WO2023044493A2 - Kras neoantigen therapies - Google Patents

Kras neoantigen therapies Download PDF

Info

Publication number
WO2023044493A2
WO2023044493A2 PCT/US2022/076680 US2022076680W WO2023044493A2 WO 2023044493 A2 WO2023044493 A2 WO 2023044493A2 US 2022076680 W US2022076680 W US 2022076680W WO 2023044493 A2 WO2023044493 A2 WO 2023044493A2
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
antigen
sequence
kras
epitope
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/076680
Other languages
English (en)
French (fr)
Other versions
WO2023044493A3 (en
Inventor
Raphael Rousseau
Karin Jooss
Christine Denise PALMER
Amy Rachel Rappaport
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gritstone Bio Inc
Original Assignee
Gritstone Bio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to IL311258A priority Critical patent/IL311258A/en
Priority to JP2024516894A priority patent/JP2024535855A/ja
Priority to KR1020247010184A priority patent/KR20240070547A/ko
Priority to CA3231297A priority patent/CA3231297A1/en
Priority to CN202280063132.1A priority patent/CN117957015A/zh
Priority to AU2022346048A priority patent/AU2022346048A1/en
Application filed by Gritstone Bio Inc filed Critical Gritstone Bio Inc
Priority to EP22871019.0A priority patent/EP4401766A4/en
Publication of WO2023044493A2 publication Critical patent/WO2023044493A2/en
Publication of WO2023044493A3 publication Critical patent/WO2023044493A3/en
Priority to US18/607,061 priority patent/US20240238397A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • A61K39/001164GTPases, e.g. Ras or Rho
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/64Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/82Colon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/852Pancreas
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/86Lung
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00

Definitions

  • a method for treating a subject with a disease wherein the disease is cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigenbased vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula: (E x -(E N n)y)z, wherein, E represents a nucleotide sequence a distinct epitopeencoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer
  • Also disclosed herein is a method for treating a subject with a disease, wherein the disease is cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence,
  • the epitope-encoding nucleic acid sequence is derived from a tumor of the subject with cancer or from a cell or sample of the infected subject. In some aspects, the epitope-encoding nucleic acid sequence are not derived from a tumor of the subject with cancer or from a cell or sample of the infected subject.
  • Also disclosed herein is a method for stimulating an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigenencoding nucleic acid sequence described, from 5’ to 3’, by the formula (E x -(E N n )y)z , wherein, E represents a nucleotide sequence comprisinga distinct epitope-encoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequence
  • a method for stimulating an immune response in a subject with cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigenencoding nucleic
  • the subject expresses at least one HLA allele predicted or known to present the at least one epitope sequence, optionally wherein the at least one epitope sequence predicted or known to be presented comprises the KRAS-associated MHC class I neoepitope.
  • the subject expresses at least one HLA allele predicted or known to present the at least one epitope sequence, and wherein the at least one epitope sequence comprises an epitope known or suspected to be presented by MHC class I on a surface of a cell, optionally wherein the at least one epitope sequence predicted or known to be presented comprises the KRAS- associated MHC class I neoepitope.
  • the surface of the cell is a tumor cell surface.
  • Also disclosed herein is a method for inducing an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigenencoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigenencoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula: (E x -(E N n)y)z wherein, E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences, n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any
  • a method for inducing an immune response in a subject with cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid
  • the antigen-based vaccine is administered as a priming dose. In some aspects, the antigen-based vaccine is administered as one or more boosting doses. In some aspects, the boosting dose is different than the priming dose. In some aspects a) the priming dose comprises a chimpanzee adenovirus vector and the boosting dose comprises an alphavirus vector; or b) the priming dose comprises an alphavirus vector and the boosting dose comprises a chimpanzee adenovirus vector. In some aspects, the boosting dose is the same as the priming dose. In some aspects, the injection site of the one or more boosting doses is as close as possible to the injection site of the priming dose.
  • the method further comprises determining or having determined the HLA-haplotype of the subject.
  • the antigen-based vaccine is administered intramuscularly (IM), intradermally (ID), subcutaneously (SC), or intravenously (IV).
  • the antigenbased vaccine is administered intramuscularly (IM).
  • the IM administration is administered at separate injection sites.
  • the separate injection sites are in opposing deltoid muscles.
  • the separate injection sites are in gluteus or rectus femoris sites on each side.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises any one of the amino acid sequence shown in SEQ ID NOs: 75- 82.
  • the antigen-encoding cassette comprises each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigen-encoding cassette comprises two or more iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82, optionally comprising 4 iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises the amino acid sequence shown in SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, or SEQ ID NO: 60.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a distinct KRAS- associated MHC class I neoepitope or a distinct KRAS mutation. In some aspects, each of the epitope-encoding nucleic acid sequences independently encodes a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • the epitope-encoding nucleic acid sequences independently encodes each of a KRAS G12C mutation, a KRAS G12V mutation, and a KRAS G12D mutation, and optionally a KRAS Q61H mutation.
  • the antigenencoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 64 or SEQ ID NO: 65.
  • the cassette does not encode an immunodominant MHC class I epitope that: (1) stimulates a 5-fold or greater immune response when administered in a vaccine composition to a subject relative to another MHC class I epitope encoded in the cassette and capable of stimulating an immune response in the subject, and/or (2) reduces an immune response to another MHC class I epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other MHC class I epitope is administered in the absence of the immunodominant MHC class I epitope, optionally wherein the immune response is reduced to below a limit of detection and/or wherein the immune response is not a therapeutically effective response.
  • the cancer comprises a solid tumor expressing a KRAS-associated and/or a NRAS-associated MHC class I neoepitope.
  • the KRAS-associated and/or the NRAS-associated MHC class I neoepitope comprises a mutation selected from the group consisting of: KRAS G12C, NRAS G12C, KRAS G12D, NRAS G12D, KRAS G12V, NRAS G12V, KRAS Q61H, and NRAS Q61H.
  • the cancer comprises colorectal cancer (CRC). In some aspects, the cancer comprises non-small cell lung cancer (NSCLC). In some aspects, the cancer comprises pancreatic ductal adenocarcinoma (PDA).
  • CRC colorectal cancer
  • NSCLC non-small cell lung cancer
  • PDA pancreatic ductal adenocarcinoma
  • the antigen-based vaccine or the one or more boosting doses is administered every 4 weeks (Q4W). In some aspects, the antigen-based vaccine or the one or more boosting doses is administered every 8 weeks (Q8W). In some aspects, the antigen-based vaccine or the one or more boosting doses is administered monthly. In some aspects, the antigenbased vaccine or the one or more boosting doses is administered every two months.
  • the method comprises administering to the subject a composition for delivery of a self-replicating alphavirus-based expression system and administering to the subject a composition for delivery of a chimpanzee adenovirus (ChAdV)-based expression system, and wherein the composition for delivery of the ChAdV-based expression system is administered as a priming dose and the composition for delivery of the self-replicating alphavirus-based expression system is administered as one or more boosting doses.
  • ChAdV chimpanzee adenovirus
  • two or more boosting doses are administered. In some aspects, 1, 2, 3, 4, 5, 6, 7, or 8 boosting doses are administered.
  • the ChAdV-based expression system is further administered as a boosting dose. In some aspects, the ChAdV-based boosting dose is only administered as a single boosting dose. In some aspects, the ChAdV-based expression system is administered as the boosting dose on or about day 140 after the priming dose of the ChAdV-based expression system. In some aspects, the ChAdV-based expression system is administered as the boosting dose on or about week 20 after the priming dose of the ChAdV-based expression system. In some aspects, the ChAdV-based expression system is administered as the boosting dose on or about month 5 after the priming dose of the ChAdV-based expression system.
  • the ChAdV-based expression system is administered as the boosting dose on or after day 140 after the priming dose of the ChAdV-based expression system. In some aspects, the ChAdV- based expression system is administered as the boosting dose on or after week 20 after the priming dose of the ChAdV-based expression system. In some aspects, the ChAdV-based expression system is administered as the boosting dose on or after month 5 after the priming dose of the ChAdV-based expression system.
  • the self-replicating alphavirus-based expression system is administered as at least two boosting doses. In some aspects, the self-replicating alphavirusbased expression system is administered as at least two or more boosting doses at least 28 days apart. In some aspects, the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 4 weeks (Q4W) apart. In some aspects, the selfreplicating alphavirus-based expression system is administered as at least two or more boosting doses at least one month apart. In some aspects, the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 56 days apart.
  • the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 8 weeks (Q8W) apart. In some aspects, the self-replicating alphavirus-based expression system is administered as at least two or more boosting doses at least 2 months apart. In some aspects, the self-replicating alphavirus-based expression system is administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system. In some aspects, the self-replicating alphavirus-based expression system is administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV-based expression system. In some aspects, the selfreplicating alphavirus-based expression system is administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.
  • the self-replicating alphavirus-based expression system is administered as at least four boosting doses. In some aspects, the self-replicating alphavirusbased expression system is administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system. In some aspects, the self-replicating alphavirus-based expression system is administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system. In some aspects, the self-replicating alphavirus-based expression system is administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.
  • the method further comprises administration of one or more immune modulators, optionally wherein the immune modulator is administered before, concurrently with, or after administration of the composition or pharmaceutical composition.
  • the one or more immune modulators are selected from the group consisting of: an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigen-binding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti-4-lBB antibody or an antigen-binding fragment thereof, or an anti-OX-40 antibody or an antigenbinding fragment thereof.
  • the immune modulator is administered intravenously (IV), intramuscularly (IM), intradermally (ID), or subcutaneously (SC).
  • the subcutaneous administration is near the site of the composition or pharmaceutical composition administration or in close proximity to one or more vector or composition draining lymph nodes.
  • the method comprises administration of an anti-CTLA-4 antibody or an antigen-binding fragment thereof only with the priming dose and the first boosting dose.
  • the anti-CTLA-4 antibody comprises ipilimumab. In some aspects, the ipilimumab is administered at a dose of 30 mg subcutaneously.
  • the method comprises administration of an anti-PD-Ll antibody or an antigen-binding fragment thereof every 4 weeks (Q4W), optionally comprising.
  • the anti-PD-Ll antibody comprises atezolizumab or nivolumab. In some aspects, the atezolizumab is administered at a dose of 1680 mg intravenously or the nivolumab is administered at a dose of 480 mg intravenously.
  • the method comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 administrations of one or more of the immune modulators. In some aspects, the method comprises at least 13 administrations of the anti-PD-Ll antibody. In some aspects, the one or more immune modulators are selected from the group consisting of: atezolizumab, nivolumamb, cemiplimab, and ipilimumab.
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12C mutation is selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), and GACGVGKSAL;
  • the KRAS- associated MHC class I neoepitope comprising a KRAS G12D mutation is selected from the group consisting of: VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV, and GADGVGKSAL;
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12V mutation is selected from the group consisting of: VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), and GAVGVGKSAL.
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12C mutation is selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), and GACGVGKSAL.
  • the KRAS- associated MHC class I neoepitope comprising a KRAS G12D mutation is selected from the group consisting of: VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV, and GADGVGKSAL.
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12V mutation is selected from the group consisting of: VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), and GAVGVGKSAL.
  • the stimulating the immune response comprises stimulating a molecular response.
  • the molecular response comprises a reduction in ctDNA.
  • the reduction in ctDNA is at least a 20%, at least a 30%, at least a 40%, or at least a 50% reduction in ctDNA.
  • the reduction in ctDNA is at least a 30% reduction in ctDNA.
  • the antigen-encoding cassette, or the polypeptide sequence encoded by the cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula:
  • E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including
  • the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E N , or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes a distinct KRAS-associated MHC class I neoepitope.
  • the antigen-encoding cassette encodes at least 4 iterations of each of the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises any one of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigenencoding cassette comprises each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigen-encoding cassette comprises two or more iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigen-encoding cassette comprises 4 iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises the amino acid sequence shown in SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, or SEQ ID NO: 60.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a distinct KRAS- associated MHC class I neoepitope or a distinct KRAS mutation.
  • each of the epitope-encoding nucleic acid sequences independently encodes a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation. In some aspects, the epitope-encoding nucleic acid sequences independently encodes each of a KRAS G12C mutation, a KRAS G12V mutation, and a KRAS G12D mutation, and optionally a KRAS Q61H mutation. In some aspects, the antigenencoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 64 or SEQ ID NO: 65. In some aspects, the antigen-encoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 65.
  • At least two of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encode distinct KRAS-associated MHC class I neoepitopes. In some aspects, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encode distinct KRAS-associated MHC class I neoepitopes. In some aspects, each of the distinct epitopeencoding nucleic acid sequences comprising the at least two iterations encode distinct KRAS- associated MHC class I neoepitopes.
  • one or more of the nucleic acid sequences encoding the KRAS-associated MHC class I neoepitopes comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 iterations. In some aspects, each of the nucleic acid sequences encoding the KRAS-associated MHC class I neoepitopes comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 iterations. In some aspects, one or more of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 4 iterations.
  • each of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 4 iterations.
  • one or more of the distinct KRAS-associated MHC class I neoepitopes independently comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • each N encodes an epitope 7-15 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the epitope, and wherein the 5’ linker sequence encodes a peptide that is at least 2 amino acids in length
  • L3 is a native 3’ linker sequence that encodes a native C-terminal amino acid sequence of the epitope, and wherein the 3’ linker sequence encodes a peptide that is at least 32amino acids in length.
  • the 5’ and/or 3’ linker sequence encodes a peptide that is at least 3 amino acids in length.
  • the 5’ and/or 3’ linker sequence encodes a peptide that is at least 4 amino acids in length. In some aspects, the 5’ and/or 3’ linker sequence encodes a peptide that is at least 5 amino acids in length. In some aspects, the 5’ and/or 3’ linker sequence encodes a peptide that is at least 8 amino acids in length. In some aspects, the 5’ and/or 3’ linker sequence encodes a peptide that is at least 2-8 amino acids in length. In some aspects, the 5’ and/or 3’ linker sequence encodes a peptide that is at least 2-10 amino acids in length.
  • each E and E N encodes an epitope at least 7 amino acids in length. In some aspects, each E and E N encodes an epitope 7-15 amino acids in length. In some aspects, each E and E N is a nucleotide sequence at least 21 nucleotides in length. In some aspects, each E and E N is a nucleotide sequence 75 nucleotides in length.
  • the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigenencoding nucleic acid sequence, comprising: (I) an epitope-encoding nucleic acid sequence encoding a KRAS-associated MHC class I neoepitope, and wherein each of the epitope-encoding nucleic acid sequences comprises; (A) optionally, a 5’ linker sequence, and (B) optionally, a 3’ linker sequence; (ii) optionally, a second promoter nucleotide sequence operably linked to the antigen-encoding nucleic acid sequence; and (iii) optionally, at least one MHC class II
  • the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 distinct epitope-encoding nucleic acid sequences linearly linked to each other wherein at least one of the distinct epitope-encoding nucleic acid sequences encodes a KRAS-associated MHC class I neoepitope, and wherein each of the epitope-encoding nucleic acid sequences comprises; (A) optionally, a 5’ linker sequence, and (B) optionally, a 3’ linker sequence; (ii) optionally, a second promoter nucle
  • the at least one antigen-encoding nucleic acid sequence comprises at least 3 distinct epitope-encoding nucleic acid sequences.
