WO2023060359A1 - Modified multabody constructs, compositions, and methods targeting sars-cov-2 - Google Patents

Modified multabody constructs, compositions, and methods targeting sars-cov-2 Download PDF

Info

Publication number
WO2023060359A1
WO2023060359A1 PCT/CA2022/051517 CA2022051517W WO2023060359A1 WO 2023060359 A1 WO2023060359 A1 WO 2023060359A1 CA 2022051517 W CA2022051517 W CA 2022051517W WO 2023060359 A1 WO2023060359 A1 WO 2023060359A1
Authority
WO
WIPO (PCT)
Prior art keywords
self
cov
sars
polypeptide complex
binding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2022/051517
Other languages
English (en)
French (fr)
Inventor
Jean-Philippe Julien
Arif JETHA
Clare BURN ASCHNER
Krithika MUTHURAMAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Hospital for Sick Children HSC
Original Assignee
Hospital for Sick Children HSC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Hospital for Sick Children HSC filed Critical Hospital for Sick Children HSC
Priority to US18/701,187 priority Critical patent/US20250011397A1/en
Priority to CA3235530A priority patent/CA3235530A1/en
Priority to JP2024522502A priority patent/JP2024537398A/ja
Priority to EP22879729.6A priority patent/EP4416189A4/en
Publication of WO2023060359A1 publication Critical patent/WO2023060359A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/735Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)

