed to cleave the gene target site of interest.
- tracrRNA and crRNA may be annealed, for example by heating them at 95°C for 5 minutes and letting them slowly cool down to room temperature for 10 minutes.
- the guide RNA may be a single guide RNA (sgRNA) that consists of both the crRNA and tracrRNA as a single construct.
- the guide RNA may comprise of a 3’-end, which forms a scaffold for nuclease binding, and a 5'-end which is programmable to target different DNA sites.
- the targeting specificity of CRISPR-Cas9 may be determined by the 15-25 bp sequence at the 5' end of the guide RNA.
- the desired target sequence typically precedes a protospacer adjacent motif (PAM) which is a short DNA sequence usually 2-6 bp in length that follows the DNA region targeted for cleavage by the CRISPR system, such as CRISPR-Cas9.
- PAM protospacer adjacent motif
- the PAM is required for a Cas nuclease to cut and is typically found 3-4 bp downstream from the cut site.
- Cas9 mediates a double strand break about 3 -nt upstream of PAM.
- Numerous tools exist for designing guide RNAs e.g.
- COSMID is a webbased tool for identifying and validating guide RNAs (Cradick TJ, et al. Mol Ther - Nucleic Acids. 2014;3(12):e214).
- sequences for guides 9, 3 and 7 may be extended as shown below, for example when used as crRNA:
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to any of SEQ ID NOs: 1 17-151 .
- the guide RNA comprises or consists of the nucleotide sequence of any of SEQ ID NOs: 117-151 .
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to any of SEQ ID NOs: 1 17-130.
- the guide RNA comprises or consists of the nucleotide sequence of any of SEQ ID NOs: 117-130.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to SEQ ID NO: 121 .
- the guide RNA comprises or consists of the nucleotide sequence of SEQ ID NO: 121.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to SEQ ID NO: 122.
- the guide RNA comprises or consists of the nucleotide sequence of SEQ ID NO: 122.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to SEQ ID NO: 127 or 129.
- the guide RNA comprises or consists of the nucleotide sequence of SEQ ID NO: 127 or 129.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to SEQ ID NO: 127.
- the guide RNA comprises or consists of the nucleotide sequence of SEQ ID NO: 127.
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to SEQ ID NO: 129. In some embodiments, the guide RNA comprises or consists of the nucleotide sequence of SEQ ID NO: 129. In one aspect, the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to any of SEQ ID NOs: 131 -143 or 149-151. In some embodiments, the guide RNA comprises or consists of the nucleotide sequence of any of SEQ ID NOs: 131 -143 or 149-151 .
- the present invention provides a guide RNA comprising or consisting of a nucleotide sequence that has at least 90% identity or at least 95% identity to any of SEQ ID NOs: 143-148.
- the guide RNA comprises or consists of the nucleotide sequence of any of SEQ ID NOs: 143-148.
- the guide RNA is chemically modified.
- the chemical modification may enhance the stability of the guide RNA.
- from one to five (e.g. three) of the terminal nucleotides at 5’ end and/or 3’ end of the guide RNA may be chemically modified to enhance stability.
- any chemical modification which enhances the stability of the guide RNA may be used.
- the chemical modification may be modification with 2'-O-methyl 3'-phosphorothioate, as described in Hendel A, et al. Nat Biotechnol. 2015;33(9):985-9.
- nuclease is an enzyme that can cleave the phosphodiester bond present within a polynucleotide chain.
- the nuclease is an endonuclease. Endonucleases are capable of breaking the bond from the middle of a chain.
- RNA-guided nuclease is a nuclease which can be directed to a specific site by a guide RNA.
- the present invention can be implemented using any suitable RNA-guided nuclease, for example any RNA-guided nuclease described in Murugan, K., et al., 2017. Molecular cell, 68(1 ), pp.15-25.
- RNA-guided nucleases include, but are not limited to, Type II CRISPR nucleases such as Cas9, and Type V CRISPR nucleases such as Cas12a and Cas12b, as well as other nucleases derived therefrom.