  • the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the vector backbone comprises a chimpanzee adenovirus vector, optionally wherein the chimpanzee adenovirus vector is a ChAdV68 vector, or an alphavirus vector, optionally wherein the alphavirus vector is a Venezuelan equine encephalitis virus vector; and (b) a cassette, optionally wherein the cassette is integrated between a native promoter nucleotide sequence native to the vector backbone and a poly(A) sequence, optionally wherein the poly(A) sequence is native to the vector backbone, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) an epitope-encoding nucleic acid sequence encoding a KRAS-associated MHC class I neoepitope, optionally comprising at least two distinct epitope-en
  • an ordered sequence of each element of the cassette is described in the formula, from 5’ to 3’, comprising:
  • N comprises one of the distinct epitope-encoding nucleic acid sequences
  • c 1
  • L5 comprises the 5’ linker sequence
  • b 0 or 1
  • L3 comprises the 3’ linker sequence
  • d 0 or 1
  • G5 comprises one of the at least one nucleic acid sequences encoding a GPGPG amino acid linker (SEQ ID NO:56)
  • e 0 or 1
  • G3 comprises one of the at least one nucleic acid sequences encoding a GPGPG amino acid linker (SEQ ID NO:56)
  • g 0 or 1
  • the corresponding Nc is a distinct epitope-encoding nucleic acid sequence, except for the Nc corresponding to the at least two iterations of the distinct epitope-encoding nucleic acid sequence.
  • the corresponding Uf is a distinct MHC class II epitope-encoding nucleic acid sequence.
  • the at least one promoter nucleotide sequence is a single native promoter nucleotide sequence native to the vector backbone
  • the at least one polyadenylation poly(A) sequence is a poly(A) sequence of at least 80 consecutive A nucleotides provided by the vector backbone
  • each N encodes an epitope 7-15 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the epitope, and wherein the 5’ linker sequence encodes a peptide that is at least 2 amino acids in length
  • L3 is a native 3’ linker sequence that encodes a native C-terminal amino acid sequence of the epitope
  • the 3’ linker sequence encodes a peptide that is at least 2 amino acids in length
  • U is each of a PADRE class II sequence
  • the antigen-encoding cassette encodes at least 4 iterations of each of the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises any one of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigenencoding cassette comprises each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigen-encoding cassette comprises two or more iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the antigen-encoding cassette comprises 4 iterations of each of the amino acid sequence shown in SEQ ID NOs: 75-82.
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises the amino acid sequence shown in SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, or SEQ ID NO: 60.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a distinct KRAS- associated MHC class I neoepitope or a distinct KRAS mutation.
  • each of the epitope-encoding nucleic acid sequences independently encodes a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation. In some aspects, the epitope-encoding nucleic acid sequences independently encodes each of a KRAS G12C mutation, a KRAS G12V mutation, and a KRAS G12D mutation, and optionally a KRAS Q61H mutation. In some aspects, the antigenencoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 64 or SEQ ID NO: 65. In some aspects, the antigen-encoding nucleic acid sequence encodes a peptide comprising the amino acid sequence shown in SEQ ID NO: 65.
  • the at least two iterations is at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 iterations. In some aspects, the at least two iterations is at least 8 iterations. In some aspects, the at least two iterations is at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, 1 at least 4, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 iterations. In some aspects, the at least two iterations is between 2-3, between 2-4, between 2-5, between 2-6, between 2-7 iterations, or between 2-8 iterations. In some aspects, the at least two iterations is 7 iterations or less, 6 iterations or less, 5 iterations or less, 4 iterations or less, or 3 iterations or less.
  • the at least one antigen-encoding nucleic acid sequence comprises at least two iterations of at least two distinct epitope-encoding nucleic acid sequences. In some aspects, the at least one antigen-encoding nucleic acid sequence comprises at least two iterations of at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 distinct epitope-encoding nucleic acid sequences. In some aspects, the at least two iterations are separated by at least one separate distinct epitope-encoding nucleic acid sequence. In some aspects, the at least two iterations are separated by at least 2 separate distinct epitope-encoding nucleic acid sequences. In some aspects, the at least two iterations, inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequence, are separated by at least 75 nucleotides.
  • the at least two iterations, inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequence are separated by at least 150 nucleotides, at least 300 nucleotides, or at least 675 nucleotides.
  • the at least two iterations, inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequence are separated by at least 50 nucleotides, at least 100 nucleotides, at least 200 nucleotides, at least 250 nucleotides, at least 350 nucleotides, at least 400 nucleotides, at least 450 nucleotides, at least 500 nucleotides, at least 700 nucleotides, at least 700 nucleotides, at least 750 nucleotides, at least 800 nucleotides, at least 900 nucleotides, or at least 1000 nucleotides.
  • the at least two iterations, inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequence are separated by at least 10 nucleotides, at least 15 nucleotides, at least 20 nucleotides, at least 25 nucleotides, at least 30 nucleotides, at least 35 nucleotides, at least 40 nucleotides, at least 45 nucleotides, at least 50 nucleotides, at least 55 nucleotides, at least 60 nucleotides, at least 65 nucleotides, or at least 70 nucleotides.
  • the at least one antigen-encoding nucleic acid sequence is described, from 5’ to 3’, by the formula:
  • E represents a nucleotide sequence comprising at least one of the distinct epitopeencoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including
  • the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E N , or a combination thereof.
  • the antigen-encoding cassette encodes at least 4 iterations of each of the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • the distinct epitope-encoding nucleic acid sequences comprises at least two distinct epitope-encoding nucleic acid sequences each encoding distinct KRAS- associated MHC class I neoepitopes. In some aspects, the distinct epitope-encoding nucleic acid sequences comprises at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 distinct epitope-encoding nucleic acid sequences each encoding distinct KRAS-associated MHC class I neoepitopes.
  • each of the epitope-encoding nucleic acid sequences of the at least one antigen-encoding nucleic acid sequence encodes a distinct KRAS-associated MHC class I neoepitope.
  • one or more of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 iterations.
  • each of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 iterations.
  • one or more of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 4 iterations. In some aspects, each of the nucleic acid sequences encoding the distinct KRAS-associated MHC class I neoepitopes comprises at least 4 iterations. In some aspects, one or more of the distinct KRAS-associated MHC class I neoepitopes independently comprises a KRAS G12C mutation, a KRAS G12V mutation, a KRAS G12D mutation, or a KRAS Q61H mutation.
  • the at least two iterations comprises a number of iterations, or z comprises a number, sufficient to stimulate a greater immune response relative to an antigenencoding nucleic acid sequence comprising a single iteration of the epitope-encoding nucleic acid sequence. In some aspects, the at least two iterations comprises a number of iterations, or z comprises a number, sufficient to stimulate an immune response, and a single iteration of the epitope-encoding nucleic acid sequence is insufficient to stimulate the immune response or insufficient to stimulate a detectable immune response.
  • the immune response is an expansion of epitope-specific T cells following in vivo immunization with the composition for delivery of the antigen expression system. In some aspects, the immune response is increased activation of epitope-specific T cells and/or increased epitope-specific killing by epitope-specific T cells following in vivo immunization with the composition for delivery of the antigen expression system.
  • compositions for delivery of an antigen expression system comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) at least two distinct epitope-encoding nucleic acid sequences, optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, optionally wherein the at least one alteration is a KRAS mutation, or (2) a nucleic acid sequence encoding an infectious disease organism peptide selected from the group consisting of: a path
  • compositions for delivery of an antigen expression system comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 distinct epitope-encoding nucleic acid sequences linearly linked to each other, optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, optionally wherein the at least one alteration is a KRAS mutation, or (2) a nucleic acid sequence encoding an infectious disease
  • At least one of the distinct epitope-encoding nucleic acid sequences encodes a KRAS-associated MHC class I neoepitope.
  • compositions for delivery of an antigen expression system comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the vector backbone comprises a chimpanzee adenovirus vector, optionally wherein the chimpanzee adenovirus vector is a ChAdV68 vector, or an alphavirus vector, optionally wherein the alphavirus vector is a Venezuelan equine encephalitis virus vector; and (b) a cassette, optionally wherein the cassette is integrated between a native promoter nucleotide sequence native to the vector backbone and a poly(A) sequence, optionally wherein the poly(A) sequence is native to the vector backbone, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence, comprising: (I) at least one epitope-encoding nucleic acid sequence, optionally comprising at least two distinct
  • the immunodominant MHC class I epitope stimulates a 10-fold, 20- fold, 30-fold, 40-fold, 50-fold, 100-fold, 200-fold, 300-fold, 400-fold, 500-fold, 1000-fold, 2000- fold, 3000-fold, 4000-fold, 5000-fold, or 10,000-fold or greater immune response when administered in a vaccine composition to a subject relative to another MHC class I epitope encoded in the cassette and capable of stimulating an immune response in the subject.
  • the immunodominant MHC class I epitope reduces the immune response of the other MHC class I epitope to below a limit of detection and/or does not stimulate a therapeutically effective response.
  • the subject expresses at least one HLA allele known or predicted to present both the immunodominant MHC class I epitope and the other MHC class I epitope encoded in the cassette.
  • one or more of the epitope-encoding nucleic acid sequences are derived from a tumor. In some aspects, each of the epitope-encoding nucleic acid sequences are derived from a tumor, an infection, or an infected cell of a subject. In some aspects, one or more of the epitope-encoding nucleic acid sequences are not derived from a tumor, an infection, or an infected cell of a subject. In some aspects, each of the epitope-encoding nucleic acid sequences are not derived from a tumor, an infection, or an infected cell of a subject.
  • the epitope-encoding nucleic acid sequence encodes an epitope known or suspected to be presented by MHC class I on a surface of a cell, optionally wherein the surface of the cell is a tumor cell surface or an infected cell surface, and optionally wherein the cell is a subject’s cell.
  • the cell is a tumor cell selected from the group consisting of: lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B- cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer, or wherein the cell is an infected cell selected from the group consisting of: a pathogen infected cell, a virally infected cell, a bacterially infected cell, a fungally infected cell, and a parasitically infected cell.
  • lung cancer melanoma
  • breast cancer ovarian cancer
  • prostate cancer kidney cancer
  • gastric cancer colon cancer
  • testicular cancer head and neck cancer
  • pancreatic cancer brain cancer
  • B- cell lymphoma acute myelogen
  • the virally infected cell is selected from the group consisting of: an HIV infected cell, a Severe acute respiratory syndrome-related coronavirus (SARS) infected cell, a severe acute respiratory syndrome coronavirus 2 (SARS- CoV-2) infected cell, a Ebola infected cell, a Hepatitis B virus (HBV) infected cell, an influenza infected cell, an orthymyxoviridae family virus infected cell, a Human papillomavirus (HPV) infected cell, a Cytomegalovirus (CMV) infected cell, a Chikungunya virus infected cell, a Respiratory syncytial virus (RSV) infected cell, a Dengue virus infected cell, and a Hepatitis C virus (HCV) infected cell.
  • SARS Severe acute respiratory syndrome-related coronavirus
  • SARS- CoV-2 severe acute respiratory syndrome coronavirus 2
  • the composition further comprises a nanoparticulate delivery vehicle.
  • the nanoparticulate delivery vehicle is a lipid nanoparticle (LNP).
  • the LNP comprises ionizable amino lipids.
  • the ionizable amino lipids comprise MC3-like (dilinoleylmethyl-4-dimethylaminobutyrate) molecules.
  • the nanoparticulate delivery vehicle encapsulates the antigen expression system.
  • the cassette is integrated between the at least one promoter nucleotide sequence and the at least one poly(A) sequence.
  • the second promoter is absent and the at least one promoter nucleotide sequence is operably linked to the antigenencoding nucleic acid sequence.
  • the one or more vectors comprise one or more +-stranded RNA vectors.
  • the one or more +-stranded RNA vectors comprise a 5’ 7- methylguanosine (m7g) cap.
  • the one or more +-stranded RNA vectors are produced by in vitro transcription.
  • the one or more vectors are self-replicating within a mammalian cell.
  • the backbone comprises at least one nucleotide sequence of an Aura virus, a Fort Morgan virus, a Venezuelan equine encephalitis virus, a Ross River virus, a Semliki Forest virus, a Sindbis virus, or a Mayaro virus.
  • the backbone comprises at least one nucleotide sequence of a Venezuelan equine encephalitis virus. In some aspects, the backbone comprises at least sequences for nonstructural protein-mediated amplification, a 26S promoter sequence, a poly(A) sequence, a nonstructural protein 1 (nsPl) gene, a nsP2 gene, a nsP3 gene, and a nsP4 gene encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • nsPl nonstructural protein 1
  • the backbone comprises at least sequences for nonstructural protein-mediated amplification, a 26S promoter sequence, and a poly(A) sequence encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • sequences for nonstructural protein-mediated amplification are selected from the group consisting of: an alphavirus 5’ UTR, a 51-nt CSE, a 24-nt CSE, a 26S subgenomic promoter sequence, a 19-nt CSE, an alphavirus 3’ UTR, or combinations thereof.
  • the backbone does not encode structural virion proteins capsid, E2 and El.
  • the cassette is inserted in place of structural virion proteins within the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • the Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5. In some aspects, the Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5 further comprising a deletion between base pair 7544 and 11175.
  • the backbone comprises the sequence set forth in SEQ ID NO:6 or SEQ ID NO:7. In some aspects, the cassette is inserted at position 7544 to replace the deletion between base pairs 7544 and 11175 as set forth in the sequence of SEQ ID NO:3 or SEQ ID NO:5.
  • the insertion of the cassette provides for transcription of a polycistronic RNA comprising the nsPl-4 genes and the at least one antigen-encoding nucleic acid sequence, wherein the nsPl-4 genes and the at least one antigen-encoding nucleic acid sequence are in separate open reading frames.
  • the backbone comprises at least one nucleotide sequence of a chimpanzee adenovirus vector.
  • the chimpanzee adenovirus vector is a ChAdV68 vector.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising the sequence set forth in SEQ ID NO: 1.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising the sequence set forth in SEQ ID NO: 1, except that the sequence is fully deleted or functionally deleted in at least one gene selected from the group consisting of the chimpanzee adenovirus E1A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4, and L5 genes of the sequence set forth in SEQ ID NO: 1, optionally wherein the sequence is fully deleted or functionally deleted in: (1) El A and E1B; (2) El A, E1B, and E3; or (3) El A, E1B, E3, and E4 of the sequence set forth in SEQ ID NO: 1.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising a partially deleted E4 gene comprising a deleted or partially-deleted E4orf2 region and a deleted or partially-deleted E4orf3 region, and optionally a deleted or partially-deleted E4orf4 region.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising the sequence set forth in SEQ ID NO:68, optionally wherein the antigen cassette is inserted within the El deletion.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising one or more deletions between base pair number 577 and 3403 or between base pair 456 and 3014, and optionally wherein the vector further comprises one or more deletions between base pair 27,125 and 31,825 or between base pair 27,816 and 31,333 of the sequence set forth in SEQ ID NO: 1.
  • the ChAdV68 vector comprises a ChAdV68 vector backbone comprising one or more deletions between base pair number 3957 and 10346, base pair number 21787 and 23370, and base pair number 33486 and 36193 of the sequence set forth in SEQ ID NO: 1.
  • the cassette is inserted in the ChAdV vector backbone at the El region, E3 region, and/or any deleted AdV region that allows incorporation of the cassette.
  • the at least one promoter nucleotide sequence is the native 26S promoter nucleotide sequence encoded by the backbone. In some aspects, the at least one promoter nucleotide sequence is an exogenous RNA promoter. In some aspects, the second promoter nucleotide sequence is a 26S promoter nucleotide sequence. In some aspects, the second promoter nucleotide sequence comprises multiple 26S promoter nucleotide sequences, wherein each 26S promoter nucleotide sequence provides for transcription of one or more of the separate open reading frames.
  • the one or more vectors are each at least 300nt in size. In some aspects, the one or more vectors are each at least Ikb in size. In some aspects, the one or more vectors are each 2kb in size. In some aspects, the one or more vectors are each less than 5kb in size.