Definitions

  • SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2
  • COVID-19 coronavirus disease 2019
  • COVID-19 coronavirus disease 2019
  • a self-assembled polypeptide complex comprising: (a) one or more fusion proteins comprising a nanocage monomer or subunit thereof linked to an Fc polypeptide, and (b) one or more fusion proteins comprising a nanocage monomer or subunit thereof linked to a SARS-CoV-2 binding moiety; wherein a plurality of the fusion proteins self-assemble to form a nanocage.
  • the Fc polypeptide does not bind to Fc ⁇ receptors.
  • the Fc polypeptide comprises an IgG4 Fc chain with a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering.
  • the IgG4 Fc chain comprises a mutation at positions 234 and 235. In an aspect, the IgG4 Fc chain comprises an F234A mutation and an L235A mutation. In an aspect, the IgG4 Fc chain comprises a mutation at position 228. In an aspect, the IgG4 Fc chain comprises an S228P mutation. In an aspect, the IgG4 Fc chain comprises a mutation at positions 237 and 238. In an aspect, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation. In an aspect, the IgG4 Fc chain does not comprise a mutation at G237 or at P238.
  • the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation. In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In an aspect, the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In an aspect, the IgG4 Fc chain does not comprise a mutation at S228. In an aspect, the nanocage monomer or subunit thereof is a ferritin monomer or subunit thereof.
  • the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof. In an aspect, the ferritin monomer or subunit thereof is a human ferritin or subunit thereof. In an aspect, the ferritin monomer or subunit thereof is a ferritin monomer subunit. In an aspect, the ferritin monomer subunit is a C-half ferritin. In an aspect, the Fc polypeptide is linked to the C-half ferritin’s N-terminus. In an aspect, the Fc polypeptide is linked to the C-half ferritin’s N-terminus via an amino acid linker. In an aspect, the amino acid linker comprises a (GnS)m linker.
  • the (GnS)m linker is a (GGGGS)m linker.
  • the Fc polypeptide comprises a single chain Fc (scFc) comprising two Fc chains, wherein the two Fc chains are linked via an amino acid linker.
  • the amino acid linker that links the two Fc chains comprises a (GnS)m linker.
  • the (GnS)m linker is a (GGGGS)m linker.
  • the SARS-CoV-2 binding moiety targets the SARS-CoV-2 S glycoprotein.
  • the SARS-CoV-2 binding moiety decorates the interior and/or exterior surface, preferably the exterior surface, of the assembled nanocage.
  • the SARS-CoV-2 binding moiety comprises an antibody or fragment thereof.
  • the antibody or fragment thereof comprises a Fab fragment.
  • the antibody or fragment thereof comprises a scFab fragment, a scFv fragment, a sdAb fragment, a VHH domains or a combination thereof.
  • the antibody or fragment thereof comprises a heavy and/or light chain of a Fab fragment.
  • the SARS-CoV-2 binding moiety comprises single chain variable domain VHH- 72, BD23 and/or 4A8.
  • the SARS-CoV-2 binding moiety comprises an mAb listed in Table 4.
  • the SARS-CoV-2 binding moiety comprises mAb 298, 324, 46, 80, 52, 82, or 236 from Table 4, or variants thereof. In an aspect, the SARS-CoV-2 binding moiety comprises mAb 298, 80, and 52 from Table 4, or variants thereof. In an aspect, the SARS-CoV-2 binding moiety is linked at the N- or C-terminus of the nanocage monomer, or wherein there is a first SARS-CoV-2 binding moiety linked at the N-terminus and a second SARS-CoV-2 binding moiety linked at the C-terminus of the nanocage monomer, wherein the first and second SARS-CoV-2 binding moieties are the same or different.
  • the nanocage monomer comprises a first nanocage monomer subunit linked to the SARS-CoV-2 binding moiety; wherein the first nanocage monomer subunit self-assembles with a second nanocage monomer subunit to form the nanocage monomer.
  • the SARS-CoV-2 binding moiety is linked at the N- or C-terminus of the first nanocage monomer, or wherein there is a first SARS-CoV-2 binding moiety linked at the N-terminus and a second SARS-CoV-2 binding moiety linked at the C-terminus of the first nanocage monomer subunit, wherein the first and second SARS-CoV-2 binding moieties are the same or different.
  • the self-assembled polypeptide complex exhibits binding to hFcRn. In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn that is substantially similar to IgG binding to hFcRn, such as IgG1 or IgG4. In an aspect, the self-assembled polypeptide complex exhibits no binding to at least one human Fc ⁇ receptor, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits no binding to one or more human Fc ⁇ receptors selected from the group consisting of hFc ⁇ RI, hFc ⁇ RIIa, hFc ⁇ RIIb, hFc ⁇ RIIIa, hFc ⁇ RIIIb, and combinations thereof, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits no binding to hFc ⁇ RI, hFc ⁇ RIIa, and hFc ⁇ RIIb, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits substantially no IgG4 effector functions.
  • the self-assembled polypeptide complex exhibits binding to at least one human Fc ⁇ receptor, as determined in an in vitro assay.
  • self-assembled polypeptide complex of claim 42 which exhibits binding to one or more human Fc ⁇ receptors selected from the group consisting of hFc ⁇ RI, hFc ⁇ RIIa, hFc ⁇ RIIb, hFc ⁇ RIIIa, hFc ⁇ RIIIb, and combinations thereof, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits binding to hFc ⁇ RI, hFc ⁇ RIIa, and hFc ⁇ RIIb, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits antibody effector functions, such as IgG effector functions. In an aspect, the self-assembled polypeptide complex exhibits IgG4 effector functions.
  • a composition comprising a plurality of the self-assembled polypeptide complexes described herein. In an aspect, the composition comprises a mixture of different self-assembled polypeptide complexes. In accordance with an aspect, there is provided a SARS-CoV-2 therapeutic or prophylactic composition comprising the self-assembled polypeptide complex described herein.
  • a method for treating and/or preventing SARS-CoV-2 comprising administering the self-assembled polypeptide complex described herein to a subject in need thereof.
  • the self-assembled polypeptide complex is for use in treating and/or preventing SARS-CoV-2.
  • a fusion protein comprising a nanocage monomer or subunit thereof linked to an Fc polypeptide, wherein the Fc polypeptide comprises an IgG4 Fc chain with a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering, and wherein a plurality of the fusion proteins self-assemble to form a nanocage.
  • the IgG4 Fc chain comprises a mutation at positions 234 and 235.
  • the IgG4 Fc chain comprises an F234A mutation and an L235A mutation.
  • the IgG4 Fc chain comprises a mutation at position 228.
  • the IgG4 Fc chain comprises an S228P mutation. In an aspect, the IgG4 Fc chain comprises a mutation at positions 237 and 238. In an aspect, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation. In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation. In an aspect, the IgG4 Fc chain does not comprise a mutation at G237 or at P238. In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
  • the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In an aspect, the IgG4 Fc chain does not comprise a mutation at S228.
  • the nanocage monomer or subunit thereof is a ferritin monomer or subunit thereof. In an aspect, the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof. In an aspect, the ferritin monomer or subunit thereof is a human ferritin or subunit thereof. In an aspect, the ferritin monomer or subunit thereof is a ferritin monomer subunit.
  • the ferritin monomer subunit is a C-half ferritin.
  • the Fc polypeptide is linked to the C-half ferritin’s N-terminus.
  • the Fc polypeptide is linked to the C-half ferritin’s N-terminus via an amino acid linker.
  • the amino acid linker comprises a (GnS)m linker.
  • the (GnS)m linker is a (GGGGS)m linker.
  • the Fc polypeptide comprises a single chain Fc (scFc) comprising two Fc chains, wherein the two Fc chains are linked via an amino acid linker.
  • the amino acid linker that links the two Fc chains comprises a (GnS)m linker.
  • the (GnS)m linker is a (GGGGS)m linker.
  • a self-assembled polypeptide complex comprising: (a) one or more first fusion polypeptides, each first fusion polypeptide being a fusion polypeptide of any one of claims 1-22, and (b) one or more second fusion polypeptides, each second fusion polypeptide comprising an antigen-binding moiety linked to a nanocage monomer or subunit thereof.
  • the nanocage monomer or subunit thereof of each second fusion polypeptide is a ferritin monomer or subunit thereof.
  • the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof.
  • the ferritin monomer or subunit thereof is a human ferritin or subunit thereof.
  • the self-assembled polypeptide complex does not comprise any ferritin heavy chains or subunits of ferritin heavy chains.
  • the antigen-binding moiety is linked to the nanocage monomer or subunit thereof via an amino acid linker.
  • the amino acid linker comprises a (GnS)m linker.
  • the (GnS)m linker is a (GGGGS)m linker.
  • the antigen-binding moiety of each second fusion polypeptide is linked to the N- terminus of nanocage monomer or subunit thereof.
  • the antigen-binding moiety of each second fusion polypeptide is a Fab fragment.
  • each second fusion polypeptide does not comprise any antibody CH2 or CH3 domains.
  • the self-assembled polypeptide complex further comprises a plurality of third fusion polypeptides, each third fusion polypeptide comprising an antigen-binding moiety linked to a nanocage monomer or a subunit thereof, wherein the third fusion polypeptide is different than the second fusion polypeptide.
  • the antigen-binding moiety of each third fusion polypeptide is a Fab fragment.
  • each third fusion polypeptide does not comprise any antibody CH2 or CH3 domains.
  • the nanocage monomer or subunit thereof of each first fusion polypeptide and each second fusion polypeptide is a ferritin monomer subunit, and a.
  • each first fusion polypeptide comprises a C-half-ferritin, and each second fusion polypeptide comprises a N-half-ferritin; or b. each first fusion polypeptide comprises an N-half ferritin, and each second fusion polypeptide comprises a C-half-ferritin.
  • the self-assembled polypeptide complex is characterized by a 1:1 ratio of first fusion polypeptides to second fusion polypeptides.
  • the self-assembled polypeptide complex comprises a total of 24 to 48 fusion polypeptides.
  • the self-assembled polypeptide complex comprises a total of least 24 fusion polypeptides.
  • the self-assembled polypeptide complex comprises a total of at least 32 fusion polypeptides. In an aspect, the self-assembled polypeptide complex has a total of about 32 fusion polypeptides. In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn. In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn that is substantially similar to IgG binding to hFcRn, such as IgG1 or IgG4. In an aspect, the self-assembled polypeptide complex exhibits no binding to at least one human Fc ⁇ receptor, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits no binding to one or more human Fc ⁇ receptors selected from the group consisting of hFc ⁇ RI, hFc ⁇ RIIa, hFc ⁇ RIIb, hFc ⁇ RIIIa, hFc ⁇ RIIIb, and combinations thereof, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits no binding to hFc ⁇ RI, hFc ⁇ RIIa, and hFc ⁇ RIIb, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits substantially no IgG4 effector functions.
  • the self-assembled polypeptide complex exhibits binding to at least one human Fc ⁇ receptor, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits binding to one or more human Fc ⁇ receptors selected from the group consisting of hFc ⁇ RI, hFc ⁇ RIIa, hFc ⁇ RIIb, hFc ⁇ RIIIa, hFc ⁇ RIIIb, and combinations thereof, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits binding to hFc ⁇ RI, hFc ⁇ RIIa, and hFc ⁇ RIIb, as determined in an in vitro assay.
  • the self-assembled polypeptide complex exhibits antibody effector functions, such as IgG effector functions. In an aspect, the self-assembled polypeptide complex exhibits IgG4 effector functions.
  • a composition comprising a plurality of the self-assembled polypeptide complexes described herein. In an aspect, the composition comprises a mixture of different self-assembled polypeptide complexes.
  • a method comprising administering a composition comprising the self-assembled polypeptide complex described herein to a mammalian subject. In an aspect, the subject is human. In an aspect, the subject has or is at risk of developing cancer.
  • the subject has or is at risk of developing an autoimmune disorder.
  • the subject has or is at risk of developing an infectious disease.
  • the subject has or is at risk of developing a metabolic disorder.
  • the method comprises administration by a systemic route.
  • the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
  • a composition comprising the self- assembled polypeptide complex described herein for administration to a mammalian subject.
  • the subject is human.
  • the subject has or is at risk of developing cancer.
  • the subject has or is at risk of developing an autoimmune disorder.
  • the subject has or is at risk of developing an infectious disease.
  • the use is for administration by a systemic route.
  • the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
  • a composition comprising the self-assembled polypeptide complex described herein for use in administration to a mammalian subject.
  • the subject is human.
  • the subject has or is at risk of developing cancer.
  • the subject has or is at risk of developing an autoimmune disorder.
  • the subject has or is at risk of developing an infectious disease.
  • the composition is for administration by a systemic route.
  • the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
  • RBD side- chains that are part of the binding interface of the ACE2-RBD and Fab 298-RBD complexes are depicted in pink, while RBD side-chains unique to a given interface are shown in yellow.
  • Surfaces of ACE2, variable regions of Fab 298 HC and Fab 298 KC are shown in white, grey and tan, respectively.
  • the RBD is colored as in (a).
  • d) Superposition of Fabs 46 (light pink) and 52 (dark pink) when bound to the RBD (green) reveals a distinct angle of approach for the two mAbs.
  • Stereo-image of the composite omit map electron density contoured at 1.3 sigma at the interfaces of e) 298-RBD and f) 52-RBD.
  • c MB and IgG2a samples were labeled with Alexa-647 for visualization of their biodistribution post subcutaneous injection into three male BALB/c mice/group via live noninvasive 2D whole body imaging.15 nm fluorescently-labeled gold nanoparticles (GNP), which have a similar Rh value as the Multabody are shown as a comparator.
  • GNP fluorescently-labeled gold nanoparticles
  • Each 3D image set is displayed showing dorsal view overlaid with CT scan (right), as well as a selected frontal (top left), medial (middle), and transverse (bottom left) planes based on signal localization.
  • 3D fluorescent images were mapped to a rainbow look-up Table (LUT), with color scale minimum set to background and maximum set to 50 pmol M -1 cm -1 (GNP) or 1000 pmol M -1 cm -1 (MB and IgG).
  • Figure 5 Protein engineering to multimerize IgG-like particles against SARS-CoV-2. a Schematic representation of the human apoferritin split design.
  • Negative stain electron micrograph of the MB. (Scale bar 50 nm, representative of two independent experiments).
  • the mean values ⁇ SD for two technical replicates are shown in each neutralization plot.
  • Figure 10. Epitope delineation of the most potent mAb specificities. a Surface and cartoon representation of RBD (light green for the core and dark green for RBM) and ACE2 66 (light brown) binding. Heat map showing binding competition experiments. High signal responses (red) represent low competition while low signal responses (white) correspond to high competition. Epitope bins are highlighted by dashed-line boxes.
  • the epitopes of mAbs 52 are shown as representative epitopes of each bin.
  • e Neutralization potency comparison of two IgG cocktails three IgGs
  • monospecific MB cocktails three MBs
  • mAbs sensitive to one or more PsV variants were selected to generate the cocktails and the tri-specific MBs.
  • the N92T mutation in the VL of mAb 52 did not impact potency as both an IgG or as a monospecific MB in a WT pseudovirus neutralization assay.
  • Figure 16. The 298-80-52 tri-specific MB (T10 MB) containing the N92T mutation in the VL of mAb 52 was screened in a P.1 PsV neutralization assay and the results confirmed that there was no loss in potency observed compared to the parental tri-specific MB.
  • the tri-specific MB, 298-80-52 demonstrated superior potency across the variants of concern in the pseudovirus neutralization assay.
  • Figure 18. T10 MBs show comparable neutralization in pseudovirus and authentic virus assays.
  • T10.G MB was able to confer 75% protection, compared to the negative control IgG group in homozygous hFcRn / hACE2 transgenic mice.
  • In vivo protection was accompanied by a reduction in body weight loss throughout the experiment in surviving mice.
  • Figure 23. T10.B MB achieves the expected maximum serum concentration (Cmax) and is detectable in circulation for weeks after dosing in NHPs.
  • Figure 24. (a) generation of tri-specific MB molecules using an engineered apoferritin split design. (b) Analysis of cryoEM micrographs revealed the formation of highly decorated and homogeneous nanocage-like particles.
  • Figure 27.3D reconstructions of the apoferritin scaffold of the MB reached 2.4 ⁇ and 2.1 ⁇ resolution, respectively, when (a)-(d) no symmetry (C1) or (e)-(h) octahedral symmetry (O) was applied.
  • Figure 28. Crystal structure of 80 Fab in complex with RBD at 3.1 ⁇ resolution.
  • Figure 29. (a) mAb 80 inhibits SARS-CoV-2 infection through receptor blockade, preventing the interaction of ACE2 with the receptor binding motif.
  • any aspects described as “comprising” certain components may also “consist of” or “consist essentially of,” wherein “consisting of” has a closed-ended or restrictive meaning and “consisting essentially of” means including the components specified but excluding other components except for materials present as impurities, unavoidable materials present as a result of processes used to provide the components, and components added for a purpose other than achieving the technical effect of the invention.
  • a composition defined using the phrase “consisting essentially of” encompasses any known acceptable additive, excipient, diluent, carrier, and the like.
  • a composition consisting essentially of a set of components will comprise less than 5% by weight, typically less than 3% by weight, more typically less than 1%, and even more typically less than 0.1% by weight of non-specified component(s).
  • any component defined herein as being included may be explicitly excluded from the claimed invention by way of proviso or negative limitation.
  • the nanocages and/or fusion proteins described herein may exclude a ferritin heavy chain and/or may exclude an iron-binding component.
  • all ranges given herein include the end of the ranges and also any intermediate range points, whether explicitly stated or not.
  • the term “about” may encompass a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less of the referred value.”
  • the abbreviation, “e.g.” is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation “e.g.” is synonymous with the terms “for example,” or “such as.”
  • the word “or” is intended to include “and” unless the context clearly indicates otherwise.
  • subject refers to any member of the animal kingdom, typically a mammal.
  • mammal refers to any animal classified as a mammal, including humans, other higher primates, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc. Typically, the mammal is human.