- RNA-guided nucleases can be defined, in broad terms, by their PAM specificity and cleavage activity.
- the RNA-guided nuclease is a Type II CRISPR nuclease, for example a Cas9 nuclease.
- Cas9 is a dual RNA-guided endonuclease enzyme associated with the Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) adaptive immune system.
- Cas9 nucleases include the well-characterized ortholog from Streptococcus pyogenes (SpCas9). SpCas9 and other orthologs (including SaCas9, FnCa9, and AnaCas9) have been reviewed by Jiang, F. and Doudna, J.A., 2017. Annual review of biophysics, 46, pp.505-529.
- the RNA-guided nuclease may be in a complex with the guide RNA, i.e. the guide RNA and the RNA-guided nuclease may together form a ribonucleoprotein (RNP).
- RNP ribonucleoprotein
- the RNP is a Cas9 RNP.
- a RNP may be formed by any method known in the art, for example by incubating a RNA-guided nuclease with a guide RNA for 5-30 minutes at room temperature. Delivering Cas9 as a preassembled RNP can protect the guide RNA from intracellular degradation thus improving stability and activity of the RNA-guided nuclease (Kim S, et al. Genome Res. 2014;24(6):1012-9).
- Kit composition, gene-editing system
- the present invention provides a kit, composition, or gene-editing system comprising the polynucleotide of the invention, the vector of the invention, and/or the guide RNA of the invention.
- a “gene-editing system” is a system which comprises all components necessary to edit a genome using the polynucleotide of the invention.
- the kit, composition, or gene-editing system comprises a polynucleotide and/or vector of the invention and a guide RNA.
- the guide RNA may correspond to the same DSB site targeted by the homology arms.
- the kit, composition, or gene-editing system comprises:
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36574368 and the second homology region is homologous to a region downstream of chr 1 1 : 36574369, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 117;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36574367 and the second homology region is homologous to a region downstream of chr 1 1 : 36574368, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 118;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36574394 and the second homology region is homologous to a region downstream of chr 11 : 36574395, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 119;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36574294 and the second homology region is homologous to a region downstream of chr 11 : 36574295, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 120;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36574109 and the second homology region is homologous to a region downstream of chr 11 : 36574110, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 121 ;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573910 and the second homology region is homologous to a region downstream of chr 11 : 36573911 , and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 122;
- a polynucleotide comprising from 5’ to 3’ a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 123; (viii) a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 :