  • At least one of the at least one antigen-encoding nucleic acid sequences encodes a polypeptide sequence or portion thereof that is presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • each epitope-encoding nucleic acid sequence is linked directly to one another.
  • at least one of the epitope-encoding nucleic acid sequences is linked to a distinct epitope-encoding nucleic acid sequence with a nucleic acid sequence encoding a linker.
  • the linker links two MHC class I sequences or an MHC class I sequence to an MHC class II sequence.
  • the linker is selected from the group consisting of: (1) consecutive glycine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (2) consecutive alanine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (3) two arginine residues (RR); (4) alanine, alanine, tyrosine (AAY); (5) a consensus sequence at least 2, 3, 4, 5, 6, 7, 8 , 9, or 10 amino acid residues in length that is processed efficiently by a mammalian proteasome; and (6) one or more native sequences flanking the antigen derived from the cognate protein of origin and that is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 2-20 amino acid residues in length.
  • the linker links two MHC class II sequences or an MHC class II sequence to an MHC class I sequence.
  • the linker comprises the sequence GPGPG (SEQ ID NO:56).
  • at least one sequence of the epitope-encoding nucleic acid sequences is linked, operably or directly, to a separate or contiguous sequence that enhances the expression, stability, cell trafficking, processing and presentation, and/or immunogenicity of the epitope-encoding nucleic acid sequences of epitope encoded therefrom.
  • the separate or contiguous sequence comprises at least one of: a ubiquitin sequence, a ubiquitin sequence modified to increase proteasome targeting (e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76), an immunoglobulin signal sequence (e.g., IgK), a major histocompatibility class I sequence, lysosomal -associated membrane protein (LAMP)-l, human dendritic cell lysosomal-associated membrane protein, and a major histocompatibility class II sequence; optionally wherein the ubiquitin sequence modified to increase proteasome targeting is A76.
  • a ubiquitin sequence e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76
  • an immunoglobulin signal sequence e.g., IgK
  • a major histocompatibility class I sequence e.g., lysosomal -associated membrane protein (LAMP)-l, human dendritic cell
  • At least one of the epitope-encoding nucleic acid sequences encodes a polypeptide sequence or portion thereof that has increased binding affinity to its corresponding MHC allele relative to the translated, corresponding wild-type nucleic acid sequence. In some aspects, at least one of the epitope-encoding nucleic acid sequences encodes a polypeptide sequence or portion thereof that has increased binding stability to its corresponding MHC allele relative to the translated, corresponding wild-type nucleic acid sequence. In some aspects, at least one of the epitope-encoding nucleic acid sequences encodes a polypeptide sequence or portion thereof that has an increased likelihood of presentation on its corresponding MHC allele relative to the translated, corresponding wild-type nucleic acid sequence.
  • the at least one alteration comprises a point mutation, a frameshift mutation, a non-frameshift mutation, a deletion mutation, an insertion mutation, a splice variant, a genomic rearrangement, or a proteasome-generated spliced antigen.
  • the tumor is selected from the group consisting of: lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, bladder cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, adult acute lymphoblastic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer, or the infectious disease organism is selected from the group consisting of: Severe acute respiratory syndrome-related coronavirus (SARS), severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), Ebola, HIV, Hepatitis B virus (HBV), influenza, Hepatitis C virus (HCV), Human papillomavirus (HPV), Cytomegalovirus (CMV), Chikungunya virus, Respiratory syncytial
  • SARS Severe
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 epitope-encoding nucleic acid sequences. In some aspects, the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 epitope-encoding nucleic acid sequences.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-400 epitope-encoding nucleic acid sequences and wherein at least two of the epitope-encoding nucleic acid sequences encode polypeptide sequences or portions thereof that are presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 antigen-encoding nucleic acid sequences.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 antigen-encoding nucleic acid sequences.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-400 antigen-encoding nucleic acid sequences and wherein at least two of the antigen-encoding nucleic acid sequences encode polypeptide sequences or portions thereof that are presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • at least two of the epitope-encoding nucleic acid sequences encode polypeptide sequences or portions thereof that are presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • At least one of the epitopes encoded by the epitope-encoding nucleic acid sequences are presented on antigen presenting cells resulting in an immune response targeting at least one of the antigens on the tumor cell surface or the infected cell surface.
  • the at least one antigen-encoding nucleic acid sequences when administered to the subject and translated, at least one of the MHC class I or class II epitopes are presented on antigen presenting cells resulting in an immune response targeting at least one of the epitopes on a tumor cell surface or the infected cell surface, and optionally wherein the expression of each of the at least one antigen-encoding nucleic acid sequences is driven by the at least one promoter nucleotide sequence.
  • each epitope-encoding nucleic acid sequence encodes a polypeptide sequence between 8 and 35 amino acids in length, optionally 9-17, 9-25, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34 or 35 amino acids in length.
  • the at least one MHC class II epitope-encoding nucleic acid sequence is present and comprises at least one universal MHC class II antigen-encoding nucleic acid sequence, optionally wherein the at least one universal sequence comprises at least one of Tetanus toxoid and PADRE.
  • the at least one poly(A) sequence comprises a poly(A) sequence native to the backbone. In some aspects, the at least one poly(A) sequence comprises a poly(A) sequence exogenous to the backbone. In some aspects, the at least one poly(A) sequence is operably linked to at least one of the at least one antigen-encoding nucleic acid sequences. In some aspects, the at least one poly(A) sequence is at least 20 , at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100 consecutive A nucleotides. In some aspects, the at least one poly(A) sequence is at least 80 consecutive A nucleotides.
  • the cassette further comprises at least one of: an intron sequence, a woodchuck hepatitis virus posttranscriptional regulatory element (WPRE) sequence, an internal ribosome entry sequence (IRES) sequence, a nucleotide sequence encoding a 2A self-cleaving peptide sequence, a nucleotide sequence encoding a Furin cleavage site, or a sequence in the 5’ or 3’ non-coding region known to enhance the nuclear export, stability, or translation efficiency of mRNA that is operably linked to at least one of the at least one antigen-encoding nucleic acid sequences.
  • WPRE woodchuck hepatitis virus posttranscriptional regulatory element
  • IVS internal ribosome entry sequence
  • the one or more vectors further comprises one or more nucleic acid sequences encoding at least one immune modulator.
  • the immune modulator is an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigen-binding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti-4-lBB antibody or an antigen-binding fragment thereof, or an anti-OX-40 antibody or an antigen-binding fragment thereof.
  • each of the epitope-encoding nucleic acid sequences is selected by performing the steps of: (a) obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data is used to obtain data representing peptide sequences of each of a set of antigens; (b) inputting the peptide sequence of each antigen into a presentation model to generate a set of numerical likelihoods that each of the antigens is presented by one or more of the MHC alleles on a cell surface, optionally a tumor cell surface or an infected cell surface, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and (c) selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens which are used to generate the at least 20 epitope-encoding nucleic acid sequences.
  • each of the MHC class I epitopes is predicted or validated to be capable of presentation by at least one HLA allele present in at least 5% of a population. In some aspects, each of the MHC class I epitopes is predicted or validated to be capable of presentation by at least one HLA allele, wherein each antigen/HLA pair has an antigen/HLA prevalence of at least 0.01% in a population. In some aspects, each of the MHC class I epitopes is predicted or validated to be capable of presentation by at least one HLA allele, wherein each antigen/HLA pair has an antigen/HLA prevalence of at least 0.1% in a population.
  • the cassette does not encode a non-therapeutic MHC class I or class II epitope nucleic acid sequence comprising a translated, wild-type nucleic acid sequence, wherein the non-therapeutic epitope is predicted to be displayed on an MHC allele of the subject.
  • the non-therapeutic predicted MHC class I or class II epitope sequence is a junctional epitope sequence formed by adjacent sequences in the cassette.
  • an order of the at least one antigen-encoding nucleic acid sequences in the cassette is determined by a series of steps comprising: (a) generating a set of candidate cassette sequences corresponding to different orders of the at least one antigen-encoding nucleic acid sequences; (b) determining, for each candidate cassette sequence, a presentation score based on presentation of non-therapeutic epitopes in the candidate cassette sequence; and (c) selecting a candidate cassette sequence associated with a presentation score below a predetermined threshold as the cassette sequence for an antigen vaccine.
  • compositions comprising any of the compositions described herein and a pharmaceutically acceptable carrier.
  • the composition further comprises an adjuvant.
  • the composition further comprises an immune modulator.
  • the immune modulator is an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigen-binding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti-4-lBB antibody or an antigen-binding fragment thereof, or an anti-OX-40 antibody or an antigen-binding fragment thereof.
  • the sequence or set of isolated nucleotide sequences comprises the cassette of any of the above composition claims inserted at position 7544 of the sequence set forth in SEQ ID NO: 6 or SEQ ID NO:7.
  • the composition further comprises: a) a T7 or SP6 RNA polymerase promoter nucleotide sequence 5’ of the one or more elements obtained from the sequence of SEQ ID NO: 3 or SEQ ID NO: 5; and b) optionally, one or more restriction sites 3’ of the poly(A) sequence.
  • the cassette of any of the above composition claims is inserted at position 7563 of SEQ ID NO:8 or SEQ ID NO:9.
  • vector or set of vectors comprising any of the nucleotide sequence described herein.
  • kits comprising any of the compositions described herein and instructions for use.
  • any of the above compositions further comprise a nanoparticulate delivery vehicle.
  • the nanoparticulate delivery vehicle may be a lipid nanoparticle (LNP).
  • the LNP comprises ionizable amino lipids.
  • the ionizable amino lipids comprise MC3-like (dilinoleylmethyl- 4-dimethylaminobutyrate ) molecules.
  • the nanoparticulate delivery vehicle encapsulates the antigen expression system.
  • the non-lamellar morphology of the LNPs comprises an inverse hexagonal (H//) or cubic phase structure.
  • the cationic lipid comprises from about 10 mol % to about 50 mol % of the total lipid present in the LNPs. In some aspects, the cationic lipid comprises from about 20 mol % to about 50 mol % of the total lipid present in the LNPs. In some aspects, the cationic lipid comprises from about 20 mol % to about 40 mol % of the total lipid present in the LNPs. [0094] In some aspects, the non-cationic lipid comprises from about 10 mol % to about 60 mol % of the total lipid present in the LNPs.
  • the non-cationic lipid comprises from about 20 mol % to about 55 mol % of the total lipid present in the LNPs. In some aspects, the non-cationic lipid comprises from about 25 mol % to about 50 mol % of the total lipid present in the LNPs.
  • the conjugated lipid comprises from about 0.5 mol % to about 20 mol % of the total lipid present in the LNPs. In some aspects, the conjugated lipid comprises from about 2 mol % to about 20 mol % of the total lipid present in the LNPs. In some aspects, the conjugated lipid comprises from about 1.5 mol % to about 18 mol % of the total lipid present in the LNPs.
  • greater than 95% of the LNPs have a non-lamellar morphology. In some aspects, greater than 95% of the LNPs are electron dense.
  • any of the above compositions further comprise a plurality of LNPs, wherein the LNPs comprise: a cationic lipid comprising from 50 mol % to 65 mol % of the total lipid present in the LNPs; a conjugated lipid that inhibits aggregation of LNPs comprising from 0.5 mol % to 2 mol % of the total lipid present in the LNPs; and a non-cationic lipid comprising either: a mixture of a phospholipid and cholesterol or a derivative thereof, wherein the phospholipid comprises from 4 mol % to 10 mol % of the total lipid present in the LNPs and the cholesterol or derivative thereof comprises from 30 mol % to 40 mol % of the total lipid present in the LNPs; a mixture of a phospholipid and cholesterol or a derivative thereof, wherein the phospholipid comprises from 3 mol % to 15 mol % of the total lipid present in the LNPs and the cholesterol or derivative thereof comprises
  • any of the above compositions further comprise a plurality of LNPs, wherein the LNPs comprise: a cationic lipid comprising from 50 mol % to 85 mol % of the total lipid present in the LNPs; a conjugated lipid that inhibits aggregation of LNPs comprising from 0.5 mol % to 2 mol % of the total lipid present in the LNPs; and a non-cationic lipid comprising from 13 mol % to 49.5 mol % of the total lipid present in the LNPs.
  • the LNPs comprise: a cationic lipid comprising from 50 mol % to 85 mol % of the total lipid present in the LNPs; a conjugated lipid that inhibits aggregation of LNPs comprising from 0.5 mol % to 2 mol % of the total lipid present in the LNPs; and a non-cationic lipid comprising from 13 mol % to 49.5 mol % of the total lipid present in
  • the phospholipid comprises dipalmitoylphosphatidylcholine (DPPC), distearoylphosphatidylcholine (DSPC), or a mixture thereof.
  • DPPC dipalmitoylphosphatidylcholine
  • DSPC distearoylphosphatidylcholine
  • the conjugated lipid comprises from 1 mol % to 2 mol % of the total lipid present in the LNPs.
  • R 2a and R 2b are, at each occurrence, independently either: (a) H or C1-C12 alkyl; or (b) R 2a is H or C1-C12 alkyl, and R 2b together with the carbon atom to which it is bound is taken together with an adjacent R 2b and the carbon atom to which it is bound to form a carbon-carbon double bond;
  • R 3a and R 3b are, at each occurrence, independently either (a): H or C1-C12 alkyl; or (b) R 3a is H or C1-C12 alkyl, and R 3b together with the carbon atom to which it is bound is taken together with an adjacent R and the carbon atom to which it is bound to form a carbon-carbon double bond;
  • R 4a and R 4b are, at each occurrence, independently either: (a) H or Cl -Cl 2 alkyl; or (b) R 4a is H or C1-C12 alkyl, and R 4b together with the carbon atom to which it is bound is taken together with an adjacent R 4b and the carbon atom to which it is bound to form a carbon-carbon double bond;
  • R 5 and R 6 are each independently H or methyl;
  • R 7 is C4-C20 alkyl;
  • R 8 and R 9 are each independently C1-C12 alkyl; or R 8 and R 9 , together with the nitrogen atom to which they are attached, form a 5, 6 or 7-membered heterocyclic ring;
  • a, b, c and d are each independently an integer from 1 to 24; and x is 0, 1 or 2.
  • R la and R lb are, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R la is H or C1-C12 alkyl, and R lb together with the carbon atom to which it is bound is taken together with an adjacent R lb and the carbon atom to which it is bound to form a carbon-carbon double bond
  • R 2a and R 2b are, at each occurrence, independently either (a) H or C1-C12 alkyl, or (b) R 2a is H or C1-C12 alkyl, and R 2b together with the carbon atom to which it is bound is taken together with an adjacent R 2b and the carbon atom to which it is bound to form a carbon-carbon double bond
  • any of the above compositions further comprise one or more excipients comprising a neutral lipid, a steroid, and a polymer conjugated lipid.
  • the neutral lipid comprises at least one of l,2-Distearoyl- w-glycero-3 -phosphocholine (DSPC), l,2-Dipalmitoyl-sw-glycero-3-phosphocholine (DPPC), l,2-Dimyristoyl- w-glycero-3- phosphocholine (DMPC), l-Palmitoyl-2-oleoyl- w-glycero-3-phosphocholine (POPC), 1,2- dioleoyl-sw-glycero-3-phosphocholine (DOPC), and l,2-Dioleoyl- w-glycero-3- phosphoethanolamine (DOPE).
  • the neutral lipid is DSPC.
  • the molar ratio of the compound to the neutral lipid ranges from about 2: 1 to about 8: 1.
  • the steroid is cholesterol. In some aspects, the molar ratio of the compound to cholesterol ranges from about 2: 1 to 1 : 1.
  • the polymer conjugated lipid is a pegylated lipid.
  • the molar ratio of the compound to the pegylated lipid ranges from about 100: 1 to about 25: 1.