  • protein nanoparticle,” “nanocage,” and “multabody” are used interchangeably herein and refer to a multi-subunit, protein-based polyhedron shaped structure.
  • the subunits or nanocage monomers are each composed of proteins or polypeptides (for example a glycosylated polypeptide), and, optionally of single or multiple features of the following: nucleic acids, prosthetic groups, organic and inorganic compounds.
  • protein nanoparticles include ferritin nanoparticles (see, e.g., Zhang, Y. Int. J. Mol. Sci., 12:5406-5421, 2011, incorporated by reference herein), encapsulin nanoparticles (see, e.g., Sutter et al., Nature Struct, and Mol.
  • Sulfur Oxygenase Reductase SOR
  • Sulfur Oxygenase Reductase SOR
  • lumazine synthase nanoparticles see, e.g., Zhang et al., J. Mol. Biol., 306: 1099-1114, 2001
  • pyruvate dehydrogenase nanoparticles see, e.g., Izard et al., PNAS 96: 1240-1245, 1999, incorporated by reference herein).
  • Ferritin, apoferritin, encapsulin, SOR, lumazine synthase, and pyruvate dehydrogenase are monomeric proteins that self-assemble into a globular protein complexes that in some cases consists of 24, 60, 24, 60, and 60 protein subunits, respectively.
  • Ferritin and apoferritin are generally referred to interchangeably herein and are understood to both be suitable for use in the fusion proteins, nanocages, and methods described herein.
  • Carboxysome, vault proteins, GroEL, heat shock protein, E2P and MS2 coat protein also produce nanocages are contemplated for use herein.
  • fully or partially synthetic self-assembling monomers are also contemplated for use herein.
  • each nanocage monomer may be divided into two or more subunits that will self-assemble into a functional nanocage monomer.
  • ferritin or apoferritin may be divided into an N- and C- subunit, e.g., an N- and C- subunit obtained by dividing full-length ferritin substantially in half, so that each subunit may be separately bound to a different SARS-CoV-2 binding moiety or bioactive moiety for subsequent self-assembly into a nanocage monomer and then a nanocage.
  • Each subunit may, in aspects, bind a SARS-CoV-2 binding moiety and/or bioactive moiety at both termini, either the same or different.
  • the nanocage monomer is capable of self-assembly with other such monomers into a nanocage as described herein.
  • the terms “ferritin” and “apoferritin” are used interchangeably herein and generally refer to a polypeptide (e.g., a ferritin chain) that is capable of assembling into a ferritin complex which typically comprises 24 protein subunits. It will be understood that the ferritin can be from any species. Typically, the ferritin is a human ferritin. In some embodiments, the ferritin is a wild-type ferritin. For example, the ferritin may be a wild-type human ferritin.
  • a ferritin light chain is used as a nanocage monomer, and/or a subunit of a ferritin light chain is used as a nanocage monomer subunit.
  • assembled nanocages do not include any ferritin heavy chains or other ferritin components capable of binding to iron.
  • multispecific refers to the characteristic of having at least two binding sites at which at least two different binding partners, e.g., an antigen or receptor (e.g., Fc receptor), can bind.
  • a nanocage that comprises at least two Fab fragments, wherein each of the two Fab fragments binds to a different antigen is “multispecific.”
  • a nanocage that comprises an Fc fragment (which is capable of binding to an Fc receptor) and a Fab fragment (which is capable of binding to an antigen) is “multispecific.”
  • the term “multivalent,” as used herein, refers to the characteristic of having at least two binding sites at which a binding partner, e.g., an antigen or receptor (e.g., Fc receptor), can bind.
  • the binding partners that can bind to the at least two binding sites may be the same or different.
  • antibody also referred to in the art as “immunoglobulin” (Ig), used herein refers to a protein constructed from paired heavy and light polypeptide chains; various Ig isotypes exist, including IgA, IgD, IgE, IgG, such as IgG 1 , IgG 2 , IgG 3 , and IgG 4 , and IgM. It will be understood that the antibody may be from any species, including human, mouse, rat, monkey, llama, or shark. When an antibody is correctly folded, each chain folds into a number of distinct globular domains joined by more linear polypeptide sequences.
  • VH and VL Interaction of the heavy and light chain variable domains (VH and VL) results in the formation of an antigen binding region (Fv).
  • Fv antigen binding region
  • Each domain has a well- established structure familiar to those of skill in the art.
  • the light and heavy chain variable regions are responsible for binding the target antigen and can therefore show significant sequence diversity between antibodies.
  • the constant regions show less sequence diversity, and are responsible for binding a number of natural proteins to elicit important immunological events.
  • variable region of an antibody contains the antigen binding determinants of the molecule, and thus determines the specificity of an antibody for its target antigen.
  • the majority of sequence variability occurs in six hypervariable regions, three each per variable heavy and light chain; the hypervariable regions combine to form the antigen-binding site, and contribute to binding and recognition of an antigenic determinant.
  • the specificity and affinity of an antibody for its antigen is determined by the structure of the hypervariable regions, as well as their size, shape and chemistry of the surface they present to the antigen.
  • An "antibody fragment" as referred to herein may include any suitable antigen-binding antibody fragment known in the art.
  • the antibody fragment may be a naturally-occurring antibody fragment, or may be obtained by manipulation of a naturally-occurring antibody or by using recombinant methods.
  • an antibody fragment may include, but is not limited to a Fv, single-chain Fv (scFv; a molecule consisting of VL and VH connected with a peptide linker), Fc, single- chain Fc, Fab, single-chain Fab, F(ab')2, single domain antibody (sdAb; a fragment composed of a single VL or VH), and multivalent presentations of any of these.
  • synthetic antibody as used herein, is meant an antibody which is generated using recombinant DNA technology.
  • epitope refers to an antigenic determinant.
  • An epitope is the particular chemical groups or peptide sequences on a molecule that are antigenic, that is, that elicit a specific immune response.
  • An antibody specifically binds a particular antigenic epitope, e.g., on a polypeptide.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5, about 9, about 11, or about 8 to about 12 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2- dimensional nuclear magnetic resonance. See, e.g., “Epitope Mapping Protocols” in Methods in Molecular Biology, Vol.66, Glenn E.
  • antigen as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both.
  • antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequence or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an "antigen" as that term is used herein.
  • an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the aspects described herein include, but are not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences could be arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a "gene” at all. It is readily apparent that an antigen can be synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a cell, or a biological fluid.
  • Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
  • a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • expression as used herein is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter. "Isolated" means altered or removed from the natural state.
  • nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
  • a "nucleotide sequence encoding an amino acid sequence" includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
  • modulating is meant mediating a detectable increase or decrease in the level of a response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and/or compared with the level of a response in an otherwise identical but untreated subject.
  • the term encompasses perturbing and/or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, typically, a human.
  • operably linked refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
  • compositions includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques. Also included are inhalation and intranasal administration.
  • polynucleotide as used herein is defined as a chain of nucleotides.
  • nucleic acids are polymers of nucleotides. Thus, nucleic acids and polynucleotides as used herein are interchangeable.
  • nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric "nucleotides.”
  • the monomeric nucleotides can be hydrolyzed into nucleosides.
  • polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCR, and the like, and by synthetic means.
  • peptide As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types.
  • Polypeptides include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others.
  • the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
  • specifically binds as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species.
  • an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen.
  • cross reactivity does not itself alter the classification of an antibody as specific.
  • the terms "specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally.
  • the phrases “does not bind,” “non-binding” or “no binding,” or similar phrases, between two entities refers to 1) a lack of detectable binding or 2) binding below a set threshold that corresponds to no binding in an appropriate assay, e.g., an in vitro binding assay such as biolayer interferometry.
  • a maximal association binding response of less than 0.1 nm after 180 seconds to a biosensor loaded with 0.8 nm of target when the test article is present at a concentration of 20 nM is classified as “non- binding.”
  • the terms "therapeutically effective amount”, “effective amount” or “sufficient amount” mean a quantity sufficient, when administered to a subject, including a mammal, for example a human, to achieve a desired result, for example an amount effective to cause a protective immune response. Effective amounts of the compounds described herein may vary according to factors such as the molecule, age, sex, species, and weight of the subject.
  • Dosage or treatment regimens may be adjusted to provide the optimum therapeutic response, as is understood by a skilled person.
  • administration of a therapeutically effective amount of the fusion proteins described herein is, in aspects, sufficient to treat and/or prevent COVID-19.
  • a treatment regime of a subject with a therapeutically effective amount may consist of a single administration, or alternatively comprise a series of applications. The frequency and length of the treatment period depends on a variety of factors, such as the molecule, the age of the subject, the concentration of the agent, the responsiveness of the patient to the agent, or a combination thereof. It will also be appreciated that the effective dosage of the agent used for the treatment may increase or decrease over the course of a particular treatment regime.
  • the fusion proteins described herein may, in aspects, be administered before, during or after treatment with conventional therapies for the disease or disorder in question.
  • the fusion proteins described herein may find particular use in combination with conventional treatments for viral infections.
  • transfected or transformed or transduced refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
  • a "transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid.
  • the cell includes the primary subject cell and its progeny.
  • a “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
  • vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
  • the term “vector” includes an autonomously replicating plasmid or a virus.
  • the term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
  • viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, and the like.
  • Administration "in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
  • pharmaceutically acceptable means that the compound or combination of compounds is compatible with the remaining ingredients of a formulation for pharmaceutical use, and that it is generally safe for administering to humans according to established governmental standards, including those promulgated by the United States Food and Drug Administration.
  • pharmaceutically acceptable carrier includes, but is not limited to solvents, dispersion media, coatings, antibacterial agents, antifungal agents, isotonic and/or absorption delaying agents and the like.
  • pharmaceutically acceptable carriers include, but is not limited to solvents, dispersion media, coatings, antibacterial agents, antifungal agents, isotonic and/or absorption delaying agents and the like.
  • pharmaceutically acceptable carriers are well known.
  • “Variants” are biologically active fusion proteins, antibodies, or fragments thereof having an amino acid sequence that differs from a comparator sequence by virtue of an insertion, deletion, modification and/or substitution of one or more amino acid residues within the comparative sequence. Variants generally have less than 100% sequence identity with the comparative sequence.
  • a biologically active variant will have an amino acid sequence with at least about 70% amino acid sequence identity with the comparative sequence, such as at least about 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity.
  • the variants include peptide fragments of at least 10 amino acids that retain some level of the biological activity of the comparator sequence.
  • Variants also include polypeptides wherein one or more amino acid residues are added at the N- or C-terminus of, or within, the comparative sequence. Variants also include polypeptides where a number of amino acid residues are deleted and/or optionally substituted by one or more amino acid residues. Variants also may be covalently modified, for example by substitution with a moiety other than a naturally occurring amino acid or by modifying an amino acid residue to produce a non-naturally occurring amino acid.
  • Percent amino acid sequence identity is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the residues in the sequence of interest, such as the polypeptides of the invention, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. None of N-terminal, C-terminal, or internal extensions, deletions or insertions into the candidate sequence shall be construed as affecting sequence identity or homology. Methods and computer programs for the alignment are well known in the art, such as "BLAST".
  • “Active” or “activity” for the purposes herein refers to a biological and/or an immunological activity of the fusion proteins described herein, wherein “biological” activity refers to a biological function (either inhibitory or stimulatory) caused by the fusion proteins.
  • the fusion proteins described herein may include modifications. Such modifications include, but are not limited to, conjugation to an effector molecule. Modifications further include, but are not limited to conjugation to detectable reporter moieties. Modifications that extend half-life (e.g., pegylation) are also included. Modifications for de-immunization are also included. Proteins and non- protein agents may be conjugated to the fusion proteins by methods that are known in the art.
  • Conjugation methods include direct linkage, linkage via covalently attached linkers, and specific binding pair members (e.g., avidin-biotin). Such methods include, for example, that described by Greenfield et al., Cancer Research 50, 6600-6607 (1990), which is incorporated by reference herein and those described by Amon et al., Adv. Exp. Med. Biol.303, 79-90 (1991) and by Kiseleva et al, MoI. Biol. (USSR)25, 508-514 (1991), both of which are incorporated by reference herein.
  • Fusion Proteins Described herein are fusion proteins.
  • the fusion proteins comprise a nanocage monomer linked to a SARS-CoV-2 binding moiety.
  • a plurality of the fusion proteins self-assemble to form a nanocage.
  • the SARS-CoV-2 binding moiety may decorate the interior surface of the assembled nanocage, the exterior surface of the assembled nanocage, or both.
  • the SARS-CoV-2 binding moiety is typically an antibody or a fragment thereof and, while it can target any part of the SARS-CoV-2 virus, it typically targets the SARS-CoV-2 S glycoprotein. It will be understood that the SARS-CoV-2 binding moiety need not be an antibody or fragment thereof and may be a molecule such as a protein that binds and blocks the virus, or the S glycoprotein or an RBD domain in the virus, for example.
  • the antibody or fragment thereof may comprise, for example, a heavy and/or light chain of a Fab fragment.
  • the antibody or fragment thereof may comprise a scFab fragment, a scFv fragment, a sdAb fragment, and/or a VHH region for example.
  • any antibody or fragment thereof may be used in the fusion proteins described herein.
  • the fusion protein described herein is associated with a Fab light chain and/or heavy chain, which may be produced separately or contiguously with the fusion protein.
  • the SARS-CoV-2 binding moiety may comprise single chain variable domain VHH-72, BD23 and/or 4A8.
  • the SARS-CoV-2 binding moiety may be selected from any one or a combination of the mAbs listed in Table 4 herein.
  • the SARS- CoV-2 binding moiety may be selected from any one or a combination of mAbs 298, 324, 46, 80, 52, 82, and 236 from Table 4.
  • the nanocage monomer described herein may be split into subunits, allowing for more SARS-CoV-2 binding moieties or other moieties to be attached thereto in various ratios.
  • the nanocage monomer comprises a first nanocage monomer subunit linked to the SARS-CoV-2 binding moiety.
  • the first nanocage monomer subunit self-assembles with a second nanocage monomer subunit to form the nanocage monomer.
  • a plurality of the nanocage monomers self-assemble to form a nanocage.
  • the nanocage monomer subunits may be provided alone or in combination and may have the same or a different SARS-CoV-2 binding moiety fused thereto.
  • a nanocage made from the nanocage monomers and/or nanocage monomer subunits described herein may have bioactive moieties included in addition to one or more SARS-CoV-2 binding moieties.
  • the bioactive moiety may comprise, for example, one or both chains of an Fc fragment.
  • the Fc fragment may be derived from any type of antibody as will be understood but is, typically, an IgG4 Fc fragment.
  • the Fc fragment may further comprise one or more mutations, such as a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering, that modulate the half-life and/or effector functions of the fusion protein and/or the resulting assembled nanocage comprising the fusion protein.
  • the half-life may be in the scale of minutes, days, weeks, or even months.
  • substitutions in the fusion proteins and nanocages described herein are contemplated, including Fc sequence modifications and addition of other agents (e.g.
  • fusion proteins and nanocages described herein can be modulated in sequence or by addition of other agents to mute immunogenicity and anti-drug responses (therapeutic, e.g. matching sequence to host, or addition of immunosuppressive therapies [such as, for example, methotrexate when administering infliximab for treating rheumatoid arthritis or induction of neonatal tolerance, which is a primary strategy in reducing the incidence of inhibitors against FVIII (reviewed in: Di Michele DM, Hoots WK, Pipe SW, Rivard GE, Santagostino E. International workshop on immune tolerance induction: consensus recommendations.
  • immunosuppressive therapies such as, for example, methotrexate when administering infliximab for treating rheumatoid arthritis or induction of neonatal tolerance
  • fusion proteins comprising a nanocage monomer or subunit thereof linked to an Fc polypeptide.