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573957 and the second homology region is homologous to a region downstream of chr 11 : 36573958, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 125;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573879 and the second homology region is homologous to a region downstream of chr 11 : 36573880, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 126;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573892 and the second homology region is homologous to a region downstream of chr 11 : 36573893, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 127;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573955 and the second homology region is homologous to a region downstream of chr 11 : 36573956, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 128;
- a polynucleotide comprising from 5’ to 3’: a first homology region, a nucleotide sequence encoding a RAG1 polypeptide fragment, and a second homology region, wherein the first homology region is homologous to a region upstream of chr 11 : 36573878 and the second homology region is homologous to a region downstream of chr 11 : 36573879, and/or a vector comprising said polynucleotide; and a guide RNA which comprises or consists of a nucleotide sequence that has at least 90% identity, at least 95% identity or 100% identity to SEQ ID NO: 129; or
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL312062A IL312062A (en) | 2021-10-12 | 2022-10-11 | Polynucleotides useful for correcting mutations in the rag1 gene |
| JP2024522030A JP2024538769A (ja) | 2021-10-12 | 2022-10-11 | Rag1遺伝子における突然変異を修正するのに有用なポリヌクレオチド |
| US18/700,795 US20240425851A1 (en) | 2021-10-12 | 2022-10-11 | Polynucleotides useful for correcting mutations in the rag1 gene |
| EP22808606.2A EP4416171A1 (en) | 2021-10-12 | 2022-10-11 | Polynucleotides useful for correcting mutations in the rag1 gene |
| CA3234828A CA3234828A1 (en) | 2021-10-12 | 2022-10-11 | Polynucleotides useful for correcting mutations in the rag1 gene |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB2114587.5A GB202114587D0 (en) | 2021-10-12 | 2021-10-12 | Polynucleotide |
| GB2114587.5 | 2021-10-12 | ||
| GB2205593.3 | 2022-04-14 | ||
| GBGB2205593.3A GB202205593D0 (en) | 2022-04-14 | 2022-04-14 | Polynucleotide |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023062030A1 true WO2023062030A1 (en) | 2023-04-20 |
Family
ID=84360322
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2022/078298 Ceased WO2023062030A1 (en) | 2021-10-12 | 2022-10-11 | Polynucleotides useful for correcting mutations in the rag1 gene |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20240425851A1 (enExample) |
| EP (1) | EP4416171A1 (enExample) |
| JP (1) | JP2024538769A (enExample) |
| CA (1) | CA3234828A1 (enExample) |
| IL (1) | IL312062A (enExample) |
| WO (1) | WO2023062030A1 (enExample) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998017815A1 (en) | 1996-10-17 | 1998-04-30 | Oxford Biomedica (Uk) Limited | Retroviral vectors |
| US20190038771A1 (en) * | 2016-02-02 | 2019-02-07 | Crispr Therapeutics Ag | Materials and methods for treatment of severe combined immunodeficiency (scid) or omenn syndrome |
| WO2020002380A1 (en) | 2018-06-25 | 2020-01-02 | Ospedale San Raffaele S.R.L | Gene therapy |
| WO2022079054A1 (en) * | 2020-10-12 | 2022-04-21 | Ospedale San Raffaele S.R.L. | Replacement of rag1 for use in therapy |
-
2022
- 2022-10-11 EP EP22808606.2A patent/EP4416171A1/en active Pending
- 2022-10-11 US US18/700,795 patent/US20240425851A1/en active Pending
- 2022-10-11 CA CA3234828A patent/CA3234828A1/en active Pending
- 2022-10-11 IL IL312062A patent/IL312062A/en unknown
- 2022-10-11 WO PCT/EP2022/078298 patent/WO2023062030A1/en not_active Ceased