  • the pegylated lipid is PEG-DAG, a PEG polyethylene (PEG-PE), a PEG- succinoyl-diacylglycerol (PEG-S-DAG), PEG-cer or a PEG dialkyoxypropylcarbamate.
  • the pegylated lipid has the following structure III: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein: R 10 and R 11 are each independently a straight or branched, saturated or unsaturated alkyl chain containing from 10 to 30 carbon atoms, wherein the alkyl chain is optionally interrupted by one or more ester bonds; and z has a mean value ranging from 30 to 60. In some aspects, R 10 and R 11 are each independently straight, saturated alkyl chains having 12 to 16 carbon atoms. In some aspects, the average z is about 45. start here
  • the LNP self-assembles into non-bilayer structures when mixed with polyanionic nucleic acid.
  • the non-bilayer structures have a diameter between 60nm and 120nm.
  • the non-bilayer structures have a diameter of about 70nm, about 80nm, about 90nm, or about lOOnm.
  • the nanoparticulate delivery vehicle has a diameter of about lOOnm.
  • the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject any of the compositions or any of the pharmaceutical compositions described herein.
  • the epitope-encoding nucleic acid sequence is derived from the tumor of the subject with cancer or from a cell or sample of the infected subject.
  • the epitope-encoding nucleic acid sequence are not derived from the tumor of the subject with cancer or from a cell or sample of the infected subject.
  • the subject expresses at least one HLA allele predicted or known to present the MHC class I epitope.
  • HLA allele predicted or known to present the MHC class I epitope is A*03:01, A*ll:01, A*02:01, A*68:01, B*07:02, C*01:02, C*03:04, C*08:02 and/or A*01 :01.
  • HLA allele predicted or known to present the MHC class I epitope is A*03:01.
  • HLA allele predicted or known to present the MHC class I epitope is A* 11 :01.
  • HLA allele predicted or known to present the MHC class I epitope is A*02:01. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*01 :02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is A*68:01. In some aspects, HLA allele predicted or known to present the MHC class I epitope is B*07:02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*03:04. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*08:02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is A*01:01.
  • the one or more immune modulators are selected from the group consisting of: an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigen-binding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti-4-lBB antibody or an antigen-binding fragment thereof, or an anti-OX- 40 antibody or an antigen-binding fragment thereof.
  • the immune modulator is administered intravenously (IV), intramuscularly (IM), intradermally (ID), or subcutaneously (SC).
  • the subcutaneous administration is near the site of the composition or pharmaceutical composition administration or in close proximity to one or more vector or composition draining lymph nodes.
  • the method further comprises administering to the subject a second vaccine composition.
  • the second vaccine composition is administered prior to the administration of any of the compositions or the pharmaceutical compositions described herein.
  • the second vaccine composition is administered subsequent to the administration of any of the compositions or the pharmaceutical compositions described herein.
  • the second vaccine composition is the same as any of the compositions or the pharmaceutical compositions described herein.
  • the second vaccine composition is different any of the compositions or the pharmaceutical compositions described herein.
  • the second vaccine composition comprises a chimpanzee adenovirus vector encoding at least one antigen-encoding nucleic acid sequence.
  • the at least one antigen-encoding nucleic acid sequence encoded by the chimpanzee adenovirus vector is the same as the at least one antigen-encoding nucleic acid sequence of any of the above composition claims.
  • a method of manufacturing the one or more vectors of any of the above composition claims comprising: (a) obtaining a linearized DNA sequence comprising the backbone and the cassette; (b) in vitro transcribing the linearized DNA sequence by addition of the linearized DNA sequence to an in vitro transcription reaction containing all the necessary components to transcribe the linearized DNA sequence into RNA, optionally further comprising in vitro addition of the m7g cap to the resulting RNA; and (c) isolating the one or more vectors from the in vitro transcription reaction.
  • the linearized DNA sequence is generated by linearizing a DNA plasmid sequence or by amplification using PCR.
  • the epitope-encoding nucleic acid sequence is derived from a tumor of the subject with cancer or from a cell or sample of the infected subject. In some aspects, the epitope-encoding nucleic acid sequence are not derived from a tumor of the subject with cancer or from a cell or sample of the infected subject.
  • E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including
  • the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E N , or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes the distinct KRAS-associated MHC class I neoepitope.
  • a method for stimulating an immune response in a subject with cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigenencoding nucle
  • a method for treating a subject with a disease wherein the disease is cancer, wherein the cancer comprises (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nu
  • the subject expresses at least one HLA allele predicted or known to present the at least one epitope sequence, optionally wherein the at least one epitope sequence predicted or known to be presented comprises (1) the KRAS-associated MHC class I neoepitope, and/or (2) the immunodominant MHC class I epitope and the other MHC class I epitope encoded in the cassette.
  • the virally infected cell is selected from the group consisting of: an HIV infected cell, a Severe acute respiratory syndrome-related coronavirus (SARS) infected cell, a severe acute respiratory syndrome coronavirus 2 (SARS- CoV-2) infected cell, a Ebola infected cell, a Hepatitis B virus (HBV) infected cell, an influenza infected cell, an orthymyxoviridae family virus infected cell, a Human papillomavirus (HPV) infected cell, a Cytomegalovirus (CMV) infected cell, a Chikungunya virus infected cell, a Respiratory syncytial virus (RSV) infected cell, a Dengue virus infected cell, and a Hepatitis C virus (HCV) infected cell.
  • SARS Severe acute respiratory syndrome-related coronavirus
  • SARS- CoV-2 severe acute respiratory syndrome coronavirus 2
  • a method for inducing an immune response in a subject with cancer comprising (1) a solid tumor expressing a KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises an antigen-encoding cassette, or a polypeptide sequence encoded by the cassette, wherein the antigen-encoding cassette comprises at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula:
  • E represents a nucleotide sequence comprising a distinct epitope-encoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including
  • the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E N , or a combination thereof, and at least one of the distinct epitope-encoding nucleic acid sequences comprising the at least two iterations encodes a distinct KRAS-associated MHC class I neoepitope.
  • a method for inducing an immune response in a subject with cancer comprising (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject an antigen-based vaccine to the subject, wherein the antigen-based vaccine comprises: an antigen expression system, comprising: the antigen expression system, wherein the antigen expression system comprises one or more vectors, the one or more vectors comprising: (a) a vector backbone, wherein the backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) optionally, at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid
  • the KRAS-associated MHC class I neoepitope or the KRAS mutation comprises the amino acid sequence shown in SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, or SEQ ID NO: 60.
  • the epitope-encoding nucleic acid sequences comprises two or more distinct epitope-encoding nucleic acid sequences independently encoding a distinct KRAS- associated MHC class I neoepitope or a distinct KRAS mutation.
  • each of the epitope-encoding nucleic acid sequences independently encodes a distinct KRAS-associated MHC class I neoepitope or a distinct KRAS mutation.
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12C mutation is selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), and GACGVGKSAL.
  • the KRAS- associated MHC class I neoepitope comprising a KRAS G12D mutation is selected from the group consisting of: VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV, and GADGVGKSAL.
  • the KRAS-associated MHC class I neoepitope comprising a KRAS G12V mutation is selected from the group consisting of: VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), and GAVGVGKSAL.
  • the cassette does not encode an immunodominant MHC class I epitope that: (1) stimulates a 5-fold or greater immune response when administered in a vaccine composition to a subject relative to another MHC class I epitope encoded in the cassette and capable of stimulating an immune response in the subject, and/or (2) reduces an immune response to another MHC class I epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other MHC class I epitope is administered in the absence of the immunodominant MHC class I epitope, optionally wherein the immune response is reduced to below a limit of detection and/or wherein the immune response is not a therapeutically effective response.
  • the cassette does not encode an immunodominant MHC class I epitope that stimulates a 5-fold or greater immune response when administered in a vaccine composition to a subject relative to a KRAS-associated neoepitope encoded in the cassette and capable of stimulating an immune response in the subject.
  • the cassette does not encode an immunodominant MHC class I epitope that reduces an immune response to another MHC class I epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other MHC class I epitope is administered in the absence of the immunodominant MHC class I epitope.
  • the cassette does not encode an immunodominant MHC class I epitope that reduces an immune response to another MHC class I epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other MHC class I epitope is administered in the absence of the immunodominant MHC class I epitope, wherein the immune response to the other MHC class I epitope is not a therapeutically effective response.
  • the antigen expression system comprises any one of the antigen expression systems described herein.
  • the antigen-based vaccine comprises any one of the pharmaceutical compositions described herein.
  • the antigen-based vaccine is administered as a priming dose. In some aspects, the antigen-based vaccine is administered as one or more boosting doses. In some aspects, the boosting dose is different than the priming dose. In some aspects, a) the priming dose comprises a chimpanzee adenovirus vector and the boosting dose comprises an alphavirus vector; or b) the priming dose comprises an alphavirus vector and the boosting dose comprises a chimpanzee adenovirus vector. In some aspects, the boosting dose is the same as the priming dose. In some aspects, the injection site of the one or more boosting doses is as close as possible to the injection site of the priming dose. [00134] In some aspects, the method further comprises determining or having determined the HLA-haplotype of the subject.
  • compositions disclosed herein comprising any of the compositions disclosed herein (such as an alphavirus-based or ChAd-based vector disclosed herein) and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition further comprises an adjuvant.
  • the pharmaceutical composition further comprises an immune modulator.
  • the immune modulator is an anti- CTLA4 antibody or an antigen-binding fragment thereof, an anti-PD-1 antibody or an antigenbinding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti -4- IBB antibody or an antigen-binding fragment thereof, or an anti-OX-40 antibody or an antigen-binding fragment thereof.
  • Also disclosed herein is a vector comprising an isolated nucleotide sequence disclosed herein.
  • kits comprising a vector or a composition disclosed herein and instructions for use.
  • Also disclosed herein is a method for treating a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject a vector disclosed herein or a pharmaceutical composition disclosed herein.
  • CRC colorectal cancer
  • NSCLC non-small cell lung cancer
  • PDA pancreatic ductal adenocarcinoma
  • Also disclosed herein is a method for inducing an immune response in a subject with cancer, wherein the cancer comprises (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA), the method comprising administering to the subject any of the compositions, vectors, or pharmaceutical compositions described herein.
  • the cancer comprises (1) a solid tumor expressing the KRAS-associated MHC class I neoepitope, (2) colorectal cancer (CRC), (3) non-small cell lung cancer (NSCLC), and/or (4) pancreatic ductal adenocarcinoma (PDA)
  • the subject expresses at least one HLA allele predicted or known to present the MHC class I epitope.
  • HLA allele predicted or known to present the MHC class I epitope is A*03:01, A*ll:01, A*02:01, A*68:01, B*07:02, C*01:02, C*03:04, C*08:02 and/or A*01 :01.
  • HLA allele predicted or known to present the MHC class I epitope is A*03:01.
  • HLA allele predicted or known to present the MHC class I epitope is A* 11 :01.
  • HLA allele predicted or known to present the MHC class I epitope is A*02:01. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*01 :02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is A*68:01. In some aspects, HLA allele predicted or known to present the MHC class I epitope is B*07:02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*03:04. In some aspects, HLA allele predicted or known to present the MHC class I epitope is C*08:02. In some aspects, HLA allele predicted or known to present the MHC class I epitope is A*01:01.
  • the vector or composition is administered intramuscularly (IM), intradermally (ID), or subcutaneously (SC), or intravenously (IV).
  • the cancer comprises a solid tumor expressing a KRAS-associated and/or a NRAS-associated MHC class I neoepitope.
  • the KRAS-associated and/or the NRAS-associated MHC class I neoepitope comprises a mutation selected from the group consisting of: KRAS G12C, NRAS G12C, KRAS G12D, NRAS G12D, KRAS G12V, NRAS G12V, KRAS Q61H, and NRAS Q61H.
  • the cancer comprises colorectal cancer (CRC). In some aspects, the cancer comprises non-small cell lung cancer (NSCLC). In some aspects, the cancer comprises pancreatic ductal adenocarcinoma (PDA).
  • CRC colorectal cancer
  • NSCLC non-small cell lung cancer
  • PDA pancreatic ductal adenocarcinoma
  • any one of the compositions, the pharmaceutical compositions, the antigen-based vaccines, or the one or more boosting doses described herein is administered every 4 weeks (Q4W). In some aspects, any one of the compositions, the pharmaceutical compositions, the antigen-based vaccines, or the one or more boosting doses described herein is administered every 8 weeks (Q8W). In some aspects, any one of the compositions, the pharmaceutical compositions, the antigen-based vaccines, or the one or more boosting doses described herein is administered monthly. In some aspects, any one of the compositions, the pharmaceutical compositions, the antigen-based vaccines, or the one or more boosting doses described herein is administered every two months.
  • stimulating the immune response comprises stimulating a molecular response.
  • the molecular response comprises a reduction in ctDNA.
  • the reduction in ctDNA is at least a 20%, at least a 30%, at least a 40%, or at least a 50% reduction in ctDNA.
  • the reduction in ctDNA is at least a 30% reduction in ctDNA.
  • Also disclosed herein is a method of manufacturing the one or more vectors of any of the above compositions, the method comprising: obtaining a linearized DNA sequence comprising the backbone and the antigen cassette; in vitro transcribing the linearized DNA sequence by addition of the linearized DNA sequence to an in vitro transcription reaction containing all the necessary components to transcribe the linearized DNA sequence into RNA, optionally further comprising in vitro addition of the m7g cap to the resulting RNA; and isolating the one or more vectors from the in vitro transcription reaction.
  • the linearized DNA sequence is generated by linearizing a DNA plasmid sequence or by amplification using PCR.
  • the DNA plasmid sequence is generated using one of bacterial recombination or full genome DNA synthesis or full genome DNA synthesis with amplification of synthesized DNA in bacterial cells.
  • the isolating the one or more vectors from the in vitro transcription reaction involves one or more of phenol chloroform extraction, silica column based purification, or similar RNA purification methods.
  • compositions disclosed herein comprising: providing components for the nanoparticulate delivery vehicle; providing the antigen expression system; and providing conditions sufficient for the nanoparticulate delivery vehicle and the antigen expression system to produce the composition for delivery of the antigen expression system.
  • the conditions are provided by microfluidic mixing.
  • Also disclosed herein is a method of manufacturing a adenovirus vector disclosed herein, the method comprising: obtaining a plasmid sequence comprising the at least one promoter sequence and the antigen cassette; transfecting the plasmid sequence into one or more host cells; and isolating the adenovirus vector from the one or more host cells.
  • isolating comprises: lysing the host cell to obtain a cell lysate comprising the adenovirus vector; and purifying the adenovirus vector from the cell lysate.
  • the plasmid sequence is generated using one of bacterial recombination or full genome DNA synthesis or full genome DNA synthesis with amplification of synthesized DNA in bacterial cells.
  • the one or more host cells are at least one of CHO, HEK293 or variants thereof, 911, HeLa, A549, LP-293, PER.C6, and AEl-2a cells.
  • purifying the adenovirus vector from the cell lysate involves one or more of chromatographic separation, centrifugation, virus precipitation, and filtration.
  • Numerical identifiers are in reference to the epitope “slot” relative to each cassette respectively and not across cassette designs (e.g., the slot “3” epitope in the 20x1 cassette is not the same as the epitope in slot 3 of the 8x2 cassette).
  • FIG. IB demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12C. Mice engineered to express human HLA-A11 :01 were immunized with 8xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with WVGACGVGK (SEQ ID NO: 75). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 1C demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V. Mice engineered to express human HLA-A11 :01 were immunized with 8xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with WVGAVGVGK (SEQ ID NO: 81). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).