  • the Fc polypeptide comprises one or more human IgG4 Fc chains that is, except for mutations noted herein, the Fc polypeptide comprises an Fc chain that is substantially similar to that of the Fc chains within a wild type human IgG4.
  • the wild type IgG4 Fc is a human IgG4 Fc, in which each Fc chain has an amino acid sequence of SEQ ID NO:66.
  • an Fc polypeptide may comprise an Fc chain with an amino acid sequence that is at least 85%, at least 87.5%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to that of an Fc chain within a wild-type IgG4 Fc.
  • an Fc polypeptide comprises an Fc chain that comprises the particular residue(s) at certain position(s) specifically described for that Fc chain, but has an amino acid sequence that is otherwise 100% identical to a corresponding Fc chain within a wild type Fc chain, e.g., wild type IgG4 Fc chain.
  • the Fc polypeptide comprises an Fc chain that has an amino acid sequence that differs by at least one, at least two, at least three, or at least four amino acid residues from the sequence of SEQ ID NO:66. In some embodiments, the Fc polypeptide comprises an Fc chain that has an amino acid sequence that differs by no more than ten, no more than nine, no more than eight, no more than seven, no more than six, no more than five, or no more than four amino acid residues from the sequence of SEQ ID NO:66. In some embodiments, the Fc polypeptide comprises an Fc chain that differs by three, four, or five amino acid residues from the sequence of SEQ ID NO:66.
  • the Fc polypeptide is a single chain Fc (scFc), which comprises two Fc chains linked together by a covalent linker, e.g., via an amino acid linker.
  • fragment crystallizable (Fc) regions such as IgG4 Fc chains, comprise a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering.
  • the IgG4 Fc chain comprises a mutation at positions 234 and 235.
  • the IgG4 Fc chain comprises an F234A mutation and an L235A mutation.
  • the IgG4 Fc chain comprises a mutation at position 228.
  • the IgG4 Fc chain comprises an S228P mutation. In some embodiments, the IgG4 Fc chain comprises a mutation at positions 237 and 238. In some embodiments, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation. In some embodiments, the IgG4 Fc chain does not comprise a mutation at G237 or at P238. In some embodiments, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation. In some embodiments, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
  • the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In some embodiments, the IgG4 Fc chain does not comprise a mutation at S228. Unless otherwise noted, numbering of mutations throughout this disclosure is according to the EU index.
  • the Fc region is an IgG4 Fc region, (e.g., a human IgG4 Fc region), that is, except for mutations noted herein, the Fc region comprises a Fc chains that each have an amino acid sequence that is substantially similar to that of the chains within a wild type IgG4 Fc.
  • the wild type reference IgG4 Fc is a human IgG4 Fc, in which each Fc chain has an amino acid sequence of SEQ ID NO:66.
  • an IgG4 Fc region may comprise an Fc chain with an amino acid sequence that is at least 85%, at least 87.5%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to that of an Fc chain within a wild-type IgG4 Fc.
  • an IgG4 Fc region comprises an Fc chain that comprises the Fc mutations specifically described for that IgG4 Fc region, but has an amino acid sequence that is otherwise 100% identical to an Fc chain within a wild type IgG4 Fc.
  • the Fc region is a single chain Fc (scFc), which comprises two Fc chains linked together by a covalent linker, e.g., via an amino acid linker.
  • the Fc region is an Fc monomer, which comprises a single Fc chain. In cases where the antibody or fragment thereof comprises two chains, such as a first and second chain in the case of a Fc fragment, or a heavy and light chain, the two chains are optionally separated by a linker.
  • the linker may be flexible or rigid, but it typically flexible to allow the chains to fold appropriately.
  • the linker is generally long enough to impart some flexibility to the fusion protein, although it will be understood that linker length will vary depending upon the nanocage monomer and bioactive moiety sequences and the three-dimensional conformation of the fusion protein.
  • the linker is typically from about 1 to about 130 amino acid residues, such as from about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, or 125 to about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, or 130 amino acid residues, such as from about 50 to about 90 amino acid residues, such as 70 amino acid residues.
  • the linker may be of any amino acid sequence and, in one typical example, the linker comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats.
  • the linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to: GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGS.
  • linkers are used within fusion polypeptides and/or within single-chain molecules such as scFcs.
  • the linker is an amino acid linker.
  • a linker as employed herein may comprise from about 1 to about 100 amino acid residues, e.g., about 1 to about 70, about 2 to about 70, about 1 to about 30, or about 2 to about 30 amino acid residues.
  • the linker comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid residues.
  • the linker comprises a glycine-serine sequence, e.g., a (GnS)m sequence (e.g., GGS, GGGS, or GGGGS sequence) that is present in at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, or at least 14 copies within the linker.
  • the antibody or fragment thereof binds specifically to an antigen associated with SARS-CoV-2.
  • the antigen is associated with SARS-CoV-2 and the antibody or fragment thereof comprises, for example, a binding domain from Table 4, such as binding domain 298, 52, 46, 80, 82, 236, 324 or combinations thereof.
  • the SARS-CoV-2-binding antibody fragment is capable of binding to the receptor binding domain (RBD) of SARS-CoV-2. In certain embodiments, the SARS-CoV-2- binding antibody fragment is capable of binding to the Spike protein (S protein) of SARS-CoV-2. In some embodiments, the SARS-CoV-2-binding antibody fragment is capable of binding to the N- terminal Domain (NTD) of the S protein of SARS-CoV-2. In some embodiments, the SARS-CoV-2-binding antibody fragment comprises a heavy chain variable region (e.g., a VH or VHH).
  • a heavy chain variable region e.g., a VH or VHH
  • the SARS-CoV-2-binding antibody fragment comprises a heavy chain variable domain (e.g., VH) and a light chain variable domain (e.g., a VL or VK).
  • the SARS-CoV-2-binding antibody fragment comprises a Fab which comprises a heavy chain variable domain (e.g., VH) and a light chain variable domain (e.g., a VL or VK).
  • the SARS-CoV-2-binding antibody fragment comprises a VH heavy chain variable domain and a VK light chain variable domain.
  • the SARS-CoV-2- binding antibody fragment comprises a Fab which comprises a VH heavy chain variable domain and VK a light chain variable domain.
  • the antibody or fragment thereof comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to one or more of the following sequences:
  • Fc chain 1 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVLHEALHSHYTQKSLSLSPGK;
  • Fc chain 2 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKP
  • the antibody or fragment thereof is conjugated to or associated with a further moiety, such as a detectable moiety (e.g., a small molecule, fluorescent molecule, radioisotope, or magnetic particle), a pharmaceutical agent, a diagnostic agent, or combinations thereof and may comprise, for example, an antibody-drug conjugate.
  • a detectable moiety e.g., a small molecule, fluorescent molecule, radioisotope, or magnetic particle
  • the detectable moiety may comprise a fluorescent protein, such as GFP, EGFP, Ametrine, and/or a flavin-based fluorescent protein, such as a LOV-protein, such as iLOV.
  • the pharmaceutical agent may comprise for example, a small molecule, peptide, lipid, carbohydrate, or toxin.
  • the nanocage assembled from the fusion proteins described herein comprises from about 3 to about 100 nanocage monomers, such as from about 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 55, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, or 98 to about 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 55, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90,
  • the nanocage monomer may be any known nanocage monomer, natural, synthetic, or partly synthetic and is, in aspects, selected from ferritin, apoferritin, encapsulin, SOR, lumazine synthase, pyruvate dehydrogenase, carboxysome, vault proteins, GroEL, heat shock protein, E2P, MS2 coat protein, fragments thereof, and variants thereof.
  • the nanocage monomer is ferritin or apoferritin.
  • the first and second nanocage monomer subunits interchangeably comprise the “N” and “C” regions of apoferritin.
  • the nanocage monomer is a ferritin monomer.
  • the term “ferritin monomer,” is used herein to refer to a single chain of a ferritin that, in the presence of other ferritin chains, is capable of self-assembling into a polypeptide complex comprising a plurality of ferritin chains.
  • ferritin chains self-assembled into a polypeptide complex comprising 24 or more ferritin chains.
  • the ferritin monomer is a ferritin light chain.
  • the ferritin monomer does not include a ferritin heavy chain or other ferritin components capable of binding to iron.
  • each fusion polypeptide within the self-assembled polypeptide complex comprises a ferritin light chain or a subunit of a ferritin light chain.
  • the self-assembled polypeptide complex does not comprise any ferritin heavy chains or subunits of ferritin heavy chains.
  • the ferritin monomer is a human ferritin chain, e.g., a human ferritin light chain, e.g., a human ferritin light chain having the sequence of at least residues 2-175 of SEQ ID NO:1.
  • the ferritin monomer is a mouse ferritin chain.
  • a “subunit” of a ferritin monomer refers to a portion of a ferritin monomer that is capable of spontaneously associating with another, distinct subunit of a ferritin monomer, so that the subunits together form a ferritin monomer, which ferritin monomer, in turn, is capable of self-assembling with other ferritin monomers to form a polypeptide complex.
  • the ferritin monomer subunit comprises approximately half of a ferritin monomer.
  • the term “N-half ferritin” refers to approximately half of a ferritin chain, which half comprises the N-terminus of the ferritin chain.
  • C-half ferritin refers to approximately half a ferritin chain, which half comprises the C-terminus of the ferritin chain.
  • the exact point at which a ferritin chain may be divided to form the N-half ferritin and the C-half ferritin may vary depending on the embodiment.
  • the halves may divided at a point that corresponds to a position between about position 75 to about position 100 of SEQ ID NO:1.
  • an N-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 1-95 of SEQ ID NO:1 (or a substantial portion thereof), and a C-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 96-175 of SEQ ID NO:1 (or a substantial portion thereof).
  • the halves are divided at a point that corresponds to a position between about position 85 to about position 92 of SEQ ID NO:1.
  • an N-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 1-90 of SEQ ID NO:1 (or a substantial portion thereof), and a C-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 91-175 of SEQ ID NO:1 (or a substantial portion thereof).
  • the “N” region of apoferritin comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to: MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREG YERLLKMQNQRGGRALFQDIKKPAEDEW.
  • the “C” region of apoferritin comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to: GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNL HRLGGPEAGLGEYLFERLTLRHD or GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNL HRLGGPEAGLGEYLFERLTLKHD.
  • the fusion protein described herein further comprises a linker between the nanocage monomer subunit and the bioactive moiety, much like the linker described above.
  • the linker may be flexible or rigid, but it typically flexible to allow the bioactive moiety to retain activity and to allow the pairs of nanocage monomer subunits to retain self-assembly properties.
  • the linker is generally long enough to impart some flexibility to the fusion protein, although it will be understood that linker length will vary depending upon the nanocage monomer and bioactive moiety sequences and the three-dimensional conformation of the fusion protein.
  • the linker is typically from about 1 to about 30 amino acid residues, such as from about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29 to about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acid residues, such as from about 8 to about 16 amino acid residues, such as 8, 10, or 12 amino acid residues.
  • the linker may be of any amino acid sequence and, in one typical example, the linker comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats.
  • the linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to: GGGGSGGGGSGGGGSGGGGSGGGGSGG
  • the fusion protein may further comprising a C-terminal linker for improving one or more attributes of the fusion protein.
  • the comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats.
  • the C-terminal linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to: GGSGGSGGSGGSGGGSGGSGGSGGSG.
  • a pair of the fusion proteins described above wherein the pair self- assembles to form a nanocage monomer, wherein the first and second nanocage monomer subunits are fused to different SARS-CoV-2 binding moieties. This provides multivalency and/or multispecificity to a single nanocage monomer assembled from the pair of subunits.
  • a substantially identical sequence may comprise one or more conservative amino acid mutations.
  • one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered "substantially identical" polypeptides.
  • Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity).
  • a conservative mutation may be an amino acid substitution.
  • Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group.
  • basic amino acid hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH.
  • Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K).
  • neutral amino acid also “polar amino acid”
  • Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gln or Q).
  • hydrophobic amino acid also “non-polar amino acid” is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984).
  • Hydrophobic amino acids include proline (Pro or P), isoleucine (Ile or I), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G).
  • Acidic amino acid refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).
  • Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.
  • the substantially identical sequences of the present invention may be at least 85% identical; in another example, the substantially identical sequences may be at least 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% (or any percentage there between) identical at the amino acid level to sequences described herein. In specific aspects, the substantially identical sequences retain the activity and specificity of the reference sequence. In a non-limiting embodiment, the difference in sequence identity may be due to conservative amino acid mutation(s).
  • the polypeptides or fusion proteins of the present invention may also comprise additional sequences to aid in their expression, detection or purification. Any such sequences or tags known to those of skill in the art may be used.
  • the fusion proteins may comprise a targeting or signal sequence (for example, but not limited to ompA), a detection tag, exemplary tag cassettes include Strep tag, or any variant thereof; see, e.g., U.S.
  • Patent No.7,981,632 His tag, Flag tag having the sequence motif DYKDDDDK, Xpress tag, Avi tag, Calmodulin tag, Polyglutamate tag, HA tag, Myc tag, Nus tag, S tag, SBP tag, Softag 1, Softag 3, V5 tag, CREB-binding protein (CBP), glutathione S-transferase (GST), maltose binding protein (MBP), green fluorescent protein (GFP), Thioredoxin tag, or any combination thereof; a purification tag (for example, but not limited to a His5 or His6), or a combination thereof.
  • CBP CREB-binding protein
  • GST glutathione S-transferase
  • MBP maltose binding protein
  • GFP green fluorescent protein
  • Thioredoxin tag Thioredoxin tag
  • the additional sequence may be a biotin recognition site such as that described by Cronan et al in WO 95/04069 or Voges et al in WO/2004/076670.
  • linker sequences may be used in conjunction with the additional sequences or tags. More specifically, a tag cassette may comprise an extracellular component that can specifically bind to an antibody with high affinity or avidity.
  • a tag cassette may be located (a) immediately amino-terminal to a connector region, (b) interposed between and connecting linker modules, (c) immediately carboxy-terminal to a binding domain, (d) interposed between and connecting a binding domain (e.g., scFv or scFab) to an effector domain, (e) interposed between and connecting subunits of a binding domain, or (f) at the amino- terminus of a single chain fusion protein.
  • a binding domain e.g., scFv or scFab
  • one or more junction amino acids may be disposed between and connecting a tag cassette with a hydrophobic portion, or disposed between and connecting a tag cassette with a connector region, or disposed between and connecting a tag cassette with a linker module, or disposed between and connecting a tag cassette with a binding domain.
  • the solid surface may be any suitable surface, for example, but not limited to the well surface of a microtiter plate, channels of surface plasmon resonance (SPR) sensorchips, membranes, beads (such as magnetic-based or sepharose-based beads or other chromatography resin), glass, a film, or any other useful surface.
  • the fusion proteins may be linked to a cargo molecule; the fusion proteins may deliver the cargo molecule to a desired site and may be linked to the cargo molecule using any method known in the art (recombinant technology, chemical conjugation, chelation, etc.).
  • the cargo molecule may be any type of molecule, such as a therapeutic or diagnostic agent.
  • the cargo molecule is a protein and is fused to the fusion protein such that the cargo molecule is contained in the nanocage internally. In other aspects, the cargo molecule is not fused to the fusion protein and is contained in the nanocage internally.
  • the cargo molecule is typically a protein, a small molecule, a radioisotope, or a magnetic particle.
  • the fusion proteins described herein specifically bind to their targets. Antibody specificity, which refers to selective recognition of an antibody for a particular epitope of an antigen, of the antibodies or fragments described herein can be determined based on affinity and/or avidity.
  • Affinity represented by the equilibrium constant for the dissociation of an antigen with an antibody (KD) measures the binding strength between an antigenic determinant (epitope) and an antibody binding site.
  • Avidity is the measure of the strength of binding between an antibody with its antigen.
  • Antibodies typically bind with a KD of 10 -5 to 10 -11 M. Any KD greater than 10 -4 M is generally considered to indicate non-specific binding. The lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antibody binding site.
  • the antibodies described herein have a KD of less than 10 -4 M, 10 -5 M, 10 -6 M, 10 -7 M, 10 -8 M, 10 -9 M, 10 -10 M, 10 -11 M, 10 -12 M, 10 -13 M, 10 -14 M, or 10 -15 M.
  • nanocages comprising at least one fusion protein described herein and at least one second nanocage monomer subunit that self-assembles with the fusion protein to form a nanocage monomer.
  • pairs of the fusion proteins are described herein, wherein the pair self-assembles to form a nanocage monomer and wherein the first and second nanocage monomer subunits are fused to different bioactive moieties.