- 2022-10-11 JP JP2024522030A patent/JP2024538769A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998017815A1 (en) | 1996-10-17 | 1998-04-30 | Oxford Biomedica (Uk) Limited | Retroviral vectors |
| US20190038771A1 (en) * | 2016-02-02 | 2019-02-07 | Crispr Therapeutics Ag | Materials and methods for treatment of severe combined immunodeficiency (scid) or omenn syndrome |
| WO2020002380A1 (en) | 2018-06-25 | 2020-01-02 | Ospedale San Raffaele S.R.L | Gene therapy |
| WO2022079054A1 (en) * | 2020-10-12 | 2022-04-21 | Ospedale San Raffaele S.R.L. | Replacement of rag1 for use in therapy |
Non-Patent Citations (49)
| Title |
|---|
| "ESID 2014 ORAL PRESENTATIONS", JOURNAL OF CLINICAL IMMUNOLOGY, KLUWER ACADEMIC PUBLISHERS, NEW YORK, vol. 34, no. Suppl 2, 1 October 2014 (2014-10-01), pages 139 - 515, XP037077267, ISSN: 0271-9142, [retrieved on 20141025], DOI: 10.1007/S10875-014-0101-9 * |
| "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| "Oligonucleotide Synthesis: A Practical Approach", 1984, IRL PRESS |
| ARBUCKLE, J.L. ET AL., BMC BIOCHEMISTRY, vol. 12, no. 1, 2011, pages 23 |
| ATSCHUL ET AL., J. MOL. BIOL., 1990, pages 403 - 410 |
| AUSUBEL, F.M. ET AL.: "Current Protocols in Molecular Biology", 1995, JOHN WILEY & SONS |
| AYUSO, E. ET AL., CURRENT GENE THERAPY, vol. 10, no. 6, 2010, pages 423 - 436 |
| BREDEMEYER AL ET AL., NATURE, vol. 442, no. 7101, 14 July 2006 (2006-07-14), pages 466 - 70 |
| CLACKSON T., GENE THERAPY, vol. 7, 2000, pages 120 - 5 |
| CRADICK TJ ET AL., MOL THER - NUCLEIC ACIDS, vol. 3, no. 12, 2014, pages e214 |
| CUI, Y. ET AL., INTERDISCIPLINARY SCIENCES: COMPUTATIONAL LIFE SCIENCES, vol. 10, no. 2, 2018, pages 455 - 465 |
| DE RAVIN SS ET AL., BLOOD, vol. 116, no. 8, 2010, pages 1263 - 71 |
| DELMONTE OM ET AL., BLOOD, vol. 135, no. 9, 2020, pages 610 - 9 |
| DELMONTE, O.M. ET AL., JOURNAL OF CLINICAL IMMUNOLOGY, vol. 38, no. 6, 2018, pages 646 - 655 |
| DEVEREUX ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387 |
| FEMS MICROBIOL. LETT., vol. 177, no. 1, 1999, pages 187 - 50 |
| FERRARI, S. ET AL., NATURE BIOTECHNOLOGY, 2020, pages 1 - 11 |
| GUANQING LIU ET AL: "Computational approaches for effective CRISPR guide RNA design and evaluation", COMPUTATIONAL AND STRUCTURAL BIOTECHNOLOGY JOURNAL, vol. 18, 1 January 2020 (2020-01-01), Sweden, pages 35 - 44, XP055681329, ISSN: 2001-0370, DOI: 10.1016/j.csbj.2019.11.006 * |
| HADDAD E ET AL., BLOOD, vol. 132, no. 17, 2018, pages 1737 - 49 |
| HENDEL A ET AL., NAT BIOTECHNOL., vol. 33, no. 2, 2015, pages 187 - 97 |
| HUANG, X. ET AL., F1000RESEARCH, vol. 8, 2019, pages 1833 |
| JIANG, F.DOUDNA, J.A., ANNUAL REVIEW OF BIOPHYSICS, vol. 46, 2017, pages 505 - 529 |
| KIM S ET AL., GENOME RES, vol. 24, no. 6, 2014, pages 1012 - 9 |
| LAGRESLE-PEYROU C ET AL., BLOOD, vol. 107, no. 1, 2006, pages 63 - 72 |
| LANGMEAD BSALZBERG SL, NAT METHODS, vol. 9, no. 4, 2012, pages 357 - 9 |
| LIANG HE ET AL., IMMUNITY, 2002 |
| LILLEY, D.M.DAHLBERG, J.E.: "Methods in Enzymology", 1992, ACADEMIC PRESS, article "DNA Structures Part A: Synthesis and Physical Analysis of DNA" |
| MA, S.L. ET AL., PLOS ONE, vol. 10, no. 6, 2015, pages e0130729 |
| MADEIRA, F. ET AL., NUCLEIC ACIDS RESEARCH, vol. 47, no. W1, 2019, pages W636 - W641 |
| MERTEN, O.W. ET AL., MOLECULAR THERAPY-METHODS & CLINICAL DEVELOPMENT, vol. 3, 2016, pages 16017 |
| MINGJIE LIU ET AL: "Methodologies for Improving HDR Efficiency", FRONTIERS IN GENETICS, vol. 9, 7 January 2019 (2019-01-07), XP055732542, DOI: 10.3389/fgene.2018.00691 * |
| MURUGAN, K. ET AL., MOLECULAR CELL, vol. 68, no. 1, 2017, pages 15 - 25 |