  • SFC spot forming colonies
  • FIG. ID demonstrates repeating epitopes increases vaccine induced antigen-specific T-cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12D. Mice engineered to express human HLA-A11 :01 were immunized with 8xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with WVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 2B demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12C. Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGACGVGK (SEQ ID NO: 75). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 2C demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12D. Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 2D demonstrates removal of an immunodominant epitope increases vaccine induced antigen-specific T-cell response to KRAS neoepitopes. Shown are ELISpot results for the neoepitope KRAS G12V. Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81).
  • FIG. 2E demonstrates the immune response of an immunodominant epitope and related control epitope. Shown are ELISpot results for the TP53 neoepitope pools for R213L and S127Y neoepitopes. Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days postimmunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation. Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).
  • SFC spot forming colonies
  • FIG. 3 demonstrates repeating epitopes increases vaccine induced antigen-specific T- cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81) or VVVGADGVGK (SEQ ID NO: 78), respectively. Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 4 demonstrates repeating epitopes increases vaccine induced antigen-specific T- cell response. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11 :01 were immunized with 7xlO 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 14 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVVGAVGVGK (SEQ ID NO: 81) or VVVGADGVGK (SEQ ID NO: 78), respectively. Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median.
  • SFC spot forming colonies
  • FIG. 5 demonstrates repeating epitopes increases vaccine induced antigen-specific T- cell response for KRAS Q61H. Shown are ELISpot results for the repeated neoepitope KRAS Q61H for the indicated cassette formats.
  • Mice engineered to express human HLA-A01 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated and splenocytes isolated 12 days post-immunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with ILDTAGHEEY (SEQ ID NO: 82). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median. Dashed line represent samples that were too numerous to count (TNTC).
  • FIG. 6 demonstrates repeating epitopes increases vaccine induced antigen-specific T- cell response for both ChAdV68 and SAM vector formats. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated or lOpg the SAM vectors indicated and splenocytes isolated 14 days postimmunization. The number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with respective peptide pools that contained all possible 38 minimal epitopes that span the 25mer.
  • FIG. 7 demonstrates repeating epitopes increases vaccine induced antigen-specific T- cell response for both ChAdV68 and SAM vector formats. Shown are ELISpot results for the repeated neoepitope KRAS G12V (left panel) or KRAS G12D (right panel). Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors indicated or lOpg the SAM vectors indicated and splenocytes isolated 14 days post- immunization.
  • the number of antigen-specific T-cells were measured by IFNg ELISpot following overnight stimulation with VVGAVGVGK (SEQ ID NO: 79) or VVVGADGVGK (SEQ ID NO: 78). Data presented as spot forming colonies (SFC) per IxlO 6 splenocytes for each animal. Bar represents the median. Columns from left to right are ChAdV68 20x1, SAM 20x1, ChAdV68 4x4, and SAM 4x4.
  • FIG. 8 illustrates a Phase 1/2 study designed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of cancer vaccines encoding the iterated KRAS neoepitope cassettes described herein (“SLATE v2”) administered in combination with immune checkpoint blockade in patients with advanced cancer.
  • SLATE v2 KRAS neoepitope cassettes described herein
  • FIG. 9 shows ELISpot CD8 T cell response for SLATE patient S21 administered the SLATE “version 1” (vl) cassette and patient S31 administered the optimized SLATE “version 2” (v2) cassette including iterated KRAS neoepitopes. Shown are overnight stimulations with peptide pool containing 38 minimal epitopes. Timepoint was collected post-second SAM administration.
  • FIG. 10 shows clinical responses for patient S31 administered the SLATE v2 cassette including iterated KRAS neoepitopes.
  • Top panel radiological CT scan of tumor lesion.
  • Bottom left panel quantification of radiological CT scans.
  • Bottom right panel response assessment through monitoring neoantigen ctDNA.
  • FIG. 11 illustrates a Phase 1/2 study designed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of cancer vaccines encoding the iterated KRAS neoepitope cassettes described herein (“SLATE v2”) administered in combination with immune checkpoint blockade in patients with advanced cancer.
  • SLATE v2 KRAS neoepitope cassettes described herein
  • FIG. 12 shows a summary of T cells responses assessed by IFNy ELISpot for the various G12 mutations, alleles, and cassettes indicated.
  • FIG. 13 shows molecular responses as assessed by monitoring neoantigen ctDNA (left top panel) and standard serum tumor markers CEA and CA 19-9 (left bottom panel), as well as radiological CT scans of tumor lesions (right panels.
  • FIG. 14 shows overall survival probabilities for subjects with and without molecular responses (reduction in ctDNA >30%).
  • FIG. 15 shows a summary of clinical results for patients with NSCLC.
  • FIG. 16 shows a summary of clinical results for patients with late-stage CRC.
  • FIG. 17 illustrates a two-month treatment schedule for the Phase 2 trial.
  • an antigen is a substance that stimulates an immune response.
  • An antigen can be a neoantigen.
  • An antigen can be a “shared antigen” that is an antigen found among a specific population, e.g., a specific population of cancer patients.
  • neoantigen is an antigen that has at least one alteration that makes it distinct from the corresponding wild-type antigen, e.g., via mutation in a tumor cell or post-translational modification specific to a tumor cell.
  • a neoantigen can include a polypeptide sequence or a nucleotide sequence.
  • a mutation can include a frameshift or non-frameshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF.
  • a mutations can also include a splice variant.
  • Post-translational modifications specific to a tumor cell can include aberrant phosphorylation.
  • Post-translational modifications specific to a tumor cell can also include a proteasome-generated spliced antigen. See Liepe et al., A large fraction of HLA class I ligands are proteasome-generated spliced peptides; Science. 2016 Oct 21;354(6310):354-358.
  • the subject can be identified for administration through the use of various diagnostic methods, e.g., patient selection methods described further below.
  • tumor antigen is an antigen present in a subject’s tumor cell or tissue but not in the subject’s corresponding normal cell or tissue, or derived from a polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
  • the term “antigen-based vaccine” is a vaccine composition based on one or more antigens, e.g., a plurality of antigens.
  • the vaccines can be nucleotide-based (e.g., virally based, RNA based, or DNA based), protein-based (e.g., peptide based), or a combination thereof.
  • cancer antigen is a mutation or other aberration giving rise to a sequence that may represent an antigen.
  • coding region is the portion(s) of a gene that encode protein.
  • coding mutation is a mutation occurring in a coding region.
  • ORF means open reading frame.
  • NEO-ORF is a tumor-specific ORF arising from a mutation or other aberration such as splicing.
  • missense mutation is a mutation causing a substitution from one amino acid to another.
  • nonsense mutation is a mutation causing a substitution from an amino acid to a stop codon or causing removal of a canonical start codon.
  • frameshift mutation is a mutation causing a change in the frame of the protein.
  • the term “indel” is an insertion or deletion of one or more nucleic acids.
  • the term percent "identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
  • the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
  • sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
  • test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • sequence similarity or dissimilarity can be established by the combined presence or absence of particular nucleotides, or, for translated sequences, amino acids at selected sequence positions (e.g., sequence motifs).
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
  • non-stop or read-through is a mutation causing the removal of the natural stop codon.
  • epitopope is the specific portion of an antigen typically bound by an antibody or T cell receptor.
  • immunogenic is the ability to stimulate an immune response, e.g., via T cells, B cells, or both.
  • HLA binding affinity means affinity of binding between a specific antigen and a specific MHC allele.
  • the term “bait” is a nucleic acid probe used to enrich a specific sequence of DNA or RNA from a sample.
  • variant is a difference between a subject’s nucleic acids and the reference human genome used as a control.
  • variant call is an algorithmic determination of the presence of a variant, typically from sequencing.
  • polymorphism is a germline variant, i.e., a variant found in all DNA-bearing cells of an individual.
  • somatic variant is a variant arising in non-germline cells of an individual.
  • allele is a version of a gene or a version of a genetic sequence or a version of a protein.
  • HLA type is the complement of HLA gene alleles.
  • nonsense-mediated decay or “NMD” is a degradation of an mRNA by a cell due to a premature stop codon.
  • truncal mutation is a mutation originating early in the development of a tumor and present in a substantial portion of the tumor’s cells.
  • subclonal mutation is a mutation originating later in the development of a tumor and present in only a subset of the tumor’s cells.
  • exome is a subset of the genome that codes for proteins.
  • An exome can be the collective exons of a genome.
  • logistic regression is a regression model for binary data from statistics where the logit of the probability that the dependent variable is equal to one is modeled as a linear function of the dependent variables.
  • neural network is a machine learning model for classification or regression consisting of multiple layers of linear transformations followed by element-wise nonlinearities typically trained via stochastic gradient descent and back- propagation.
  • proteome is the set of all proteins expressed and/or translated by a cell, group of cells, or individual.
  • peptidome is the set of all peptides presented by MHC-I or MHC-II on the cell surface.
  • the peptidome may refer to a property of a cell or a collection of cells (e.g., the tumor peptidome, meaning the union of the peptidomes of all cells that comprise the tumor).
  • ELISPOT Enzyme-linked immunosorbent spot assay - which is a common method for monitoring immune responses in humans and animals.
  • the term “dextramers” is a dextran-based peptide-MHC multimers used for antigen-specific T-cell staining in flow cytometry.
  • tolerance or immune tolerance is a state of immune nonresponsiveness to one or more antigens, e.g. self-antigens.
  • central tolerance is a tolerance affected in the thymus, either by deleting self-reactive T-cell clones or by promoting self-reactive T-cell clones to differentiate into immunosuppressive regulatory T-cells (Tregs).
  • peripheral tolerance is a tolerance affected in the periphery by downregulating or anergizing self-reactive T-cells that survive central tolerance or promoting these T cells to differentiate into Tregs.
  • sample can include a single cell or multiple cells or fragments of cells or an aliquot of body fluid, taken from a subject, by means including venipuncture, excretion, ejaculation, massage, biopsy, needle aspirate, lavage sample, scraping, surgical incision, or intervention or other means known in the art.
  • subject encompasses a cell, tissue, or organism, human or non-human, whether in vivo, ex vivo, or in vitro, male or female.
  • subject is inclusive of mammals including humans.
  • the term “mammal” encompasses both humans and non-humans and includes but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
  • the term “clinical factor” refers to a measure of a condition of a subject, e.g., disease activity or severity. “Clinical factor” encompasses all markers of a subject’s health status, including non-sample markers, and/or other characteristics of a subject, such as, without limitation, age and gender.
  • a clinical factor can be a score, a value, or a set of values that can be obtained from evaluation of a sample (or population of samples) from a subject or a subject under a determined condition.
  • a clinical factor can also be predicted by markers and/or other parameters such as gene expression surrogates.
  • Clinical factors can include tumor type, tumor sub-type, and smoking history.
  • nucleic acid sequences derived from a tumor refers to nucleic acid sequences obtained from the tumor, e.g. via RT-PCR; or sequence data obtained by sequencing the tumor and then synthesizing the nucleic acid sequences using the sequencing data, e.g., via various synthetic or PCR-based methods known in the art.
  • Derived sequences can include nucleic acid sequence variants, such as sequence-optimized nucleic acid sequence variants (e.g., codon-optimized and/or otherwise optimized for expression), that encode the same polypeptide sequence as the corresponding native nucleic acid sequence obtained from a tumor.
  • alphavirus backbone refers to minimal sequence(s) of an alphavirus that allow for self-replication of the viral genome.
  • Minimal sequences can include conserved sequences for nonstructural protein-mediated amplification, a nonstructural protein 1 (nsPl) gene, a nsP2 gene, a nsP3 gene, a nsP4 gene, and a polyA sequence, as well as sequences for expression of subgenomic viral RNA including a subgenomic (e.g., a 26S) promoter element.
  • sequences for nonstructural protein-mediated amplification includes alphavirus conserved sequence elements (CSE) well known to those in the art.
  • RNA polymerase includes polymerases that catalyze the production of RNA polynucleotides from a DNA template. RNA polymerases include, but are not limited to, bacteriophage derived polymerases including T3, T7, and SP6.
  • lipid nanoparticle includes vesicle like structures formed using a lipid containing membrane surrounding an aqueous interior, also referred to as liposomes.
  • Lipid nanoparticles includes lipid-based compositions with a solid lipid core stabilized by a surfactant.
  • the core lipids can be fatty acids, acylglycerols, waxes, and mixtures of these surfactants.
  • Biological membrane lipids such as phospholipids, sphingomyelins, bile salts (sodium taurocholate), and sterols (cholesterol) can be utilized as stabilizers.
  • Lipid nanoparticles can be formed using defined ratios of different lipid molecules, including, but not limited to, defined ratios of one or more cationic, anionic, or neutral lipids.
  • Lipid nanoparticles can encapsulate molecules within an outer-membrane shell and subsequently can be contacted with target cells to deliver the encapsulated molecules to the host cell cytosol.
  • Lipid nanoparticles can be modified or functionalized with non-lipid molecules, including on their surface.
  • Lipid nanoparticles can be single-layered (unilamellar) or multi-layered (multilamellar).
  • Lipid nanoparticles can be complexed with nucleic acid.
  • Unilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior.
  • Multilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior, or to form or sandwiched between
  • Methods for identifying shared antigens include identifying antigens from a tumor of a subject that are likely to be presented on the cell surface of the tumor or immune cells, including professional antigen presenting cells such as dendritic cells, and/or are likely to be immunogenic.
  • one such method may comprise the steps of: obtaining at least one of exome, transcriptome or whole genome tumor nucleotide sequencing and/or expression data from the tumor cell of the subject, wherein the tumor nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wildtype peptide sequence or in cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on the tumor cell surface of the tumor cell of the subject or cells present in the tumor, the set of
  • these mutations can be present in the genome, transcriptome, proteome, or exome of cancer cells of a subject having cancer but not in normal tissue from the subject.
  • Specific methods for identifying neoantigens, including shared neoantigens, that are specific to tumors are known to those skilled in the art, for example the methods described in more detail in US Pat No. 10,055,540, US Application Pub. No.
  • KRAS-associated MHC class I neoepitope can include those mutations with reference to wild-type (WT) human KRAS, such as with reference to the following exemplary amino acid sequence:
  • Genetic mutations in tumors can be considered useful for the immunological targeting of tumors if they lead to changes in the amino acid sequence of a protein exclusively in the tumor.
  • Useful mutations include: (1) non-synonymous mutations leading to different amino acids in the protein; (2) read-through mutations in which a stop codon is modified or deleted, leading to translation of a longer protein with a novel tumor-specific sequence at the C-terminus; (3) splice site mutations that lead to the inclusion of an intron in the mature mRNA and thus a unique tumor-specific protein sequence; (4) chromosomal rearrangements that give rise to a chimeric protein with tumor-specific sequences at the junction of 2 proteins (i.e., gene fusion); (5) frameshift mutations or deletions that lead to a new open reading frame with a novel tumorspecific protein sequence. Mutations can also include one or more of non-frameshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any
  • Peptides with mutations or mutated polypeptides arising from for example, splicesite, frameshift, readthrough, or gene fusion mutations in tumor cells can be identified by sequencing DNA, RNA or protein in tumor versus normal cells.
  • mutations can include previously identified tumor specific mutations. Known tumor mutations can be found at the Catalogue of Somatic Mutations in Cancer (COSMIC) database.
  • a variety of methods are available for detecting the presence of a particular mutation or allele in an individual's DNA or RNA. Advancements in this field have provided accurate, easy, and inexpensive large-scale SNP genotyping. For example, several techniques have been described including dynamic allele-specific hybridization (DASH), microplate array diagonal gel electrophoresis (MADGE), pyrosequencing, oligonucleotide-specific ligation, the TaqMan system as well as various DNA "chip” technologies such as the Affymetrix SNP chips. These methods utilize amplification of a target genetic region, typically by PCR.