  • the nanocages may self-assemble from multiple identical fusion proteins, from multiple different fusion proteins (and therefore be multivalent and/or multispecific), from a combination of fusion proteins and wild-type proteins, and any combination thereof.
  • the nanocages may be decorated internally and/or externally with at least one of the fusion proteins described herein in combination with at least one anti-SARS-CoV-2 antibody.
  • from about 20% to about 80% of the nanocage monomers comprise the fusion protein described herein.
  • the nanocages could in theory comprise up to twice as many bioactive moieties as there are monomers in the nanocage, as each nanocage monomer may be divided into two subunits, each of which can independently bind to a different bioactive moiety.
  • this modularity can be harnessed to achieve any desired ratio of bioactive moieties as described herein in specific example to a 4:2:1:1 ratio of four different bioactive moieties.
  • the nanocages described herein may comprise at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different bioactive moieties. In this way, the nanocages can be multivalent and/or multispecific and the extent of this can be controlled with relative ease.
  • the nanocages described herein may further comprise at least one whole nanocage monomer, optionally fused to a bioactive moiety that may be the same or different from the bioactive moiety described herein as being linked to a nanocage monomer subunit.
  • the nanocages described herein comprise a first, second, and third fusion protein to a subunit or the monomer, and optionally at least one whole nanocage monomer, optionally fused to a bioactive moiety, wherein the bioactive moieties of the first, second, and third fusion proteins and of the whole nanocage monomer are all different from one another.
  • the first, second, and third fusion proteins each comprise an antibody or Fc fragment thereof fused to N- or C-half ferritin, wherein at least one of the first, second, and third fusion proteins is fused to N-half ferritin and at least one of the first, second, and third fusion proteins is fused to C-half ferritin.
  • the antibody or fragment thereof of the first fusion protein is typically an Fc fragment;
  • the second and third fusion proteins typically each comprise an antibody or fragment thereof specific for a different antigen of a virus such as SARS-CoV-2 and the whole nanocage monomer is fused to a bioactive moiety that is specific for another different antigen, optionally of the same virus such as SARS-CoV-2.
  • the antibody or fragment thereof of the second fusion protein is 46 or 52; and the antibody or fragment thereof of the third fusion protein is 324 or 80.
  • the nanocage described herein comprises the following four fusion proteins, optionally in a 4:2:1:1: ratio: a.298 (optionally sc298) fused to full length ferritin; b.
  • Fc (optionally scFc) fused to N-ferritin or C-ferritin; c.46 or 52 (optionally sc46 or sc52) fused to N-ferritin or C-ferritin; and d.324 or 80 (optionally sc324 or sc80) fused to N-ferritin or C-ferritin.
  • the nanocage described herein comprises or consists of sequences at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to one or more of the following sequences, where ferritin subunits are in bold, linkers are underlined, light chains are italicized, and heavy chains are in lowercase: a.298-hFerr: DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTRES GVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPPTFGQGTKLEIKRTVAAPSVFIFPPSDEQ LKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKV YACEVTHQGLSSPVTKSFNRGECGGGGSGGGGSGGGGSGGGGSGGGGGGSGGG
  • self-assembled polypeptide complexes comprise (1) a plurality of first fusion polypeptides, each first fusion polypeptide comprising an Fc region linked to a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer, or subunit thereof), as disclosed herein; and (2) a plurality of second fusion polypeptides, each second fusion polypeptide comprising a SARS-CoV-2-binding antibody fragment (e.g., a Fab fragment of an antibody that is capable of binding to SARS-CoV-2 protein (e.g., the Spike protein or a receptor- binding domain (RBD))), the SARS-CoV-2-binding antibody fragment being linked to a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer) or subunit thereof.
  • a nanocage monomer e.g., ferritin monomer, e.g., human ferritin monomer
  • self-assembled polypeptide complex further comprises a plurality of third fusion polypeptides, each third fusion polypeptide being distinct from the second fusion polypeptide and each comprising (1) a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer) linked to (2) a SARS-CoV-2-binding antibody fragment (e.g., Fab fragment of an antibody that is capable of binding to a SARS-CoV-2 protein).
  • a nanocage monomer e.g., ferritin monomer, e.g., human ferritin monomer
  • SARS-CoV-2-binding antibody fragment e.g., Fab fragment of an antibody that is capable of binding to a SARS-CoV-2 protein
  • one of the fusion polypeptides comprises an N-half nanocage monomer (e.g., an N-half ferritin) (but not a full-length nanocage (e.g., ferritin) monomer), and one of the other fusion polypeptides comprises a C-half nanocage monomer (e.g., a C-half ferritin) (but not a full-length nanocage (e.g., ferritin) monomer).
  • the ratio of fusion polypeptides comprising the N-half nanocage monomer (e.g., N-half ferritin) to the fusion polypeptides comprising the C-half nanocage monomer (e.g., C-half ferritin) within the self-assembled polypeptide complex is about 1:1.
  • the self-assembled polypeptide complex comprises 24 fusion polypeptides.
  • the self-assembled polypeptide complex comprises more than 24 fusion polypeptides, e.g., at least 26, at least 28, at least 30, at least 32 fusion polypeptides, at least 34 fusion polypeptides, at least 36 fusion polypeptides, at least 38 fusion polypeptides, at least 40 fusion polypeptides, at least 42 fusion polypeptides, at least 44 fusion polypeptides, at least 46 fusion polypeptides, or at least 48 fusion polypeptides.
  • the self-assembled polypeptide complex comprises 32 fusion polypeptides.
  • the self-assembled polypeptide complex comprises at least 4, at least 5, least 6, at least 7, or at least 8 first fusion polypeptides.
  • the self-assembled polypeptide complex comprises at least 4, at least 5, least 6, at least 7, or at least 8 second fusion polypeptides. In some embodiments, the self-assembled polypeptide complex further comprises at least 4, at least 5, least 6, at least 7, at least 8, at least 9, at least 10, least 11, at least 12, at least 13, at least 14, at least 15, or at least 16 third fusion polypeptides. In some embodiments, the self-assembled polypeptide complex comprises a ratio of approximately 1:1, 1:2, 1:3, or 1:4 of first fusion polypeptides to all other fusion polypeptides. In some embodiments, each fusion polypeptide within the self-assembled polypeptide complex comprises a ferritin light chain or a subunit of a ferritin light chain.
  • the self-assembled polypeptide complex does not comprise any ferritin heavy chains, subunits of ferritin heavy chains, or other ferritin components capable of binding to iron.
  • compositions comprising the nanocage, such as therapeutic or prophylactic compositions.
  • Related methods and uses for treating and/or preventing COVID-19 are also described, wherein the method or use comprises administering the nanocage or composition described herein to a subject in need thereof.
  • nucleic acid molecules encoding the fusion proteins and polypeptides described herein, as well as vectors comprising the nucleic acid molecules and host cells comprising the vectors.
  • Polynucleotides encoding the fusion proteins described herein include polynucleotides with nucleic acid sequences that are substantially the same as the nucleic acid sequences of the polynucleotides of the present invention. "Substantially the same" nucleic acid sequence is defined herein as a sequence with at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95% identity to another nucleic acid sequence when the two sequences are optimally aligned (with appropriate nucleotide insertions or deletions) and compared to determine exact matches of nucleotides between the two sequences.
  • Suitable sources of polynucleotides that encode fragments of antibodies include any cell, such as hybridomas and spleen cells, that express the full-length antibody.
  • the fragments may be used by themselves as antibody equivalents, or may be recombined into equivalents, as described above.
  • the DNA deletions and recombinations described in this section may be carried out by known methods, such as those described in the published patent applications listed above in the section entitled "Functional Equivalents of Antibodies" and/or other standard recombinant DNA techniques, such as those described below.
  • Another source of DNAs are single chain antibodies produced from a phage display library, as is known in the art.
  • expression vectors are provided containing the polynucleotide sequences previously described operably linked to an expression sequence, a promoter and an enhancer sequence.
  • a variety of expression vectors for the efficient synthesis of antibody polypeptide in prokaryotic, such as bacteria and eukaryotic systems, including but not limited to yeast and mammalian cell culture systems have been developed.
  • the vectors of the present invention can comprise segments of chromosomal, non-chromosomal and synthetic DNA sequences. Any suitable expression vector can be used.
  • prokaryotic cloning vectors include plasmids from E. coli, such as colEl, pCRl, pBR322, pMB9, pUC, pKSM, and RP4.
  • Prokaryotic vectors also include derivatives of phage DNA such as Ml3 and other filamentous single-stranded DNA phages.
  • An example of a vector useful in yeast is the 2 ⁇ plasmid.
  • Suitable vectors for expression in mammalian cells include well-known derivatives of SV-40, adenovirus, retrovirus-derived DNA sequences and shuttle vectors derived from combination of functional mammalian vectors, such as those described above, and functional plasmids and phage DNA. Additional eukaryotic expression vectors are known in the art (e.g., P J. Southern & P. Berg, J. Mol. Appl. Genet, 1:327-341 (1982); Subramani et al, Mol. Cell.
  • the expression vectors typically contain at least one expression control sequence that is operatively linked to the DNA sequence or fragment to be expressed.
  • the control sequence is inserted in the vector in order to control and to regulate the expression of the cloned DNA sequence.
  • Examples of useful expression control sequences are the lac system, the trp system, the tac system, the trc system, major operator and promoter regions of phage lambda, the control region of fd coat protein, the glycolytic promoters of yeast, e.g., the promoter for 3-phosphoglycerate kinase, the promoters of yeast acid phosphatase, e.g., Pho5, the promoters of the yeast alpha-mating factors, and promoters derived from polyoma, adenovirus, retrovirus, and simian virus, e.g., the early and late promoters or SV40, and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells and their viruses or combinations thereof.
  • fusion proteins described herein can be expressed in cell lines other than in hybridomas.
  • Nucleic acids which comprise a sequence encoding a polypeptide according to the invention, can be used for transformation of a suitable mammalian host cell.
  • Cell lines of particular preference are selected based on high level of expression, constitutive expression of protein of interest and minimal contamination from host proteins.
  • Mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines, such as but not limited to, HEK 293 cells, Chinese Hamster Ovary (CHO) cells, Baby Hamster Kidney (BHK) cells and many others.
  • Suitable additional eukaryotic cells include yeast and other fungi.
  • Useful prokaryotic hosts include, for example, E. coli, such as E. coli SG-936, E. coli HB 101, E. coli W3110, E. coli X1776, E. coli X2282, E. coli DHI, and E. coli MRC1, Pseudomonas, Bacillus, such as Bacillus subtilis, and Streptomyces.
  • E. coli such as E. coli SG-936, E. coli HB 101, E. coli W3110, E. coli X1776, E. coli X2282, E. coli DHI, and E. coli MRC1, Pseudomonas, Bacillus, such as Bacillus subtilis, and Streptomyces.
  • E. coli such as E. coli SG-936, E. coli HB 101, E. coli W3110, E. coli X1776, E. coli X2282, E. coli
  • Targeting of the expressed polypeptide for secretion in the recombinant host cells can be facilitated by inserting a signal or secretory leader peptide-encoding sequence (See, Shokri et al, (2003) Appl Microbiol Biotechnol.60(6): 654-664, Nielsen et al, Prot. Eng., 10:1-6 (1997); von Heinje et al., Nucl. Acids Res., 14:4683-4690 (1986), all of which are incorporated by reference herein) at the 5' end of the antibody-encoding gene of interest.
  • secretory leader peptide elements can be derived from either prokaryotic or eukaryotic sequences.
  • secretory leader peptides are used, being amino acids joined to the N-terminal end of a polypeptide to direct movement of the polypeptide out of the host cell cytosol and secretion into the medium.
  • the fusion proteins described herein can be fused to additional amino acid residues. Such amino acid residues can be a peptide tag to facilitate isolation, for example. Other amino acid residues for homing of the antibodies to specific organs or tissues are also contemplated. It will be understood that a Fab-nanocage can be generated by co-transfection of HC-ferritin and LC. Alternatively, single-chain Fab-ferritin nanocages can be used that only require transfection of one plasmid.
  • Tags e.g. Flag, HA, myc, His6x, Strep, etc.
  • a tag system can be used to make sure many different Fabs are present on the same nanoparticle using serial/additive affinity chromatography steps when different Fab-nanoparticle plasmids are co- transfected. This provides multi-specificity to the nanoparticles.
  • Protease sites e.g.
  • TEV, 3C, etc. can be inserted to cleave linkers and tags after expression and/or purification, if desired.
  • Any suitable method or route can be used to administer the fusion proteins described herein. Routes of administration include, for example, oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration. It is understood that the fusion proteins described herein, where used in a mammal for the purpose of prophylaxis or treatment, will be administered in the form of a composition additionally comprising a pharmaceutically acceptable carrier.
  • Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof.
  • compositions of the injection may, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
  • human antibodies are particularly useful for administration to humans, they may be administered to other mammals as well.
  • mammal as used herein is intended to include, but is not limited to, humans, laboratory animals, domestic pets and farm animals.
  • SARS-CoV-2-related condition refers to a condition (e.g., symptom or sign) that is associated with infection with SARS-CoV-2.
  • the condition is a level of SARS- CoV-2 RNA, protein, or viral particles in sample from a subject (e.g., the subject who is administered a self-assembled polypeptide complex as disclosed herein), which level is indicative of SARS-CoV-2 infection (e.g., because the level satisfies a threshold or exceeds a reference level indicative of SARS-CoV-2 infection).
  • the condition is a symptom associated with COVID-19 disease, e.g., fever, cough, tiredness, shortness of breath or difficulty breathing, muscle aches, chills, sore throat, runny nose, headache, chest pain, conjunctivitis, nausea, vomiting, diarrhea, loss of smell, loss of taste, or stroke).
  • compositions for administration to subjects generally comprise a self-assembled polypeptide complex as disclosed herein. In some embodiments, such compositions further comprise a pharmaceutically acceptable excipient. Compositions may be formulated for administration for any of a variety of routes of administration, including systemic routes (e.g., oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration).
  • systemic routes e.g., oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration.
  • Example 1 Multivalency transforms SARS-CoV-2 antibodies into ultrapotent neutralizers This example describes the design, expression, purification, and characterization of fusion proteins with apoferritin.
  • Apoferritin protomers self-assemble into an octahedrally symmetric structure with an ⁇ 6 nm hydrodynamic radius (Rh) composed of 24 identical polypeptides.
  • Rh hydrodynamic radius
  • the N-terminus of each apoferritin subunit points outwards of the spherical nanocage and is therefore accessible for the genetic fusion of proteins of interest.
  • the fusion proteins were designed such that upon folding, apoferritin protomers act as building blocks that drive the multimerization of the 24 proteins fused to the apoferritin termini.
  • Abstract SARS-CoV-2 the virus responsible for COVID-19, has caused a global pandemic. Antibodies can be powerful biotherapeutics to fight viral infections.
  • IC 50 half-maximal inhibitory concentration
  • the MULTi-specific, multi-Affinity antiBODY (Multabody or MB) platform thus uniquely leverages binding avidity together with multi-specificity to deliver ultrapotent and broad neutralizers against SARS-CoV-2.
  • the modularity of the platform also makes it relevant for rapid evaluation against other infectious diseases of global health importance. Neutralizing antibodies are a promising therapeutic for SARS-CoV-2. Introduction The continuous threat to public health from respiratory viruses such as the novel SARS-CoV- 2 underscores the urgent need to rapidly develop and deploy prophylactic and therapeutic interventions to combat pandemics.
  • mAbs Monoclonal antibodies
  • palivizumab for the prevention of respiratory syncytial virus in high-risk infants 1 or Zmapp
  • mAb114 Monoclonal antibodies
  • REGN-EB3 for the treatment of Ebola 2 .
  • mAbs targeting the Spike (S) protein of SARS-CoV-2 have been a focus for the development of biomedical countermeasures against COVID-19.
  • RNA viruses have higher mutations rates than DNA viruses and such mutations can significantly alter the potency of neutralizing antibodies. Indeed, several studies have already shown a reduction in neutralization potency from convalescent serum and resistance of certain mAbs 21,22,23 to the more recent B.1.1.7 24 , B.1.351 25 , and B.1.1.28 26,27 variants of SARS-CoV-2. Hence, there is an unmet need for the development of a platform that bridges antibody discovery and the rapid identification and deployment of highly potent neutralizers less susceptible to viral sequence variability.
  • the potency of an antibody is greatly affected by its ability to simultaneously interact multiple times with its epitope 28,29,30 .
  • This enhanced apparent affinity known as avidity
  • avidity has been previously reported to increase the neutralization potency of nanobodies 31,32 and of IgGs over Fabs 8,10,16 against SARS-CoV-2.
  • avidity To leverage the full power of binding avidity, we have developed an antibody-scaffold technology using the human apoferritin protomer as a modular subunit to multimerize antibody fragments and propel mAbs into ultrapotent neutralizers against SARS-CoV-2. Indeed, the resulting Multabody molecules can increase potency by up to four orders of magnitude over corresponding IgGs.
  • the Multabody offers a versatile IgG-like “plug-and-play” platform to enhance antiviral characteristics of mAbs against SARS-CoV-2, and demonstrates the power of avidity as a mechanism to be leveraged against viral pathogens.
  • Materials and Methods Protein expression and purification Genes encoding VHH-human apoferritin fusion, Fc fusions, Fabs, IgG, and RBD mutants were synthesized and cloned by GeneArt (Life Technologies) into the pcDNA3.4 expression vector.