| NADEAU, I.KAMEN, A., BIOTECHNOLOGY ADVANCES, vol. 20, no. 7-8, 2003, pages 475 - 489 |
| NALDINI L, NATURE, vol. 526, 2015, pages 351 - 360 |
| NOTARANGELO LD ET AL., NAT REV IMMUNOL, vol. 16, no. 4, 2016, pages 234 - 246 |
| NOTARANGELO, L.D. ET AL., NATURE REVIEWS IMMUNOLOGY, vol. 16, no. 4, 2016, pages 234 - 246 |
| PIKE-OVERZET K ET AL., JOURNAL OF ALLERGY AND CLINICAL IMMUNOLOGY, vol. 134, 2014, pages 242 - 243 |
| PIKE-OVERZET K ET AL., LEUKEMIA, vol. 25, no. 9, 2011, pages 1471 - 83 |
| POLAK, J.M.MCGEE, J.O'D.: "In Situ Hybridization: Principles and Practice", 1990, OXFORD UNIVERSITY PRESS |
| RAN, F.A. ET AL., NATURE PROTOCOLS, vol. 8, no. 11, 2013, pages 2281 - 2308 |
| ROE, B.CRABTREE, J.KAHN, A.: "DNA Isolation and Sequencing: Essential Techniques", 1996, JOHN WILEY & SONS |
| SANTAGATA S ET AL., PROC NATL ACAD SCI., vol. 97, no. 26, 19 December 2000 (2000-12-19), pages 14572 - 7 |
| SCHIROLI, G. ET AL., CELL STEM CELL, vol. 24, 2019, pages 551 - 565 |
| SCHOTT, J.W. ET AL., MOLECULAR THERAPY-METHODS & CLINICAL DEVELOPMENT, vol. 14, 2019, pages 134 - 147 |
| TENG GSCHATZ DG, ADVANCES IN IMMUNOLOGY, vol. 128, 2015, pages 1 - 39 |
| VAN TIL NP ET AL., J ALLERGY CLIN IMMUNOL, vol. 133, no. 4, 2014, pages 1116 - 23 |
| WILBIE, D. ET AL., ACCOUNTS OF CHEMICAL RESEARCH, vol. 52, no. 6, 2019, pages 1555 - 1564 |
| YANG, H. ET AL., MOLECULAR THERAPY-NUCLEIC ACIDS, vol. 20, 2020, pages 451 - 458 |
| ZHU LJ ET AL., BMC GENOMICS, vol. 18, no. 1, 2017 |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240425851A1 (en) | 2024-12-26 |
| IL312062A (en) | 2024-06-01 |
| CA3234828A1 (en) | 2023-04-20 |
| JP2024538769A (ja) | 2024-10-23 |
| EP4416171A1 (en) | 2024-08-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220396813A1 (en) | Recombinase compositions and methods of use | |
| US20230131847A1 (en) | Recombinase compositions and methods of use | |
| CN114174520B (zh) | 用于选择性基因调节的组合物和方法 | |
| US20200255859A1 (en) | Cellular models of and therapies for ocular diseases | |
| AU2019365100B2 (en) | Genome editing by directed non-homologous DNA insertion using a retroviral integrase-Cas9 fusion protein | |
| EP4305165A1 (en) | Lentivirus with altered integrase activity | |
| CA3221566A1 (en) | Integrase compositions and methods | |
| CN113840927A (zh) | 用于治疗核纤层蛋白病的组合物及方法 | |
| US20230365996A1 (en) | Replacement of rag1 for use in therapy | |
| JP2023542130A (ja) | Aav-mir-sod1により筋萎縮性側索硬化症(als)を治療するための組成物及び方法 | |
| EP4416171A1 (en) | Polynucleotides useful for correcting mutations in the rag1 gene | |
| CA3195268A1 (en) | Replacement of rag1 for use in therapy | |
| US20240181084A1 (en) | Genome Editing by Directed Non-Homologous DNA Insertion Using a Retroviral Integrase-Cas Fusion Protein and Methods of Treatment | |
| JP2025513887A (ja) | 肝臓における遺伝子発現を脱標的化するための要素 | |
| Lacombe | CRISPR-Cas9-based strategies for enhanced targeted integration | |
| EP4490301A2 (en) | Adeno-associated virus variant capsids with improved lung tropism and uses thereof | |
| AU2021202657A1 (en) | Polynucleotide | |
| WO2026052819A1 (en) | Gene therapy | |
| BR122024014087A2 (pt) | Vetores e células |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22808606 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 312062 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2024522030 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3234828 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18700795 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022808606 Country of ref document: EP Effective date: 20240513 |