  • DASH dynamic allele-specific hybridization
  • MADGE microplate array diagonal gel electrophoresis
  • pyrosequencing oligonucleotide-specific ligation
  • TaqMan system as well as various DNA "chip” technologies such as the Affymetrix SNP chips.
  • PCR based detection means can include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously. Alternatively, it is possible to amplify different markers with primers that are differentially labeled and thus can each be differentially detected. Of course, hybridization based detection means allow the differential detection of multiple PCR products in a sample. Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
  • RNA sequences can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No. 4,656,127).
  • a primer complementary to the allelic sequence immediately 3' to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human.
  • the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection. Since the identity of the exonuclease-resistant derivative of the sample is known, a finding that the primer has become resistant to exonucleases reveals that the nucleotide(s) present in the polymorphic site of the target molecule is complementary to that of the nucleotide derivative used in the reaction. This method has the advantage that it does not require the determination of large amounts of extraneous sequence data.
  • a solution-based method can be used for determining the identity of a nucleotide of a polymorphic site.
  • Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. W091/02087).
  • a primer is employed that is complementary to allelic sequences immediately 3' to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
  • Goelet, P. et al. An alternative method, known as Genetic Bit Analysis or GBA is described by Goelet, P. et al. (PCT Appln. No. 92/15712).
  • the method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3' to a polymorphic site.
  • the labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated.
  • the method of Goelet, P. et al. can be a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
  • oligonucleotides 30-50 bases in length are covalently anchored at the 5' end to glass cover slips. These anchored strands perform two functions. First, they act as capture sites for the target template strands if the templates are configured with capture tails complementary to the surface-bound oligonucleotides. They also act as primers for the template directed primer extension that forms the basis of the sequence reading.
  • the capture primers function as a fixed position site for sequence determination using multiple cycles of synthesis, detection, and chemical cleavage of the dye-linker to remove the dye. Each cycle includes adding the polymerase/labeled nucleotide mixture, rinsing, imaging and cleavage of dye.
  • polymerase is modified with a fluorescent donor molecule and immobilized on a glass slide, while each nucleotide is color-coded with an acceptor fluorescent moiety attached to a gamma-phosphate.
  • the system detects the interaction between a fluorescently-tagged polymerase and a fluorescently modified nucleotide as the nucleotide becomes incorporated into the de novo chain.
  • Other sequencing-by-synthesis technologies also exist.
  • any suitable sequencing-by-synthesis platform can be used to identify mutations.
  • four major sequencing-by-synthesis platforms are currently available: the Genome Sequencers from Roche/454 Life Sciences, the 1G Analyzer from Illumina/Solexa, the SOLiD system from Applied BioSystems, and the Heliscope system from Helicos Biosciences. Sequencing-by-synthesis platforms have also been described by Pacific BioSciences and VisiGen Biotechnologies.
  • a plurality of nucleic acid molecules being sequenced is bound to a support (e.g., solid support).
  • a capture sequence/universal priming site can be added at the 3' and/or 5' end of the template.
  • the nucleic acids can be bound to the support by hybridizing the capture sequence to a complementary sequence covalently attached to the support.
  • the capture sequence also referred to as a universal capture sequence
  • the capture sequence is a nucleic acid sequence complementary to a sequence attached to a support that may dually serve as a universal primer.
  • a member of a coupling pair (such as, e.g., antibody/antigen, receptor/ligand, or the avidin-biotin pair as described in, e.g., US Patent Application No. 2006/0252077) can be linked to each fragment to be captured on a surface coated with a respective second member of that coupling pair.
  • sequence can be analyzed, for example, by single molecule detection/sequencing, e.g., as described in the Examples and in U.S. Pat. No. 7,283,337, including template-dependent sequencing-by-synthesis.
  • sequencing-by-synthesis the surface-bound molecule is exposed to a plurality of labeled nucleotide triphosphates in the presence of polymerase.
  • the sequence of the template is determined by the order of labeled nucleotides incorporated into the 3' end of the growing chain. This can be done in real time or can be done in a step-and-repeat mode. For real-time analysis, different optical labels to each nucleotide can be incorporated and multiple lasers can be utilized for stimulation of incorporated nucleotides.
  • Sequencing can also include other massively parallel sequencing or next generation sequencing (NGS) techniques and platforms. Additional examples of massively parallel sequencing techniques and platforms are the Illumina HiSeq or MiSeq, Thermo PGM or Proton, the Pac Bio RS II or Sequel, Qiagen’s Gene Reader, and the Oxford Nanopore MinlON. Additional similar current massively parallel sequencing technologies can be used, as well as future generations of these technologies.
  • NGS next generation sequencing
  • RNA sample can be obtained from a tumor or a bodily fluid, e.g., blood, obtained by known techniques (e.g. venipuncture) or saliva.
  • nucleic acid tests can be performed on dry samples (e.g. hair or skin).
  • a sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of the same tissue type as the tumor.
  • a sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of a distinct tissue type relative to the tumor.
  • Tumors can include one or more of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, and T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.
  • protein mass spectrometry can be used to identify or validate the presence of mutated peptides bound to MHC proteins on tumor cells.
  • Peptides can be acid-eluted from tumor cells or from HLA molecules that are immunoprecipitated from tumor, and then identified using mass spectrometry.
  • Antigens can include nucleotides or polypeptides.
  • an antigen can be an RNA sequence that encodes for a polypeptide sequence.
  • Antigens useful in vaccines can therefore include nucleotide sequences or polypeptide sequences.
  • Neoantigen peptides can be described in the context of their coding sequence where a neoantigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.
  • cassettes including iterations of KRAS-associated MHC class I neoepitopes.
  • KRAS-associated MHC class I neoepitopes include, but are not limited to, neoepitopes having KRAS G12 mutations and/or KRAS Q61 mutations.
  • Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12 mutation.
  • Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS Q61 mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12C mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12V mutation.
  • Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS G12D mutation. Cassettes can include iterations of KRAS-associated MHC class I neoepitopes having a KRAS Q61H mutation. Cassettes can include iterations of each of KRAS-associated MHC class I neoepitopes having a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation.
  • Cassettes can include iterations of at least two distinct KRAS- associated MHC class I neoepitopes selected from the group consisting of: a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation.
  • Cassettes can include iterations of at least three distinct KRAS-associated MHC class I neoepitopes selected from the group consisting of: a KRAS G12C, KRAS G12V, KRAS G12D, and KRAS Q61H mutation.
  • Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope.
  • Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12C mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12D mutation. Cassettes can include iterations only of a single distinct KRAS-associated MHC class I neoepitope having a KRAS G12V mutation. Cassettes can include iterations only of a single distinct KRAS- associated MHC class I neoepitope having a KRAS Q61H mutation.
  • KRAS-associated MHC class I neoepitopes having a KRAS G12C mutation include VVVGACGVGK (SEQ ID NO: 75), KLVVVGACGV (SEQ ID NO: 76), or GACGVGKSAL.
  • KRAS-associated MHC class I neoepitopes having a KRAS G12D mutation include VVGADGVGK (SEQ ID NO: 77), VVVGADGVGK (SEQ ID NO: 78), KLVVVGADGV, or GADGVGKSAL.
  • KRAS-associated MHC class I neoepitopes having a KRAS G12V mutation include VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), AVGVGKSAL (SEQ ID NO: 80), or GAVGVGKSAL.
  • Cassettes can include iterations of each of KRAS-associated MHC class I neoepitopes having the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • Cassettes can include iterations of at least two distinct KRAS-associated MHC class I neoepitopes having the amino acid sequences selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • Cassettes can include iterations of at least three distinct KRAS-associated MHC class I neoepitopes having the amino acid sequences selected from the group consisting of: VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • Cassettes can include iterations of at least one of KRAS-associated MHC class I neoepitopes having the amino acid sequences VVVGACGVGK (SEQ ID NO: 75), VVVGADGVGK (SEQ ID NO: 78), VVGAVGVGK (SEQ ID NO: 79), and ILDTAGHEEY (SEQ ID NO: 82).
  • KRAS-associated MHC class I neoepitopes can include native N- and/or C-terminal flanking sequences of the therapeutic vaccine epitope in the context of the native KRAS protein.
  • Illustrative non -limiting examples of KRAS-associated MHC class I neoepitopes are the 25mers MTEYKLVVVGACGVGKSALTIQLIQ (SEQ ID NO: 57) for KRAS G12C, MTEYKLVVVGADGVGKSALTIQLIQ (SEQ ID NO: 58) for KRAS G12D, MTEYKLVVVGAVGVGKSALTIQLIQ (SEQ ID NO: 59) for KRAS G12V, and ETCLLDILDTAGHEEYSAMRDQYMR (SEQ ID NO: 60) for KRAS Q61H.
  • KRAS-associated MHC class I neoepitopes that include native flanking sequences can be linked (concatenated) to other neoepitopes encoded in a cassette, including other neoepitopes (e.g., other KRAS- associated MHC class I neoepitopes) that include their respective native flanking sequences.
  • An illustrative non-limiting cassette of concatenated KRAS-associated MHC class I neoepitopes that are linked through their native flanking sequences and that includes 4 iterations for each of the KRAS neoepitopes having the mutations KRAS G12C, KRAS G12D, KRAS G12V, and KRAS Q61H is represented by the amino acid sequence shown in SEQ ID NO: 65.
  • Epitope-encoding nucleic acid sequences that encode KRAS-associated MHC class I neoepitopes can encode multiple known and/or predicted KRAS-associated MHC class I neoepitopes.
  • the KRAS G12V 25mer MTEYKLVVVGAVGVGKSALTIQLIQ (SEQ ID NO: 59) encodes each of the known and/or predicted KRAS-associated MHC class I neoepitopes VVGAVGVGK (SEQ ID NO: 79), VVVGAVGVGK (SEQ ID NO: 81), and AVGVGKSAL (SEQ ID NO: 80).
  • Epitope-encoding nucleic acid sequences including those that encode KRAS- associated MHC class I neoepitopes, can be in any order in a cassette.
  • Epitope-encoding nucleic acid sequences can be in an order that minimizes junctional epitopes, as described further herein.
  • concatenated KRAS-associated MHC class I neoepitopes linked together to minimize junctional epitopes is represented by the amino acid sequence shown in SEQ ID NO: 65 and has the order: G12C G12D Q61H G12D G12V G12C Q61H G12D G12V G12C Q61H G12D G12V Q61H G12V G12V Q61H G12V G12C.
  • peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
  • Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database. COSMIC curates comprehensive information on somatic mutations in human cancer.
  • the peptide contains the tumor specific mutation.
  • Tumor antigens e.g., shared tumor antigens and tumor neoantigens
  • Tumor antigens can include, but are not limited to, those described in US App. No.
  • Antigen peptides can be described in the context of their coding sequence where an antigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.
  • Antigens can be selected that are predicted to be presented on the cell surface of a cell, such as a tumor cell or an immune cell, including professional antigen presenting cells such as dendritic cells. Antigens can be selected that are predicted to be immunogenic.
  • One or more polypeptides encoded by an antigen nucleotide sequence can comprise at least one of: a binding affinity with MHC with an IC50 value of less than lOOOnM, for MHC Class I peptides a length of 8-15, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, presence of sequence motifs within or near the peptide promoting proteasome cleavage, and presence or sequence motifs promoting TAP transport.
  • MHC Class II peptides a length 6-30, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids, presence of sequence motifs within or near the peptide promoting cleavage by extracellular or lysosomal proteases (e.g., cathepsins) or HLA-DM catalyzed HLA binding.
  • extracellular or lysosomal proteases e.g., cathepsins
  • HLA-DM catalyzed HLA binding e.g., HLA-DM catalyzed HLA binding.
  • One or more antigens can be presented on the surface of a tumor.
  • One or more antigens can be immunogenic in a subject having a tumor, e.g., capable of stimulating a T cell response and/or a B cell response in the subject.
  • One or more antigens can be capable of stimulating a B cell response, such as the production of antibodies that recognize the one or more antigens e.g., antibodies that recognize a tumor).
  • Antibodies can recognize linear polypeptide sequences or recognize secondary and tertiary structures.
  • B cell antigens can include linear polypeptide sequences or polypeptides having secondary and tertiary structures, including, but not limited to, full-length proteins, protein subunits, protein domains, or any polypeptide sequence known or predicted to have secondary and tertiary structures.
  • Antigens capable of stimulating a B cell response to a tumor can be an antigen found on the surface of tumor cell.
  • Antigens capable of eliciting a B cell response to a tumor can be an intracellular neoantigen expressed in a tumor.
  • One or more antigens can include a combination of antigens capable of stimulating a T cell response (e.g., peptides including predicted T cell epitope sequences) and distinct antigens capable of stimulating a B cell response (e.g., full-length proteins, protein subunits, protein domains).
  • a T cell response e.g., peptides including predicted T cell epitope sequences
  • distinct antigens capable of stimulating a B cell response e.g., full-length proteins, protein subunits, protein domains.
  • One or more antigens that stimulate an autoimmune response in a subject can be excluded from consideration in the context of vaccine generation for a subject.
  • the size of at least one antigenic peptide molecule can comprise, but is not limited to, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 60, about 70, about 80, about 90, about 100, about 110, about 120 or greater amino molecule residues, and any range derivable therein.
  • the antigenic peptide molecules are equal to or less than 50 amino acids.
  • Antigenic peptides and polypeptides can be: for MHC Class 1 15 residues or less in length and usually consist of between about 8 and about 11 residues, particularly 9 or 10 residues; for MHC Class II, 6-30 residues, inclusive.
  • a longer peptide can be designed in several ways.
  • a longer peptide could consist of either: (1) individual presented peptides with an extensions of 2-5 amino acids toward the N- and C-terminus of each corresponding gene product; (2) a concatenation of some or all of the presented peptides with extended sequences for each.
  • sequencing reveals a long (>10 residues) neoepitope sequence present in the tumor (e.g.
  • a longer peptide would consist of: (3) the entire stretch of novel tumor-specific amino acids— thus bypassing the need for computational or in vitro test-based selection of the strongest HLA- presented shorter peptide. In both cases, use of a longer peptide allows endogenous processing by patient cells and may lead to more effective antigen presentation and stimulation of T cell responses.
  • Longer peptides can also include a full-length protein, a protein subunit, a protein domain, and combinations thereof of a peptide, such as those expressed in a tumor. Longer peptides (e.g., full-length protein, protein subunit, or protein domain) and combinations thereof can be included to stimulate a B cell response.
  • Antigenic peptides and polypeptides can be presented on an HLA protein. In some aspects antigenic peptides and polypeptides are presented on an HLA protein with greater affinity than a wild-type peptide. In some aspects, an antigenic peptide or polypeptide can have an IC50 of at least less than 5000 nM, at least less than 1000 nM, at least less than 500 nM, at least less than 250 nM, at least less than 200 nM, at least less than 150 nM, at least less than 100 nM, at least less than 50 nM or less.
  • antigenic peptides and polypeptides do not stimulate an autoimmune response and/or invoke immunological tolerance when administered to a subject.
  • compositions comprising at least two or more antigenic peptides.
  • the composition contains at least two distinct peptides.
  • At least two distinct peptides can be derived from the same polypeptide.
  • distinct polypeptides is meant that the peptide vary by length, amino acid sequence, or both.
  • a peptide can include a tumorspecific mutation.
  • Tumor-specific peptides can be derived from any polypeptide known to or have been found to contain a tumor specific mutation or peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
  • the peptides can be derived from any polypeptide known to or suspected to be associated with an infectious disease organism, or peptides derived from any polypeptide known to or have been found to have altered expression in an infected cell in comparison to a normal cell or tissue (e.g., an infectious disease polynucleotide or polypeptide, including infectious disease polynucleotides or polypeptides with expression restricted to a host cell).
  • Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database or the AACR Genomics Evidence Neoplasia Information Exchange (GENIE) database.