  • Fabs and IgGs were transiently expressed by co-transfecting 90 ⁇ g of the LC and the HC in a 1:2 ratio and purified using KappaSelect affinity column (GE Healthcare) and HiTrap Protein A HP column (GE Healthcare), respectively with 100 mM glycine pH 2.2 as the elution buffer. Eluted fractions were immediately neutralized with 1 M Tris-HCl, pH 9.0, and further purified using a Superdex 200 Increase size exclusion column (GE Healthcare). Fc fusions of ACE2 and VHH-72 were purified the same way as IgGs.
  • VHH-72 apoferritin fusion was purified by hydrophobic interaction chromatography using a HiTrap Phenyl HP column and the eluted fraction was loaded onto a Superose 610/300 GL size exclusion column (GE Heathcare) in 20 mM sodium phosphate pH 8.0, 150 mM NaCl.
  • Wild type (BEI NR52309) and mutant RBDs, the prefusion S ectodomain (BEI NR52394) and Fc receptors (FcRn and Fc ⁇ RI) from mouse and human were purified using a HisTrap Ni-NTA column (GE Healthcare).
  • the C terminus of the Fab light chain is fused, through the linker, to the N terminus of the Fab heavy chain.
  • the two single Fc chains that form the functional homodimer Fc were fused in tandem.
  • the individual domains are fused to apoferritin monomers with a 25 amino acid linker: (GGGGS)x5.
  • Genes encoding scFab and scFc fragments linked to half apoferritin were generated by deletion of residues 1 to 90 (C-Ferritin) and 91 to 175 (N-Ferritin) of the light chain of human apoferritin.
  • Transient transfection of the Multabodies in HEK 293F cells were obtained by mixing 66 ⁇ g of the plasmids scFab-human apoferritin: scFc-human N-Ferritin: scFab-C-Ferritin in a 2:1:1 ratio. Addition of scFab- human apoferritin allowed efficient Multabody assembly and increased the number of Fab’s compared to Fc’s in the final molecule, thus favoring Fab avidity over Fc avidity.
  • Grids were imaged with a FEI Tecnai T20 electron microscope operating at 200 kV and equipped with an Orius charge-coupled device (CCD) camera (Gatan Inc).
  • CCD charge-coupled device
  • Biolayer interferometry Direct binding kinetics measurements were conducted using an Octet RED96 BLI system (Sartorius ForteBio) in PBS pH 7.4, 0.01% BSA, and 0.002% Tween at 25 °C. His-tagged RBD, SARS-CoV-2 Spike was loaded onto Ni-NTA (NTA) biosensors (Sartorius ForteBio) to reach a BLI signal response of 0.8 nm.
  • NTA Ni-NTA
  • Ni-NTA biosensors preloaded with His-tagged RBD were first dipped into wells containing the primary antibody at 50 ⁇ g/mL for 180 s. After a 30 s baseline period, the sensors were dipped into wells containing the second antibody at 50 ⁇ g/ml for an additional 300 s. All incubation steps were performed in PBS pH 7.4, 0.01% BSA, and 0.002% Tween at 25 °C. ACE2-Fc was used to map mAb binding to the receptor binding site. Dynamic light scattering The Rh of the Multabody was determined by dynamic light scattering (DLS) using a DynaPro Plate Reader III (Wyatt Technology).
  • Tagg was determined as the temperature at which 50% increase in the static light scattering at a 266 nm wavelength relative to baseline was observed (i.e., the maximum value of the differential curve). The average and the standard error of two independent measurements were calculated using the UNit analysis software.
  • Pharmacokinetics and immunogenicity A surrogate Multabody composed of the scFab and scFc fragments of mouse HD37 (anti- hCD19) IgG2a fused to the N-terminus of the light chain of mouse apoferritin (mFerritin) was used for the study.
  • L234A, L235A, and P329G (LALAP) mutations were introduced in the mouse IgG2a Fc-construct to silence effector functions of the Multabody 48 .
  • In vivo studies were performed using 12-week-old male C57BL/6 mice purchased from Charles River (Strain code: 027), housed in individually-vented cages under 12 h light/dark cycle (7 a.m./7 p.m.) at a temperature of 21–23 °C and a humidity of 40–55%. All procedures were approved by the Local Animal Care Committee at the University of Toronto Scarborough.
  • Nunc MaxiSorp plates (Biolegend) were coated with a 12-mer HD37 scFab-mFerritin or with the HpFerritin-PfCSP malaria peptide.1:100 sera dilution was incubated for 1 h at RT and further develop using HRP-ProteinA (Invitrogen) as a secondary molecule (dilution 1:10,000). The chemiluminescence signal at 450 nm was quantified using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments). Biodistribution Eight-week-old male BALB/c mice were purchased from The Jackson Laboratory and housed in individually-vented caging.
  • mice were housed 14 h of light/10 h dark with phased in dawn to dusk intensity, maximum at noon at a temperature of 20–21 °C and a humidity of 40–60%. All procedures were approved by the Local Animal Care Committee at the University of Toronto. Multabodies composed of the scFab and scFc fragments of mouse HD37 IgG2a fused to the N-terminus of mouse apoferritin light chain was used for this study.
  • HD37 IgG2a Multabody or control samples were fluorescently conjugated with Alexa-647 using Alexa Fluor TM 647 Antibody Labeling kit (Invitrogen) as per the manufacturer’s instruction.
  • mice were injected subcutaneously into the loose skin over the shoulders with ⁇ 5 mg/kg of the MB, HD37 IgG2a, or gold nanoparticles in 200 ⁇ L of PBS (pH 7.5) and imaged at time 0, 1 h, 6 h, 24 h, 2, 3, 4, 8, and 11 days following injection. Prior to imaging, mice were placed in an anesthesia induction chamber containing a mixture of isoflurane and oxygen for 1 min.
  • mice were then placed in the prone position at the center of a built-in heated docking system within the IVIS imaging system (maintained at 37 °C and supplied with a mixture of isoflurane and oxygen).
  • IVIS imaging system maintained at 37 °C and supplied with a mixture of isoflurane and oxygen.
  • mice were imaged for 1–2 s (excitation 640 nm and emission 680 nm) inside the imaging system. Data were analyzed using the IVIS software (Living Image Software for IVIS). After confirming the fluorescent signal from 2D epi-illumination images, 3D transilluminating fluorescence imaging tomography (FLIT) was performed on regions of interest using a built-in scan field of 3 ⁇ 3 or 3 ⁇ 4 transillumination positions.
  • FLIT 3D transilluminating fluorescence imaging tomography
  • a series of 2D fluorescent surface radiance images were taken at various transillumination positions using an excitation of 640 and 680 nm emission.
  • a series of CT scans were also taken at the corresponding positions.
  • a 3D distribution map of the fluorescent signal was reconstructed by combining fluorescent signal and CT scans. Resulting 3D fluorescent images were thresholded based on the 3D images of PBS injected mice taken at the corresponding body positions.
  • an RBD-Fc-Avi tag construct of the SARS-CoV-2 was expressed in the EXPi-293 mammalian expression system.
  • This protein was subsequently purified by protein G Dynabeads, biotinylated and quality-controlled for biotinylation and binding to ACE2 recombinant protein (Sino Biologics Inc).
  • the SuperHuman 2.0 Phage library (5 ⁇ 10 12 ) was heated for 10 min at 72 °C and de-selected against Protein G Dynabeads TM (Invitrogen), M-280 Streptavidin Dynabeads TM (Invitrogen), Histone from Calf Thymus (Sigma), Human IgG (Sigma) and ssDNA-Biotin NNK from Integrated DNA Technologies and DNA-Biotin NNK from Integrated DNA Technologies.
  • the library was panned against the RBD- captured by M-280 Streptavidin Dynabeads TM using an automated protocol on Kingfisher FLEX (Thermofisher).
  • Selected phages were acid eluted from the beads and neutralized using Tris-HCl pH 7.9 (Teknova).
  • the rescued phages were precipitated by PEG and subjected to three additional rounds of soluble-phase automated panning. PBST/1% BSA buffer and/or PBS/1% BSA was used in the de-selection, washes and selection rounds.
  • the chip surface was first activated by 10 min injection of a 1:1:1 (v/v/v) mixture of 0.4 M 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride (EDC), 0.1 M N-hydroxysulfosuccinimide (sNHS) and 0.1 M 2-(N- morpholino) ethanesulfonic acid (MES) pH 5.5. Then, 50 ⁇ g/ml of anti-V5 tag antibody prepared in 10 mM sodium acetate pH 4.3 was coupled for 14 min and the excess reactive esters were blocked with 1 M ethanolamine HCl pH 8.5 during a 10 min injection.
  • EDC 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride
  • sNHS N-hydroxysulfosuccinimide
  • MES 2-(N- morpholino) ethanesulfonic acid
  • a 384-ligand array comprising of crude bacterial periplasmic extracts (PPE) containing the scFvs (one spot per scFv) was prepared.
  • PPE crude bacterial periplasmic extracts
  • Each extract was prepared at a twofold dilution in running buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.01% (v/v) Tween-20 (HBSTE)) and printed on the anti-V5 surface for 15 min.
  • SARS-CoV-2 RBD Avi Tev His tagged was then prepared at 0, 3.7, 11.1, 33.3, 100, 37, and 300 nM in 10 mM HEPES pH 7.4, 150 mM NaCl, and 0.01% (v/v) Tween-20 (HBST) supplemented with 0.5 mg/ml BSA and injected as analyte for 5 min with a 15 min dissociation time. Samples were injected in ascending concentration without any regeneration step. Binding data from the local reference spots was used to subtracted signal from the active spots and the nearest buffer blank analyte responses were subtracted to double-reference the data.
  • the double-referenced data were fitted to a simple 1:1 Langmuir binding model in Carterra’s Kinetic Inspection Tool (version Oct. 2019). Twenty medium-affinity binders from phage display screening were selected for the present study. Pseudovirus production and neutralization SARS-CoV-2 pseudotyped viruses (PsV) were generated using an HIV-based lentiviral system 49 with few modifications.
  • 293T cells were co-transfected with a lentiviral backbone encoding the luciferase reporter gene (BEI NR52516), a plasmid expressing the Spike (BEI NR52310) and plasmids encoding the HIV structural and regulatory proteins Tat (BEI NR52518), Gag-pol (BEI NR52517), and Rev (BEI NR52519) using BioT transfection reagent (Bioland Scientific) and following the manufacturer’s instructions.24 h post transfection at 37 °C, 5 mM sodium butyrate was added to the media and the cells were incubated for an additional 24–30 h at 30 °C.
  • SARS-CoV-2 Spike mutant D614G was kindly provided by D.R. Burton (The Scripps Research Institute), SARS-COV-2 PsV variant B.1.351 was kindly provided by D.D. Ho (Columbia University) and the rest of the PsV mutants were generated using the KOD-Plus mutagenesis kit (Toyobo, Osaka, Japan) using primers described in Table 1.
  • PsV particles were harvested, passed through 0.45 ⁇ m pore sterile filters and finally concentrated using a 100 K Amicon (Merck Millipore Amicon-Ultra 2.0 Centrifugal Filter Units). Table 1.
  • the incubated volume was added to the cells and incubated for 48 h.
  • PsV neutralization was monitored by adding 50 ⁇ l Britelite plus reagent (PerkinElmer) to 50 ⁇ l of the cells and after 2 min incubation, the volume was transferred to a 96-well white plate (Sigma- Aldrich) and the luminescence in relative light units (RLUs) was measured using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments). Two to three biological replicates with two technical replicates each were performed.
  • IgG IC 50 fold increase was calculated as: IgG IC 50 ( ⁇ g/mL) / MB IC 50 ( ⁇ g/mL)
  • DMEM fetal calf serum
  • MB IC 50 fold increase was calculated as: IgG IC 50 ( ⁇ g/mL) / MB IC 50 ( ⁇ g/mL)
  • DMEM fetal calf serum
  • MB IC 50 ( ⁇ g/mL) Authentic virus neutralization VeroE6 cells were seeded in a 96 F plate at a concentration of 30,000/well in DMEM supplemented with 100 U Penicillin, 100 U Streptomycin, and 10% FBS. Cells were allowed to adhere to the plate and rest overnight. After 24 h, fivefold serial dilutions of the IgG and MB samples were prepared in DMEM supplemented with 100 U Penicillin and 100 U Streptomycin in a 96 R plate in quadruplicates (25 ⁇ L/well).
  • SARS-CoV-2/SB2-P4-PB 50 Clone 1 was added to each well at 100TCID/well and incubated for 1 h at 37 °C with shaking every 15 min. After co-culturing, the media from the VeroE6 plate was removed, and 50 ⁇ L antibody-virus sample was used to inoculate VeroE6 cells in quadruplicates for 1 h at 37 °C, 5% CO2, shaking every 15 min. After 1 h inoculation, the inoculum was removed and 200 ⁇ L of fresh DMEM supplemented with 100U Penicillin, 100U Streptomycin, and 2% FBS was added to each well. The plates were further incubated for 5 days.
  • CPE cytopathic effect
  • Templates generated from 2D classification during the cryoSPARC Live session were used for template selection of particles.2D classification was used to remove junk particle images, resulting in a dataset of 80,951 particle images for the Spike-Fab 80 complex, 203,138 particle images for the Spike-Fab 298 complex, 64,365 particle images for the Spike-Fab 324 complex, and 2,143,629 particle images for the RBD-Fab 46 complex. Multiple rounds of multi-class ab initio refinement were used to clean up the particle image stacks, and homogeneous refinement was used to obtain consensus structures. For tilted particles, particle polishing was done within Relion at this stage and reimported back into cryoSPARC.
  • a ternary complex of 52 Fab-298 Fab-RBD was obtained by mixing 200 ⁇ g of RBD with 2x molar excess of each Fab in 20 mM Tris pH 8.0, 150 mM NaCl, and subsequently purified via size exclusion chromatography (Superdex 200 Increase 10/300 GL, GE Healthcare). Fractions containing the complex were concentrated to 7.3 mg/ml and mixed in a 1:1 ratio with 20% (w/v) 2-propanol, 20% (w/v) PEG 4000, and 0.1 M sodium citrate pH 5.6. Crystals appeared after ⁇ 1 day and were cryoprotected in 10% (v/v) ethylene glycol before being flash-frozen in liquid nitrogen.
  • Phases were determined by molecular replacement using Phaser 61 with CNTO88 Fab as a model for 52 Fab (PDB ID: 4DN3), 20358 Fab as a model for 298 Fab (PDB ID: 5CZX), and PDB ID: 6XDG as a search model for the RBD.
  • Phaser 61 Phaser 61 with CNTO88 Fab as a model for 52 Fab (PDB ID: 4DN3), 20358 Fab as a model for 298 Fab (PDB ID: 5CZX), and PDB ID: 6XDG as a search model for the RBD.
  • Refinement of the structure was performed using phenix.refine 62 and iterations of manual building in Coot 63 .
  • PyMOL was utilized for structure analysis and figure rendering 64 . Access to all software was supported through SBGrid 65 .
  • FIG.2e Representative electron density for the two Fab-RBD interfaces is shown in Fig.2e, f.
  • Materials availability The electron microscopy maps have been deposited in the Electron Microscopy Data Bank (EMDB) with accession codes EMD-22738, EMD-22739, EMD-22740, and EMD-22741 (Table 2).
  • the crystal structure of the 298-52-RBD complex (Table 3) is available from the Protein Data Bank under accession PDB ID: 7K9Z.
  • the sequences of the monoclonal antibodies used are provided with this paper (Table 4). Additional PDB/EMDB entries were used throughout the manuscript to perform a comparative analysis of the different epitope bins targeted by mAbs.
  • the entries used in this analysis are: REGN10933 (PDB ID: 6XDG), CV30 (PDB ID: 6XE1), C105 (PDB ID: 6XCM), COVA2-04 (PDB ID: 7JMO), COVA2-39 (PDB ID: 7JMP), CC12.1 (PDB ID: 6XC2), BD23 (PDB ID: 7BYR), B38 (PDB ID: 7BZ5), P2C-1F11 (PDB ID: 7BWJ), 2-4 (PDB ID: 6XEY), CB6 (PDB ID: 7C01), REGN10987 (PDB ID: 6XDG), S309 (PDB ID: 6WPS, 6WPT), EY6A (PDB ID: 6ZCZ), CR3022 (PDB ID: 6YLA), H014 (PDB ID: 7CAH), 4-8 (EMDB ID: 22159), 4A8 (PDB ID: 7C2L), and 2-43 (EMDB ID: 22275).
  • VHH-72 has been previously described to neutralize SARS- CoV-2 when fused to a Fc domain, but not in its monovalent format 31 .
  • Fab is a hetero-dimer consisting of a light and a heavy chain
  • Fc is a homodimer
  • scFab single-chain Fab
  • scFc single-chain Fc
  • Binding kinetics showed that the resulting MB molecule binds mouse FcRn in a pH dependent manner—binding at endosomal pH (5.6) and no binding at physiological pH (7.4)—similar to the parental IgG (Fig.3a).
  • binding to the high-affinity mouse Fc ⁇ R1 was enhanced through avidity effects in comparison to the parental IgG.
  • Subcutaneous administration of MBs in C57BL/6 or BALB/c mice was well tolerated with no decrease in body weight or visible adverse events.
  • the MB showed favorable IgG-like serum half-life (Fig.3b), with a prolonged detectable titer in the sera for the lower Fc ⁇ R-binding MB (LALAP Fc sequence) compared to the WT MB, indicative of a role for the Fc in dictating in vivo bioavailability.
  • Live 2D and 3D-imaging revealed that the fluorescently-labeled MB biodistributed systemically like the corresponding IgG, without accumulation in any specific tissue (Fig.3c and Fig.4).
  • 15 nm gold nanoparticles (GNP) which have a similar Rh as MBs, rapidly disseminated from the site of injection (Fig.3c and Fig.4).
  • the surrogate mouse MB did not induce an anti-drug antibody response in mice (Fig.3d), thus further highlighting the IgG-like properties of the MB platform.
  • Protein engineering to achieve higher valency we aimed to generate fully- human MBs derived from the previously reported IgG BD23 12 and IgG 4A8 13 that target the SARS- CoV-2 spike RBD and N-terminal domain (NTD), respectively. Addition of scFcs into the MB reduces the number of scFabs that can be multimerized.
  • the apoferritin protomer In order to endow the MB platform with Fc without compromising Fab avidity and hence neutralization potency, we engineered the apoferritin protomer to accommodate more than 24 components per particle. Based on its four-helical bundle fold, the human apoferritin protomer was split into two halves: the two N-terminal ⁇ helices (N-Ferritin) and the two C-terminal ⁇ helices (C-Ferritin). In this configuration, the scFc fragment of human IgG1 and the scFab of anti-SARS-CoV-2 IgGs were genetically fused at the N terminus of each apoferritin half, respectively.
  • This split MB design forms 16 nm Rh spherical particles with an uninterrupted ring of density and regularly spaced protruding scFabs and scFc (Fig.5b, c).
  • the MB is on the lower size range of natural IgMs 34 , but packs more weight on a similar size to achieve high multi-valency.
  • Binding kinetics experiments demonstrated that high binding avidity of the MB for the Spike was preserved upon addition of Fc fragments (Fig.5d and Table 5). Binding to human Fc ⁇ RI and FcRn at both pH 5.6 and 7.4 confirmed that scFc was properly folded in the split MB design (Tables 6 and 7).
  • Binding of human MB to human Fc ⁇ RI and FcRn at endosomal pH confirmed that scFc was properly folded in the split MB design and that LALAP and I253A mutations lowered binding affinities to Fc ⁇ RI and FcRn, respectively.
  • Table 8. Kinetic constants and affinities to mouse FcRn of mouse Ferritin Multabodies derived from HD37 Antibody (IgG2a) targeting CD19 determined by BLI.
  • Table 9 Kinetic constants and affinities to mouse Fc ⁇ RI of mouse Ferritin Multabodies derived from HD37 Antibody (IgG2) targeting CD19 determined by BLI.
  • Table 10 Binding of human MB to human Fc ⁇ RI and FcRn at endosomal pH confirmed that scFc was properly folded in the split MB design and that LALAP and I253A mutations lowered binding affinities to Fc ⁇ RI and FcRn, respectively.
  • Table 8. Kinetic constants and affinities
  • mAbs were produced as full-length IgGs and MBs and their capacity to block viral infection was compared in a neutralization assay against SARS-CoV-2 PsV (Fig.6b and Fig.7a).
  • MB expression yields, homogeneity and thermostability was similar to those of the parental IgG (Fig.8 and Table 12) and the MB enhanced the potency of 18 out of 20 (90%) IgGs by up to four orders of magnitude (Table 13).
  • the largest increment was observed for mAb 298 which went from a mean IC 50 of ⁇ 0.3 ⁇ g/mL as an IgG to 0.0001 ⁇ g/mL as a MB.
  • Epitope mapping Based on their neutralization potency, seven mAbs were selected for further characterization: 298 (IGHV1-46/IGKV4-1), 82 (IGHV1-46/IGKV1-39), 46 (IGHV3-23/IGKV1-39), 324 (IGHV1- 69/IGKV1-39), 236 (IGHV1-69/IGKV2-28), 52 (IGHV1-69/IGKV1-39), and 80 (IGHV1-69/IGKV4-1) (Fig.6b and Table 4). Epitope binning experiments showed that these mAbs target two main sites on the RBD, with one of these bins overlapping with the ACE2 binding site (Fig.10a and Fig.11).