  • COSMIC curates comprehensive information on somatic mutations in human cancer.
  • AACR GENIE aggregates and links clinical-grade cancer genomic data with clinical outcomes from tens of thousands of cancer patients.
  • the tumor specific mutation is a driver mutation for a particular cancer type.
  • a peptide can include a KRAS mutation (e.g., KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations).
  • KRAS mutation e.g., KRAS G12C, KRAS G12V, KRAS G12D, and/or KRAS Q61H mutations.
  • Antigenic peptides and polypeptides having a desired activity or property can be modified to provide certain desired attributes, e.g., improved pharmacological characteristics, while increasing or at least retaining substantially all of the biological activity of the unmodified peptide to bind the desired MHC molecule and activate the appropriate T cell.
  • antigenic peptide and polypeptides can be subject to various changes, such as substitutions, either conservative or non-conservative, where such changes might provide for certain advantages in their use, such as improved MHC binding, stability or presentation.
  • conservative substitutions is meant replacing an amino acid residue with another which is biologically and/or chemically similar, e.g., one hydrophobic residue for another, or one polar residue for another.
  • the substitutions include combinations such as Gly, Ala; Vai, He, Leu, Met; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr.
  • the effect of single amino acid substitutions may also be probed using D-amino acids.
  • Modifications of peptides and polypeptides with various amino acid mimetics or unnatural amino acids can be particularly useful in increasing the stability of the peptide and polypeptide in vivo. Stability can be assayed in a number of ways. For instance, peptidases and various biological media, such as human plasma and serum, have been used to test stability. See, e.g., Verhoef et al., Eur. J. Drug Metab Pharmacokin. 11 :291-302 (1986). Half-life of the peptides can be conveniently determined using a 25% human serum (v/v) assay. The protocol is generally as follows.
  • pooled human serum (Type AB, non-heat inactivated) is delipidated by centrifugation before use. The serum is then diluted to 25% with RPMI tissue culture media and used to test peptide stability. At predetermined time intervals a small amount of reaction solution is removed and added to either 6% aqueous trichloracetic acid or ethanol. The cloudy reaction sample is cooled (4 degrees C) for 15 minutes and then spun to pellet the precipitated serum proteins. The presence of the peptides is then determined by reversed-phase HPLC using stability-specific chromatography conditions.
  • the peptides and polypeptides can be modified to provide desired attributes other than improved serum half-life. For instance, the ability of the peptides to stimulate CTL activity can be enhanced by linkage to a sequence which contains at least one epitope that is capable of stimulating a T helper cell response.
  • Immunogenic peptides/T helper conjugates can be linked by a spacer molecule.
  • the spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions.
  • the spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids.
  • the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homooligomer.
  • the spacer will usually be at least one or two residues, more usually three to six residues.
  • the peptide can be linked to the T helper peptide without a spacer.
  • An antigenic peptide can be linked to the T helper peptide either directly or via a spacer either at the amino or carboxy terminus of the peptide.
  • the amino terminus of either the antigenic peptide or the T helper peptide can be acylated.
  • Exemplary T helper peptides include tetanus toxoid 830-843, influenza 307-319, malaria circumsporozoite 382-398 and 378-389.
  • Proteins or peptides can be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, or the chemical synthesis of proteins or peptides.
  • the nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and can be found at computerized databases known to those of ordinary skill in the art.
  • One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website.
  • the coding regions for known genes can be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
  • various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.
  • an antigen includes a nucleic acid (e.g. polynucleotide) that encodes an antigenic peptide or portion thereof.
  • the polynucleotide can be, e.g., DNA, cDNA, PNA, CNA, RNA (e.g., mRNA), either single- and/or double-stranded, or native or stabilized forms of polynucleotides, such as, e.g., polynucleotides with a phosphorothioate backbone, or combinations thereof and it may or may not contain introns.
  • a polynucleotide sequence encoding an antigen can be sequence-optimized to improve expression, such as through improving transcription, translation, post-transcriptional processing, and/or RNA stability.
  • polynucleotide sequence encoding an antigen can be codon-optimized. “Codonoptimization” herein refers to replacing infrequently used codons, with respect to codon bias of a given organism, with frequently used synonymous codons.
  • Polynucleotide sequences can be optimized to improve post-transcriptional processing, for example optimized to reduce unintended splicing, such as through removal of splicing motifs (e.g., canonical and/or cryptic/non-canonical splice donor, branch, and/or acceptor sequences) and/or introduction of exogenous splicing motifs (e.g., splice donor, branch, and/or acceptor sequences) to bias favored splicing events.
  • splicing motifs e.g., canonical and/or cryptic/non-canonical splice donor, branch, and/or acceptor sequences
  • exogenous splicing motifs e.g., splice donor, branch, and/or acceptor sequences
  • Exogenous intron sequences include, but are not limited to, those derived from SV40 (e.g., an SV40 mini-intron) and derived from immunoglobulins
  • Exogenous intron sequences can be incorporated between a promoter/enhancer sequence and the antigen(s) sequence. Exogenous intron sequences for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul 5; 363(2): 288-302), herein incorporated by reference for all purposes.
  • Polynucleotide sequences can be optimized to improve transcript stability, for example through removal of RNA instability motifs (e.g., AU- rich elements and 3’ UTR motifs) and/or repetitive nucleotide sequences. Polynucleotide sequences can be optimized to improve accurate transcription, for example through removal of cryptic transcriptional initiators and/or terminators.
  • Polynucleotide sequences can be optimized to improve translation and translational accuracy, for example through removal of cryptic AUG start codons, premature polyA sequences, and/or secondary structure motifs. Polynucleotide sequences can be optimized to improve nuclear export of transcripts, such as through addition of a Constitutive Transport Element (CTE), RNA Transport Element (RTE), or Woodchuck Posttranscriptional Regulatory Element (WPRE). Nuclear export signals for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul 5; 363(2): 288-302), herein incorporated by reference for all purposes.
  • CTE Constitutive Transport Element
  • RTE RNA Transport Element
  • WPRE Woodchuck Posttranscriptional Regulatory Element
  • Polynucleotide sequences can be optimized with respect to GC content, for example to reflect the average GC content of a given organism. Sequence optimization can balance one or more sequence properties, such as transcription, translation, post-transcriptional processing, and/or RNA stability. Sequence optimization can generate an optimal sequence balancing each of transcription, translation, post-transcriptional processing, and RNA stability. Sequence optimization algorithms are known to those of skill in the art, such as GeneArt (Thermo Fisher), Codon Optimization Tool (IDT), Cool Tool (University of Singapore), SGI-DNA (La Jolla California). One or more regions of an antigenencoding protein can be sequence-optimized separately.
  • a still further aspect provides an expression vector capable of expressing a polypeptide or portion thereof.
  • Expression vectors for different cell types are well known in the art and can be selected without undue experimentation.
  • DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression. If necessary, DNA can be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host, although such controls are generally available in the expression vector.
  • the vector is then introduced into the host through standard techniques. Guidance can be found e.g. in Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. V. Vaccine Compositions
  • an immunogenic composition e.g., a vaccine composition, capable of raising a specific immune response, e.g., a tumor-specific immune response.
  • Vaccine compositions typically comprise one or a plurality of antigens, e.g., selected using a method described herein. Vaccine compositions can also be referred to as vaccines.
  • a vaccine can contain between 1 and 30 peptides, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 different peptides, 6, 7, 8, 9, 10
  • a vaccine can contain between 1 and 100 or more nucleotide sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52,
  • a vaccine can contain between 1 and 30 antigen sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52,
  • a vaccine can contain between 1 and 30 antigen-encoding nucleic acid sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
  • Antigen-encoding nucleic acid sequences can refer to the antigen encoding portion of an “antigen cassette.” Features of an antigen cassette are described in greater detail herein.
  • An antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences e.g., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).
  • a vaccine can contain between 1 and 30 distinct epitope-encoding nucleic acid sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52,
  • Epitope-encoding nucleic acid sequences can refer to sequences for individual epitope sequences, such as each of the T cell epitopes in an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes.
  • a vaccine can contain at least two iterations of an epitope-encoding nucleic acid sequence.
  • an “iteration” (or interchangeably a “repeat”) refers to two or more identical nucleic acid epitope-encoding nucleic acid sequences (inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequences described herein) within an antigen-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence portion of a cassette encodes at least two iterations of an epitope-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence portion of a cassette encodes more than one distinct epitope, and at least one of the distinct epitopes is encoded by at least two iterations of the nucleic acid sequence encoding the distinct epitope (i.e., at least two distinct epitope-encoding nucleic acid sequences).
  • an antigenencoding nucleic acid sequence encodes epitopes A, B, and C encoded by epitope-encoding nucleic acid sequences epitope-encoding sequence A (EA), epitope-encoding sequence B (EB), and epitope-encoding sequence C (Ec), and examplary antigen-encoding nucleic acid sequences having iterations of at least one of the distinct epitopes are illustrated by, but is not limited to, the formulas below:
  • epitopes A, B, and C EA-EB-EC-EA-EB-EC; or EA-EA-EB-EB-EC-EC
  • the antigen-encoding nucleic acid sequences having iterations of at least one of the distinct epitopes can encode each of the distinct epitopes in any order or frequency.
  • the order and frequency can be a random arangement of the distinct epitopes, e.g., in an example with epitopes A, B, and C, by the formula EA-EB-EC-EC- EA-EB -EA-EC-EA-EC-EC-EB .
  • an antigen-encoding cassette having at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula:
  • E represents a nucleotide sequence including a distinct epitope-encoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0,
  • at least one of the distinct epitope-encoding nucleic acid sequences with the at least two iterations encodes a KRAS- associated MHC class I neoepitope.
  • Each E or E N can independently comprise any epitope-encoding nucleic acid sequence described herein (e.g., a peptide encoding an infectious disease T cell epitope and/or a neoantigen epitope).
  • Epitopes and linkers that can be used are further described herein.
  • Iterations of an epitope-encoding nucleic acid sequences can be linearly linked directly to one another (e.g., EA-EA-. . . as illustrated above). Iterations of an epitope-encoding nucleic acid sequences can be separated by one or more additional nucleotides sequences. In general, iterations of an epitope-encoding nucleic acid sequences can be separated by any size nucleotide sequence applicable for the compositions described herein.
  • iterations of an epitope-encoding nucleic acid sequences can be separated by a separate distinct epitopeencoding nucleic acid sequence (e.g., EA-EB-EC-EA. . ., as illustrated above).
  • a separate distinct epitopeencoding nucleic acid sequence e.g., EA-EB-EC-EA. . ., as illustrated above.
  • each epitope-encoding nucleic acid sequences (inclusive of optional 5’ linker sequence and/or the optional 3’ linker sequences) encodes a peptide 25 amino acids in length
  • the iterations can be separated by 75 nucleotides, such as in antigen-encoding nucleic acid represented by EA-EB- EA. .
  • EA is separated by 75 nucleotides.
  • an antigen-encoding nucleic acid having the sequence VTNTEMFVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDTVTNTEMF VTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDT (SEQ ID NO:85) encoding iterations of 25mer antigens Trpl (VTNTEMFVTAPDNLGYMYEVQWPGQ [SEQ ID NO:86]) and Trp2 (TQPQIANCSVYDFFVWLHYYSVRDT [SEQ ID NO:87]), the iterations of Trpl are separated by the 25mer Trp2 and thus the repeats of the Trpl epitope-encoding nucleic acid sequences are separated the 75 nucleotide Trp2 epitope-encoding nucleic acid sequence.
  • each epitope-encoding nucleic acid sequences (inclusive of optional 5’ linker sequence and/or the optional 3’ linker sequences) encodes a peptide 25 amino acids in length
  • the iterations can be separated by 150, 225, 300, 375, 450, 525, 600, or 675 nucleotides, respectively.
  • different peptides and/or polypeptides or nucleotide sequences encoding them are selected so that the peptides and/or polypeptides capable of associating with different MHC molecules, such as different MHC class I molecules and/or different MHC class II molecules.
  • one vaccine composition comprises coding sequence for peptides and/or polypeptides capable of associating with the most frequently occurring MHC class I molecules and/or different MHC class II molecules.
  • vaccine compositions can comprise different fragments capable of associating with at least 2 preferred, at least 3 preferred, or at least 4 preferred MHC class I molecules and/or different MHC class II molecules.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and/or a specific helper T-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific helper T-cell response.
  • the vaccine composition can be capable of stimulating a specific B-cell response (e.g., an antibody response).
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and/or a specific B-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific B- cell response.
  • the vaccine composition can be capable of stimulating a specific helper T-cell response and a specific B-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and a specific B-cell response.
  • a vaccine composition can further comprise an adjuvant and/or a carrier. Examples of useful adjuvants and carriers are given herein below.
  • a composition can be associated with a carrier such as e.g. a protein or an antigen-presenting cell such as, e.g., a dendritic cell (DC) capable of presenting the peptide to a T-cell.
  • a carrier such as e.g. a protein or an antigen-presenting
  • Adjuvants are any substance whose admixture into a vaccine composition increases or otherwise modifies the immune response to an antigen.
  • Carriers can be scaffold structures, for example a polypeptide or a polysaccharide, to which an antigen, is capable of being associated.
  • adjuvants are conjugated covalently or non-covalently.
  • an adjuvant to increase an immune response to an antigen is typically manifested by a significant or substantial increase in an immune-mediated reaction, or reduction in disease symptoms.
  • an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen
  • an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th response into a primarily cellular, or Th response.
  • Adjuvants such as incomplete Freund's or GM-CSF are useful.
  • GM-CSF Several immunological adjuvants (e.g., MF59) specific for dendritic cells and their preparation have been described previously (Dupuis M, et al., Cell Immunol. 1998; 186(1): 18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11).
  • cytokines can be used.
  • cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen-presenting cells for T-lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat. No. 5,849,589, specifically incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).
  • CpG immunostimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine setting.
  • Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 may also be used.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:CI2U) non-CpG bacterial DNA or RNA
  • immunoactive small molecules and antibodies such as cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafinib, XL-999, CP- 547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which may act therapeutically and/or as an adjuvant.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:CI2U) e.g. polyi:CI2U
  • non-CpG bacterial DNA or RNA as well as immunoactive small molecules and antibodies
  • adjuvants and additives can readily be determined by the skilled artisan without undue experimentation.
  • Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, sargramostim).
  • GM-CSF Granulocyte Macrophage Colony Stimulating Factor
  • a vaccine composition can comprise more than one different adjuvant.
  • a therapeutic composition can comprise any adjuvant substance including any of the above or combinations thereof. It is also contemplated that a vaccine and an adjuvant can be administered together or separately in any appropriate sequence.
  • a carrier can be present independently of an adjuvant.
  • the function of a carrier can for example be to increase the molecular weight of in particular mutant to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life.
  • a carrier can aid presenting peptides to T-cells.
  • a carrier can be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell.
  • a carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid.
  • the carrier is generally a physiologically acceptable carrier acceptable to humans and safe.
  • tetanus toxoid and/or diphtheria toxoid are suitable carriers.
  • the carrier can be dextrans for example Sepharose.
  • Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev.
  • viral vector-based vaccine platforms such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus
  • this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides.
  • the sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science.
  • antigen cassette or “cassette” is meant the combination of a selected antigen or plurality of antigens (e.g., antigen-encoding nucleic acid sequences) and the other regulatory elements necessary to transcribe the antigen(s) and express the transcribed product.
  • antigen cassette or “cassette” is meant the combination of a selected antigen or plurality of antigens (e.g., antigen-encoding nucleic acid sequences) and the other regulatory elements necessary to transcribe the antigen(s) and express the transcribed product.