  • the crystal structure shows that Fab 298 binds almost exclusively to the ACE2 receptor binding motif (RBM) of the RBD (residues 438–506). In fact, out of 16 RBD residues involved in binding Fab 298, 12 are also involved in ACE2-RBD binding (Fig.2a–c and Table 14).
  • the RBM is stabilized by 11 hydrogen bonds from heavy and light chain residues of Fab 298.
  • RBM Phe486 is contacted by 11 Fab 298 residues burying ⁇ 170 ⁇ 2 (24% of the total buried surface area on RBD) and hence is central to the antibody–antigen interaction (Fig.2a and Table 14).
  • Mutation L452R decreased the sensitivity of the 46-MB and 52-MB but in contrast to their parental IgGs, they remained neutralizing against this PsV variant (Fig.13d).
  • the more infectious SARS-CoV-2 PsV variant D614G was neutralized with similar potency as the WT PsV for both IgGs and MBs (Fig.13c and Fig.14a).
  • MB cocktails consisting of three monospecific MBs resulted in pan-neutralization across all PsV variants without a significant loss in potency and hence achieved a 100–1000-fold higher potency compared to the corresponding IgG cocktails (Fig.13e and Fig.14c, d).
  • the MB format was able to increase the potency of these previously reported highly potent IgGs by a further one to two orders of magnitude against PsV and live replicating SARS-CoV-2 virus (Fig.13h), thus highlighting the plug-and-play nature of the MB and the ability of multivalency to enhance the neutralization capacity of mAbs across a range of potencies.
  • the values determined for median IC 50 of neutralization are summarized in Table 13 and Table 15.
  • the seven most potent MBs have IC 50 values of 0.2 to 2 ng/mL (9 ⁇ 10 ⁇ 14 to 9 ⁇ 10 ⁇ 13 M) against SARS-CoV-2 PsVs and therefore are, to our knowledge, within the most potent antibody-like molecules reported to date against SARS-CoV-2.
  • the MB platform was designed to include key favorable attributes from a developability perspective. First, the ability to augment antibody potency is independent of antibody sequence, format or epitope targeted.
  • the modularity and flexibility of the platform was exemplified by enhancing the potency of a VHH and multiple Fabs that target non-overlapping regions on two SARS-CoV-2 S sub-domains (RBD and NTD).
  • Using the MB to enhance the potency of VHH domains could provide particular value to this class of molecules since its small size allows highly efficient multimerization.
  • the split MB design allows combination of multiple antibody specificities within a single multimerized molecule resulting in similar potency and breadth as the MB cocktails.
  • the B.1.351 variant of concern that can escape the neutralization of several mAbs 21,22,23 is neutralized with high potency by a tri-specific Multabody, thus further highlighting the capacity of these molecules to resist viral escape.
  • Multi-specificity within the same particle could offer additional advantages such as intra-S avidity and synergy for the right combination of mAbs, setting the stage for further investigation of different combinations of mAb specificities on the MB. Avidity and multi-specificity could also be leveraged to deliver a single molecule that neutralizes potently across viral genera.
  • the MB platform provides a tool to surpass antibody affinity limits and generate broad and potent neutralizing molecules while by-passing extensive antibody discovery or engineering efforts.
  • This platform is an example of how binding avidity can be leveraged to accelerate the timeline to discovery of the most potent biologics against infectious diseases of global health importance.
  • Monoclonal antibodies have been used as antiviral therapeutics but have been limited in efficacy by viral sequence variability in emerging variants of concern (VOCs), and in deployment by the need for high doses.
  • mAbs Monoclonal antibodies
  • RSV respiratory syncytial virus
  • Ebola virus Ebola virus
  • FDA US Food and Drug Administration
  • the avid molecules GEN3009, INBRX-106(Inhibrx) and IGM- 8444 are being tested in Phase I/II clinical trials for the treatment of hematological and solid tumors, highlighting the clinical benefit of multivalent antibody-presenting formats.
  • a platform called the Multabody (MB) to increase neutralization potency of antibodies targeting SARS-CoV-2 and HIV-1.
  • MB Multabody
  • Dissociation rates were measured by dipping the biosensors into buffer- containing wells. The duration of each of these two steps was 180 s.
  • Fc characterization in the split Multabody design was assessed by measuring binding to hFc ⁇ RI and hFcRn. To probe the theoretical capacity of the Multabodies to undergo endosomal recycling, binding to the hFcRn ⁇ 2-microglobulin complex was measured at physiological (7.5) and endosomal (5.6) pH. In some cases, association of the Multabodies to the hFcRn ⁇ 2-microglobulin complex was done at pH 5.6 and dissociation was done at pH 7.4. Competition assays were performed in a two-step binding process.
  • Ni-NTA biosensors preloaded with His-tagged RBD were first dipped into wells containing the primary antibody at 50 ⁇ g/mL for 180 s. After a 30 s baseline period, the sensors were dipped into wells containing the second antibody at 50 ⁇ g/ml for an additional 300 s.
  • Virus production and pseudovirus neutralization assays SARS-CoV-2 pseudotyped viruses (PsV) were generated using an HIV-based lentiviral system as previously described with few modifications.
  • 293T cells were co-transfected with a lentiviral backbone encoding the luciferase reporter gene (BEI NR52516), a plasmid expressing the Spike (BEI NR52310) and plasmids encoding the HIV structural and regulatory proteins Tat (BEI NR52518), Gag-pol (BEI NR52517) and Rev (BEI NR52519).24 h post transfection at 37° C, 5 mM sodium butyrate was added to the media and the cells were incubated for an additional 24-30 h at 30° C. SARS-CoV-2 Spike mutant D614G was kindly provided by D.R.
  • SARS-CoV-2 spike variants of concern B.1.117, B.1.351, P.1 and B.1.617.2 were kindly provided by David Ho (Columbia).
  • Neutralization was determined in a single-cycle neutralization assay using 293T-ACE2 cells (BEI NR52511) and HeLa-ACE2 cells (kindly provided by D.R. Burton; The Scripps Research Institute).
  • PsV neutralization was monitored by adding Britelite plus reagent (PerkinElmer) to the cells and measuring luminescence in relative light units (RLUs) using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments). IC 50 fold increase was calculated as: IgGIC 50 ( ⁇ g/mL) / MBIC50 ( ⁇ g/mL). Two to three biological replicates with two technical replicates each were performed. Authentic virus neutralization assays VeroE6 cells were seeded in a 96F plate at a concentration of 30,000/well in DMEM supplemented with 100U Penicillin, 100U Streptomycin and 10% FBS. Cells were allowed to adhere to the plate and rest overnight.
  • THP-1 cells (ATCC, TIB-202) were maintained at fewer than 5 x 10 5 cells/mL and 5 x 10 4 cells/well in 200 ⁇ L were added to the immune complexes for 1 h at 37 °C + 5% CO2. Cells were washed and stained with Live Dead Fixable Violet stain (Invitrogen, L34995) according to the provided protocol before being washed and fixed with 1% PFA for 20 min at room temperature. Fixed cells were washed with FACS buffer (PBS + 10% FBS, 0.5 mM EDTA) and collected on an LSRII Flow Cytometer (BD Biosciences).
  • FACS buffer PBS + 10% FBS, 0.5 mM EDTA
  • SARS-CoV-2 challenge study 6-8-week old female hFcRn/hACE2 double transgenic mice were purchased from Jackson laboratories (stock # 034902). All procedures were approved by the Local Animal Care Committee at the University of Toronto.
  • Tri-specific 298-80-52 (T10) MBs or PGDM1400 negative control IgG were administered by intraperitoneal (i.p.) injection with a total of between 6-60 ⁇ g of MB or 60-180 ⁇ g of IgG one day prior to infection, depending on the experiment.24 h later, mice were infected with SARS-CoV-2/SB2-P4-PB Clone 1 at a dose of between 1x10 4 - 1x10 5 PFU / mouse. Mice were monitored daily for body weight until 12 days post infection.
  • samples were added to VeroE6 cells at a 1:10 serial dilution and allowed to infect for 1 h at 37 °C. Following infection, supernatants were removed, and the cells were replenished with 100 ⁇ L fresh media and allowed to incubate for 5 days. The cytopathic effect (CPE) was monitored, and PRISM was used to calculate ID50 values. Three technical replicates each were performed.
  • 96-well Pierce Nickel Coated Plates (Thermo Fisher) were coated with either 50 ⁇ L at 0.5 ⁇ g/ml of the His6x-tagged RBD antigen or His 6x -tagged BG505 to determine T10 MBs and PGDM1400 IgG levels, respectively.
  • HRP-ProteinA (Invitrogen) was used as a secondary molecule and the chemiluminescence signal was quantified using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments).
  • the tri-specific MB (298-52-80) sample was concentrated to 2.0 mg/mL and 3.0 ⁇ l of the sample was deposited on homemade holey gold grids, which were glow-discharged in air for 15 s before use. Sample was blotted for 3.0 s, and subsequently plunge-frozen in liquid ethane using a Leica EM GP2 Automatic Plunge Freezer (maintained at 4 °C and 100% humidity). Data collection was performed on a Thermo Fisher Scientific Titan Krios G3 operated at 300 kV with a Falcon 4i camera automated with the EPU software. A nominal magnification of 75,000 ⁇ and defocus range between 0.5 and 2.0 ⁇ m were used for data collection.
  • Exposures were collected for 8.3 s as movies of 30 frames with a camera exposure rate of ⁇ 6.3 e ⁇ per pixel per second, and total exposure of 49.6 electrons/ ⁇ 2 . A total of 4,385 raw movies were obtained. Image processing was carried out in cryoSPARC v3. Initial specimen movement correction, exposure weighting, and CTF parameters estimation were done using patch-based algorithms. Micrographs were sorted based on CTF fit resolution, and only micrographs with a fit better than 5.0 ⁇ were accepted for further processing. Manual picking was performed to create templates for template- based picking, which resulted in selection of 955,995 particle images. Particle images were sorted via several rounds of 2D classification, which resulted in selection of 358,036 particle images.
  • a preliminary 3D model was obtained ab-initio with no symmetry applied.
  • 151,443 particle images with CTF fit resolution better than 3.0 ⁇ were re- extracted from micrographs and subjected to non-uniform refinement 75 with no symmetry applied, which resulted in a 2.4 ⁇ resolution map of the tri-specific MB.65,478 particle images with CTF fit better than 2.7 ⁇ , were extracted from micrographs and subjected to non-uniform refinement with octahedral symmetry applied, which resulted in a 2.1 ⁇ resolution map.
  • Non-uniform refinements were performed with defocus refinement and optimization of per-group CTF parameters.
  • the pixel size was calibrated at 1.04 ⁇ per pixel by fitting a structure of human apoferritin light chain (PDB ID: 2FFX).
  • PDB ID: 2FFX human apoferritin light chain
  • the complex was purified by size exclusion chromatography (Superdex 200 Increase size exclusion column, GE Healthcare, Chicago, IL) in 20 mM Tris pH 8.0, 150 mM NaCl buffer. The fractions of interest were then concentrated to 10 mg/mL and crystallization trials were set up using the sitting drop vapor diffusion method with JCSG Top 96 screen in a 1:1 protein: reservoir ratio. Crystals appeared on day 70 in a condition containing 0.2 M di-ammonium tartrate and 20% (w/v) PEG 3350. Crystals were cryoprotected in 10% (v/v) ethylene glycol and flash- frozen in liquid nitrogen.
  • X-ray diffraction data was collected at the Argonne National Laboratory Advanced Photon Source on the 23-ID-D beamline. The data set was processed using XDS and XPREP. Phases were determined using Phaser with the 80 Fab predicted by ABodyBuilder and the SARS-CoV-2 RBD (PDB ID: 7LM8) as search models. Iterative refinement was performed using Phenix Refine and manual building was done in Coot. All software were accessed through SBGrid. Results Identification of sequence liability in mAb 52 in silico analysis of lead VH/VL sequences identified a deamidation site in the CDRL3 of mAb52 at position N92.
  • T10 MB Neutralization of T10 MB across variants of concern T10 MB was assessed for potency to WT SARS-CoV-2 and across the variants of concern (VOCs) in both pseudovirus and authentic virus neutralization assays.
  • VOCs variants of concern
  • T10 MB exhibited >1000-fold improvement in potency against WT SARS-CoV-2 relative to its corresponding IgG cocktail, and retained activity across the alpha, beta, gamma, delta and omicron (BA.1) PsVs.
  • the breadth and potency of the T10 MB was further evaluated in authentic virus neutralization assays, which confirmed the extremely potent nature of T10 MB across the VOCs tested ( Figure 18).
  • T10 Multabody Nomenclature To specifically assess the effect of neutralization potency on in vivo protection from lethal SARS-CoV-2 challenge, T10 MB and the corresponding IgG cocktail were generated with an IgG4 Fc containing mutations to ablate binding to Fc ⁇ receptors (S228P, F234A, L235A, G237A, P238S), hereafter referred to as MB* (or T10.A MB) and IgG4*, respectively. As expected, replacement of the Fc subtype from IgG1 to IgG4* did not affect the neutralization potency of the IgG or the MB, and, as previously reported.
  • IgG4 Fc containing mutations to ablate binding to Fc ⁇ receptors S228P, F234A, L235A, G237A, P238S
  • MB* or T10.A MB
  • replacement of the Fc subtype from IgG1 to IgG4* did not affect the neutralization potency of
  • the tri-specific MB* exhibited >1000-fold increase in potency relative to its corresponding cocktail IgG (Fig.19a). Binding kinetics studies revealed that both the tri-specific MB* and the IgG4* antibody cocktail displayed pH-dependent binding to mouse and human FcRn and no binding to human and mouse Fc ⁇ receptors (Figs.19b-c). This was in contrast to the Fc ⁇ R binding observed for the corresponding IgG1 antibody cocktail control (Fig.19c).
  • ADCP Antibody-dependent cell- mediated phagocytosis
  • hACE2 and hFcRn double transgenic mice were treated with 30 ⁇ g (1.5 mg/kg) of the Fc ⁇ R-binding deficient IgG4* and MB* molecules, one day prior to infection, and challenged intranasally with a high dose (1 x 10 5 TCID50) of SARS-CoV-2.
  • the tri- specific MB* provided significantly better protection (60% survival) compared to the IgG4* cocktail, with all cocktail-recipient animals succumbing to the challenge at D6-7 (Fig.19e).
  • IgG4 MB variants In order to endow the MB with a range of putative effector function properties in vivo, IgG4 based variants were generated with a range in binding profiles to human Fc ⁇ Rs using three sets of mutations.
  • FIG. 20a shows the binding profiles of these MBs to hFcRn, hFc ⁇ RI, hFc ⁇ RIIa and hFc ⁇ RIIb. While the binding of these MB variants to hFcRn was largely unchanged, there were significant differences observed in binding to Fc ⁇ Rs.
  • T10.A had no detectable binding to any Fc ⁇ Rs tested, and T10.G showed negligible binding even at the highest concentration tested.
  • removal of the G237A and P238S mutations in the T10.A MB to generate the T10.B MB restored binding for all three hFc ⁇ Rs tested.
  • Similar trends in binding to human FcRn and Fc ⁇ RI for T10.A, T10.B and T10.G were observed for Cyno FcRn and Fc ⁇ RI (Fig 20b).
  • T10.A, T10.B and T10.G all showed no detectable binding to mouse Fc ⁇ RI (Fig 20c).
  • T10.B and T10.G MBs were able to confer 75% survival at d12 compared to the negative IgG control, which had all mice succumb by d7 (Fig 21a).
  • In vivo protection was accompanied by both a reduction in body weight loss throughout the experiment in surviving mice (Fig 21b), as well as a lowering of viral titer in the lungs at the limit of detection of the assay from surviving mice at d12 (Fig 21c).
  • T10.G MB was subsequently tested for its ability to confer protection in hACE2 / hFcRn double transgenic mice which are homozygous for the hFcRn transgene (JAX #037043).
  • the results from this study show that T10.G MB was able to confer 75% protection, compared to the negative IgG control group which had all mice succumb to infection by d8 (Fig 22a).
  • In vivo protection was accompanied by a reduction in body weight loss throughout the experiment in surviving mice (Fig 22b).
  • T10.B MB Pharmacokinetic evaluation of T10.B MB in non-human primates (NHPs)
  • NHPs non-human primates
  • Fig 23 shows that T10.B MB achieves the expected maximum serum concentration (Cmax) and is detectable in circulation for weeks after dosing.
  • the apoferritin scaffold in the tri-specific MB is virtually identical to that of the human apoferritin light chain (PDB ID: 6WX6) with measured cross-correlation (cc) coefficients between maps of 0.97 (C1) and 0.92 (O).
  • the N and C termini of the core MB scaffold are similarly disposed in 3- and 4-fold symmetry axes as in the native human apoferritin light chain (Fig.24D), indicating minimal impact for scFab and scFc genetic fusions.
  • the cryoEM maps showed no evidence of deviation from the apoferritin fold for structural elements at the split design site (between residues Trp93 and Gly94; Fig.24D, bottom right panel).
  • mAb 80 inhibits SARS-CoV-2 infection through receptor blockade, preventing the interaction of ACE2 with the receptor binding motif (Fig.29A).
  • the heavy chain of mAb 80 is primarily responsible for the interaction with RBD, contributing ten of the eleven hydrogen bonds found in the binding interface (Fig.30A-B, Table 18). Additionally, interaction of F54 of the antibody heavy chain with Y489 from the RBD results in the formation of a new triple pi-stacking within the RBD structure, between residues Y473, F456 and Y421 (Fig.30C). Table 18.
  • Fab80-RBD contacting residues identified by PISA.
  • the potency of the 80 MB against Omicron BA.2 was additionally confirmed using replication- competent virus: as expected, considerably reduced potency against Omicron BA.2 live virus is observed for the 80 mAb, but high neutralization potency is retained in the MB format (Fig.29F). Discussion
  • the rapid emergence of new SARS-CoV-2 VOCs has stymied mAb therapeutics and driven antibody discovery efforts focused on expanding the breadth of viral sequences recognized by a single antibody.
  • the evidence that several FDA-authorized mAb therapies lost efficacy against the Omicron VOC supports the urgent need for new therapeutic interventions with improved breadth.
  • the MB platform offers multiple advantages as a next-generation multivalent biologic, including high stability, efficient assembly, ease of production and purification, and plug-and-play genetic fusion of antibodies of choice.
  • This structural technique has been useful for the characterization of large and complex biological designs such as subunit vaccines, including self-assembling protein nanoparticles presenting the ectodomains of influenza and RSV viral glycoprotein trimers, two-component protein nanoparticles displaying a stabilized HIV-1 Env trimer, or a COVID-19 vaccine candidate nanoparticle utilizing SpyCatcher multimerization of the SARS-CoV-2 spike protein RBD.
  • self-assembling protein nanoparticles presenting the ectodomains of influenza and RSV viral glycoprotein trimers
  • two-component protein nanoparticles displaying a stabilized HIV-1 Env trimer or a COVID-19 vaccine candidate nanoparticle utilizing SpyCatcher multimerization of the SARS-CoV-2 spike protein RBD.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pulmonology (AREA)
PCT/CA2022/051517 2021-10-16 2022-10-14 Modified multabody constructs, compositions, and methods targeting sars-cov-2 Ceased WO2023060359A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US18/701,187 US20250011397A1 (en) 2021-10-16 2022-10-14 Modified multabody constructs, compositions, and methods targeting sars-cov-2
CA3235530A CA3235530A1 (en) 2021-10-16 2022-10-14 Modified multabody constructs, compositions, and methods targeting sars-cov-2
JP2024522502A JP2024537398A (ja) 2021-10-16 2022-10-14 SARS-CoV-2を標的とする改変されたMultabody構築物、組成物、及び方法
EP22879729.6A EP4416189A4 (en) 2021-10-16 2022-10-14 MODIFIED MULTIBODY CONSTRUCTS, COMPOSITIONS AND METHODS TARGETING SARS-CoV-2

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163256565P 2021-10-16 2021-10-16
US63/256,565 2021-10-16

Publications (1)

Publication Number Publication Date
WO2023060359A1 true WO2023060359A1 (en) 2023-04-20

Family

ID=85987097

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2022/051517 Ceased WO2023060359A1 (en) 2021-10-16 2022-10-14 Modified multabody constructs, compositions, and methods targeting sars-cov-2

Country Status (5)

Country Link
US (1) US20250011397A1 (https=)
EP (1) EP4416189A4 (https=)
JP (1) JP2024537398A (https=)
CA (1) CA3235530A1 (https=)
WO (1) WO2023060359A1 (https=)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995004069A1 (en) 1993-07-30 1995-02-09 Affymax Technologies N.V. Biotinylation of proteins
WO2004076670A1 (en) 2003-02-28 2004-09-10 Roche Diagnostics Gmbh Enhanced expression of fusion polypeptides with a biotinylation tag
US7981632B2 (en) 2001-03-21 2011-07-19 Iba Gmbh Sequentially arranged streptavidin-binding modules as affinity tags
WO2021016724A1 (en) * 2019-08-01 2021-02-04 The Hospital For Sick Children Multi-valent and multi-specific nanoparticle platforms and methods
WO2022160057A1 (en) * 2021-01-28 2022-08-04 The Hospital For Sick Children Multabody constructs, compositions, and methods

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995004069A1 (en) 1993-07-30 1995-02-09 Affymax Technologies N.V. Biotinylation of proteins
US7981632B2 (en) 2001-03-21 2011-07-19 Iba Gmbh Sequentially arranged streptavidin-binding modules as affinity tags
WO2004076670A1 (en) 2003-02-28 2004-09-10 Roche Diagnostics Gmbh Enhanced expression of fusion polypeptides with a biotinylation tag
WO2021016724A1 (en) * 2019-08-01 2021-02-04 The Hospital For Sick Children Multi-valent and multi-specific nanoparticle platforms and methods
WO2022160057A1 (en) * 2021-01-28 2022-08-04 The Hospital For Sick Children Multabody constructs, compositions, and methods

Non-Patent Citations (26)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols", METHODS IN MOLECULAR BIOLOGY, vol. 66, 1996
"Molecular Biology and Biotechnology: a Comprehensive Desk Reference", 1995, VCH PUBLISHERS, INC.
AMON ET AL., ADV. EXP. MED. BIOL., vol. 303, 1991, pages 79 - 90
DIMICHELE DMHOOTS WKPIPE SWRIVARD GESANTAGOSTINO E: "International workshop on immune tolerance induction: consensus recommendations", HAEMOPHILIA, vol. 13, 2007, pages 1 - 22, XP072033923, DOI: 10.1111/j.1365-2516.2007.01497.x
GREENFIELD ET AL., CANCER RESEARCH, vol. 50, 1990, pages 6600 - 6607
IZARD ET AL., PNAS, vol. 96, 1999, pages 1240 - 1245
KAUFHIANNSHARP, MOL. CELL. BIOL, vol. 159, 1982, pages 601 - 664
KAUFINANNSHARP: "Amplification And Expression of Sequences Cotransfected with a Modular Dihydrofolate Reductase Complementary DNA Gene", J. MOL. BIOL, vol. 159, 1982, pages 601 - 621
KENDREW ET AL.: "Encyclopedia of Molecular Biology", 1994, OXFORD UNIVERSITY PRESS
KISELEVA ET AL., MOL. BIOL., vol. 25, 1991, pages 508 - 514
LIU RENA, OLDHAM ROBERT, TEAL EMMA, BEERS STEPHEN, CRAGG MARK: "Fc-Engineering for Modulated Effector Functions—Improving Antibodies for Cancer Treatment", ANTIBODIES, M D P I AG, CH, vol. 9, no. 4, 17 December 2020 (2020-12-17), CH , pages 64, XP055918764, ISSN: 2073-4468, DOI: 10.3390/antib9040064 *
NIELSEN ET AL., PROT. ENG., vol. 10, 1997, pages 1 - 6
P J. SOUTHERNP. BERG, J. MOL. APPL. GENET, vol. 1, 1982, pages 327 - 341
RUJAS EDURNE, KUCHARSKA IGA, TAN YONG ZI, BENLEKBIR SAMIR, CUI HONG, ZHAO TIANTIAN, WASNEY GREGORY A., BUDYLOWSKI PATRICK, GUVENC : "Multivalency transforms SARS-CoV-2 antibodies into ultrapotent neutralizers", NATURE COMMUNICATIONS, vol. 12, no. 1, 1 December 2021 (2021-12-01), XP055957964, DOI: 10.1038/s41467-021-23825-2 *
SAMBROOK, J.FRITSCH, E. FMANIATIS, T: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS
SCAHILL ET AL.: "Expression And Characterization Of The Product Of A Human Immune Interferon DNA Gene In Chinese Hamster Ovary Cells", PROC. NAT'1 ACAD. SCI USA, vol. 80, 1983, pages 4654 - 4659
SCHLOTHAUER, T. ET AL.: "Novel human IgGl and IgG4 Fc-engineered antibodies with completely abolished immune effector functions", PROTEIN ENGINEERING DESIGN AND SELECTION, vol. 29, no. 10, 1 October 2016 (2016-10-01), pages 457 - 66, XP055414310, ISSN: 1741-0134, DOI: 10.1093/protein/gzw040 *
See also references of EP4416189A4
SHOKRI ET AL., APPL MICROBIOL BIOTECHNOL., vol. 60, no. 6, 2003, pages 654 - 664
SUBRAMANI ET AL., MOL. CELL. BIOL, vol. 1, 1981, pages 854 - 864
SUTTER ET AL., NATURE STRUCT, AND MOL. BIOL., vol. 15, 2008, pages 939 - 947
URICH ET AL., SCIENCE, vol. 311, 2006, pages 996 - 1000
URLAUBCHASIN, PROC. NAT'L ACAD. SCI USA, vol. 77, 1980, pages 4216 - 4220
VON HEINJE ET AL., NUCL. ACIDS RES., vol. 14, 1986, pages 4683 - 4690
ZHANG ET AL., J. MOL. BIOL., vol. 306, 2001, pages 1099 - 1114
ZHANG, Y, INT. J. MOL. SCI., vol. 12, 2011, pages 5406 - 5421

Also Published As

Publication number Publication date
US20250011397A1 (en) 2025-01-09
CA3235530A1 (en) 2023-04-20
EP4416189A4 (en) 2025-08-27
EP4416189A1 (en) 2024-08-21
JP2024537398A (ja) 2024-10-10

Similar Documents

Publication Publication Date Title
US20250263469A1 (en) Polypeptides targeting sars-cov-2 and related compositions and methods
US10421803B2 (en) Broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 Env subunits
US20240317842A1 (en) Multabody constructs, compositions, and methods
Rujas et al. Multivalency transforms SARS-CoV-2 antibodies into broad and ultrapotent neutralizers
EP3784700A1 (en) High affinity monoclonal antibodies (mabs) against cell surface expressed human carbonic anhydrase ix (hca-ix), and uses thereof
US20240182544A1 (en) Polypeptides targeting dr4 and/or dr5 and related compositions and methods
US20250002564A1 (en) Modified multabody constructs, compositions, and methods
US20250011397A1 (en) Modified multabody constructs, compositions, and methods targeting sars-cov-2
WO2019023812A1 (en) VACCINE COMPOSITION AGAINST MALARIA AND METHOD THEREOF
CN116615255A (zh) 靶向SARS-CoV-2的多肽及相关组合物和方法
WO2020201992A1 (en) Antibody variants with ph-dependent antigen binding for selective targeting of solid tumors
WO2023111796A1 (en) Pan-specific sars-cov-2 antibodies and uses thereof
WO2024082067A1 (en) Multabody constructs, compositions, and methods targeting sarbecoviruses
EP4392064A2 (en) Engineered anti-her2 bispecific proteins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22879729

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2024522502

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 3235530

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2022879729

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022879729

Country of ref document: EP

Effective date: 20240516