  • the selected antigen or plurality of antigens can refer to distinct epitope sequences, e.g., an antigen-encoding nucleic acid sequence in the cassette can encode an epitope- encoding nucleic acid sequence (or plurality of epitope-encoding nucleic acid sequences) such that the epitopes are transcribed and expressed.
  • An antigen or plurality of antigens can be operatively linked to regulatory components in a manner which permits transcription. Such components include conventional regulatory elements that can drive expression of the antigen(s) in a cell transfected with the viral vector.
  • the antigen cassette can also contain a selected promoter which is linked to the antigen(s) and located, with other, optional regulatory elements, within the selected viral sequences of the recombinant vector.
  • a cassette can include one or more antigens (e.g., one or more KRAS-associated neoepitopes in the vaccine composition, such as any of the KRAS-associated neoepitopes shown in SEQ ID NOs. 75-82).
  • a cassette can have one or more antigen-encoding nucleic acid sequences, such as a cassette containing multiple antigen-encoding nucleic acid sequences each independently operably linked to separate promoters and/or linked together using other multicistonic systems, such as 2A ribosome skipping sequence elements (e.g., E2A, P2A, F2A, or T2A sequences) or Internal Ribosome Entry Site (IRES) sequence elements.
  • 2A ribosome skipping sequence elements e.g., E2A, P2A, F2A, or T2A sequences
  • IRS Internal Ribosome Entry Site
  • a linker can also have a cleavage site, such as a TEV or furin cleavage site.
  • Linkers with cleavage sites can be used in combination with other elements, such as those in a multi ci str onic system.
  • a furin protease cleavage site can be used in conjuction with a 2A ribosome skipping sequence element such that the furin protease cleavage site is configured to facilitate removal of the 2A sequence following translation.
  • each antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences (e.g., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).
  • Useful promoters can be constitutive promoters or regulated (inducible) promoters, which will enable control of the amount of antigen(s) to be expressed.
  • a desirable promoter is that of the cytomegalovirus immediate early promoter/enhancer [see, e.g., Boshart et al, Cell, 41 :521-530 (1985)].
  • Another desirable promoter includes the Rous sarcoma virus LTR promoter/enhancer.
  • Still another promoter/enhancer sequence is the chicken cytoplasmic betaactin promoter [T. A. Kost et al, Nucl. Acids Res., 11(23):8287 (1983)].
  • Other suitable or desirable promoters can be selected by one of skill in the art.
  • a viral vector comprising a cassette with at least one payload sequence operably linked to a regulatable promoter that is a TET promoter system, such as a TET-On system or TET-Off system.
  • a TET promoter system can be used to minimize transcription of payload nucleic acids encoded in a cassette, such as antigens encoded in a vaccine cassette, during viral production.
  • TET promoter systems are described in detail in international patent application publication WO2020/243719, herein incorporated by reference for all purposes.
  • a TET promoter system can include a tetracycline (TET) repressor protein (TETr) controlled promoter.
  • a viral vector comprising a cassette with at least one payload sequence operably linked to a tetracycline (TET) repressor protein (TETr) controlled promoter.
  • a TETr controlled promoter can include the 19 bp TET operator (TETo) sequence TCCCTATCAGTGATAGAGA (SEQ ID NO:83).
  • TETo 19 bp TET operator
  • a TETr controlled promoter can include 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more TETo nucleic acid sequences.
  • TETr controlled promoter have 2 or more TETo nucleic acid sequences
  • the TETo sequences can be linked together.
  • the TETo sequences can be directly linked together.
  • the TETo sequences can be linked together with a linker sequence, such as a linker sequence having 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 or more nucleotides.
  • a TETr controlled promoter can use any promoter sequence desired, such as a SV40, EF-1, RSV, PGK, HSA, MCK or EBV promoter sequence.
  • a TETr controlled promoter can use a CMV promoter sequence.
  • a TETr controlled promoter can use a minimal CMV promoter sequence.
  • TETo sequences can be upstream (5’) of a promoter sequence region where RNA polymerase binds. In an illustrative example, 7 TETo sequences are upstream (5’) of a promoter sequence.
  • a TETr controlled promoter operably linked to the at least one payload nucleic acid sequence with TETo sequence upstream of the promoter sequence region can have an ordered sequence described in the formula, from 5’ to 3’ :
  • T-LY T-LYX-P-N
  • N a payload nucleic acid sequence
  • P a RNA polymerase binding sequence of the promoter sequence operably linked to payload nucleic acid sequence
  • T is a TETo nucleic acid sequences comprising the nucleotide sequence shown in SEQ ID NO:66
  • a TETo sequences can be downstream (3’) of a promoter sequence region where RNA polymerase binds.
  • 2 TETo sequences are downstream (3’) of a promoter sequence.
  • a TETr controlled promoter operably linked to the at least one payload nucleic acid sequence with TETo sequence downstream of the promoter sequence region can have an ordered sequence described in the formula, from 5’ to 3’:
  • N a payload nucleic acid sequence
  • P a RNA polymerase binding sequence of the promoter sequence operably linked to payload nucleic acid sequence
  • T a TETo nucleic acid sequences comprising the nucleotide sequence shown in SEQ ID NO:66
  • Viral production of vectors with TETr controlled promoters can use any viral production cell line engineered to express a TETr sequence (tTS), such as a 293 cell line or its derivatives (e.g., a 293F cell line) engineered to express tTS.
  • tTS TETr sequence
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production.
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral infectivity defined as viral particles (VP) per infectious unit (IU).
  • VP viral particles
  • IU infectious unit
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 1.5, at least 2, at least 2.5, at least 3, at least 3.5, at least 4, at least 4.5, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10-fold relative to production in a non-tTS- expressing cell.
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100-fold relative to production in a non-tTS-expressing cell.
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 1.5, at least 2, at least 2.5, at least 3, at least 3.5, at least 4, at least 4.5, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10-fold relative to production of a vector not having a TETr controlled promoter.
  • Viral production of vectors with TETr controlled promoters in tTS-expressing cell can improve viral production and/or viral infectivity by at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, or at least 100-fold relative to production of a vector not having a TETr controlled promoter.
  • the antigen cassette can also include nucleic acid sequences heterologous to the viral vector sequences including sequences providing signals for efficient polyadenylation of the transcript (poly(A), poly-A or pA) and introns with functional splice donor and acceptor sites.
  • a common poly-A sequence which is employed in the exemplary vectors of this invention is that derived from the papovavirus SV-40.
  • the poly-A sequence generally can be inserted in the cassette following the antigen-based sequences and before the viral vector sequences.
  • a common intron sequence can also be derived from SV-40, and is referred to as the SV-40 T intron sequence.
  • An antigen cassette can also contain such an intron, located between the promoter/enhancer sequence and the antigen(s).
  • An antigen cassette can have one or more antigens.
  • a given cassette can include 1-10, 1-20, 1-30, 10-20, 15-25, 15-20, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more antigens.
  • Antigens can be linked directly to one another.
  • Antigens can also be linked to one another with linkers.
  • Antigens can be in any orientation relative to one another including N to C or C to N.
  • the antigen cassette can be located in the site of any selected deletion in a viral vector, such as the deleted structural proteins of a VEE backbone or the site of the El gene region deletion or E3 gene region deletion of a ChAd-based vector, among others which may be selected.
  • the antigen cassette can be described using the following formula to describe the ordered sequence of each element, from 5’ to 3’ :
  • N comprises an MHC class I epitope-encoding nucleic acid sequence
  • L5 comprises a 5’ linker sequence
  • L3 comprises a 3’ linker sequence
  • G5 comprises a nucleic acid sequences encoding an amino acid linker
  • G3 comprises one of the at least one nucleic acid sequences encoding an amino acid linker
  • U comprises an MHC class II antigen-encoding nucleic acid sequence, where for each X the corresponding Nc is an epitope encoding nucleic acid sequence, where for each Y the corresponding Uf is a MHC class II epitope-encoding nucleic acid sequence (e.g., universal MHC class II epitope-encoding nucleic acid sequence).
  • a universal sequence can comprise at least one of Tetanus toxoid and PADRE.
  • a universal sequence can comprise a Tetanus toxoid peptide.
  • a universal sequence can comprise a PADRE peptide.
  • a universal sequence can comprise a Tetanus toxoid and PADRE peptides..
  • a vector backbone such as an RNA alphavirus backbone
  • 10 MHC class I epitopes are present
  • a 5’ linker is present for each N
  • a 3’ linker is present for each N
  • 2 MHC class II epitopes are present
  • a linker is present linking the two MHC class II epitopes
  • a linker is present linking the 5’ end of the two MHC class II epitopes to the 3’ linker of the final MHC class I epitope
  • a linker is present linking the 3’ end of the two MHC class II epitopes to the to a vector backbone (e.g., an RNA alphavirus backbone).
  • Examples of linking the 3’ end of the antigen cassette to a vector backbone include linking directly to the 3’ UTR elements provided by the vector backbone, such as a 3’ 19-nt CSE.
  • Examples of linking the 5’ end of the antigen cassette to a vector backbone include linking directly to a promoter or 5’ UTR element of the vector backbone, such as a subgenomic promoter sequence (e.g., a 26S subgenomic promoter sequence), an alphavirus 5’ UTR, a 51 -nt CSE, or a 24-nt CSE.
  • each MHC class I epitope that is present can have a 5’ linker, a 3’ linker, neither, or both.
  • some MHC class I epitopes may have both a 5’ linker and a 3’ linker, while other MHC class I epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • some MHC class I epitopes may have either a 5’ linker or a 3’ linker, while other MHC class I epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • MHC class II epitopes may have both a 5’ linker and a 3’ linker, while other MHC class II epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • some MHC class II epitopes may have either a 5’ linker or a 3’ linker, while other MHC class II epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • each antigen that is present can have a 5’ linker, a 3’ linker, neither, or both.
  • some antigens may have both a 5’ linker and a 3’ linker, while other antigens may have either a 5’ linker, a 3’ linker, or neither.
  • some antigens may have either a 5’ linker or a 3’ linker, while other antigens may have either a 5’ linker, a 3’ linker, or neither.
  • the promoter nucleotide sequences P and/or P2 can be the same as a promoter nucleotide sequence provided by a vector backbone, such as an RNA alphavirus backbone.
  • the promoter sequence provided by the vector backbone, Pn and P2 can each comprise a subgenomic promoter sequence (e.g., a 26S subgenomic promoter sequence) or a CMV promoter.
  • the promoter nucleotide sequences P and/or P2 can be different from the promoter nucleotide sequence provided by a vector backbone (e.g., an RNA alphavirus backbone), as well as can be different from each other.
  • the 5’ linker L5 can be a native sequence or a non -natural sequence.
  • Non-natural sequence include, but are not limited to, AAY, RR, and DPP.
  • the 3’ linker L3 can also be a native sequence or a non-natural sequence. Additionally, L5 and L3 can both be native sequences, both be non-natural sequences, or one can be native and the other non-natural.
  • the amino acid linkers can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,
  • the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • amino acid linker G5 for each Y, can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,
  • the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • the amino acid linker G3 can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,95, 96, 97, 98, 99, 100 or more amino acids in length.
  • G3 can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • each N can encode a MHC class I epitope, a MHC class II epitope, an epitope/antigen capable of stimulating a B cell response, or a combination thereof.
  • each N can encode a combination of a MHC class I epitope, a MHC class II epitope, and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a combination of a MHC class I epitope and a MHC class II epitope.
  • each N can encode a combination of a MHC class I epitope and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a combination of a MHC class II epitope and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a MHC class II epitope.
  • each N can encode an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a MHC class I epitope 7-15 amino acids in length.
  • each N can also encodes a MHC class I epitope 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids in length.
  • each N can also encodes a MHC class I epitope at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode 2 distinct epitope-encoding nucleic acid sequences (e.g., encode 2 distinct infectious disease or tumor derived nucleic acid sequences encoding an immunogenic polypeptide).
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 2 distinct epitopeencoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences (e.g., encode 2 distinct infectious disease or tumor derived nucleic acid sequences encoding an immunogenic polypeptide).
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens be between 375-700 nucleotides in length and encode at least 3 distinct epitopeencoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375- 400 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • an antigen or epitope in a cassette encoding additional antigens and/or epitopes may be an immunodominant epitope relative to the others encoded.
  • Immunodominance in general, is the skewing of an immune response towards only one or a few specific immunogenic peptides. Immunodominance can be assessed as part of an immune monitoring protocol. For example, immunodominance can be assessed through evaluating T cell and/or B cell responses to the encoded antigens.
  • Immunodominance can be assessed as the impact of an immunodominant antigen’s presence on the immune response to one or more other antigens.
  • an immunodominant antigen and its respective immune response e.g., an immunodominant MHC class I epitope
  • an immunodominant antigen and its respective immune response can reduce the immune response of another antigen relative to the immune response in the absence of the immunodominant antigen. This reduction can be such that the immune response in the presence of the immunodominant antigen is not considered a therapeutically effective response.
  • an MHC class I epitope would generally be considered immunodominant if T cell responses to other antigens are no longer considered therapeutically effective responses compared to responses elicited in the absence of the immunodominant MHC class I epitope.
  • an immune response can also be reduced to below a limit of detection or near the limit of detection, relative to the response in the absence of the immunodominant antigen.
  • an MHC class I epitope would generally be considered immunodominant if T cell responses to other antigens are at or below the limit of detection compared to responses elicited in the absence of the immunodominant MHC class I epitope.
  • the assessment of immunodominance is between two antigens both capable of stimulating an immune response, e.g., between two T cell epitopes in a vaccine composition administered to a subject possessing a cognate MHC allele known or predicted to present each epitope, respectively. Immunodominance can be assessed through evaluating relative immune responses to other antigens in the presence and absence of the suspected immunodominant antigen.
  • Immunodominance can be assessed as a relative difference in the immune responses between two or more antigens.
  • Immunodominance can refer to a 5-fold, 10-fold, 20-fold, 30- fold, 40-fold, or 50-fold immune response of a specific antigen relative to another antigen encoded in the same cassette.
  • Immunodominance can refer to a 100-fold, 200-fold, 300-fold, 400-fold, or 500-fold immune response of a specific antigen relative to another antigen encoded in the same cassette.
  • Immunodominance can refer to a 1000-fold, 2000-fold, 3000-fold, 4000- fold, or 5000-fold immune response of a specific antigen relative to another antigen encoded in the same cassette.
  • Immunodominance can refer to a 10,000-fold immune response of a specific antigen relative to another antigen encoded in the same cassette.
  • administering and/or encoding an immunodominant epitope together with additional epitope may reduce the immune response to the additional epitopes, including potentially ultimately reducing vaccine efficacy against the additional epitopes.
  • vaccine compositions including TP53-associated neoepitopes may have the immune response, e.g., a T cell response, skewed towards the TP53-associated neoepitope negatively impacting (e.g., reducing the immune response to where the immune response is not a therapeutically effective response and/or to below a limit of detection) the immune response to other antigens or epitopes in the vaccine composition (e.g., one or more KRAS-associated neoepitopes in the vaccine composition, such as any of the KRAS-associated neoepitopes shown in SEQ ID NOs. 75-82).
  • the immune response e.g., a T cell response
  • the immune response to other antigens or epitopes in the vaccine composition e.g., one or more KRAS-associated neoepitopes in the vaccine composition, such as any of the KRAS-associated neoepitopes shown in SEQ
  • vaccine compositions can be designed to not contain an immunodominant epitope, such as designing a vaccine cassette (e.g., a (neo)antigen-encoding cassette) to not encode an immunodominant epitope.
  • a vaccine cassette e.g., a (neo)antigen-encoding cassette
  • the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope.
  • the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette to below a limit of detection when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope.
  • the cassette does not encode an epitope that reduces an immune response to another epitope encoded in the cassette, wherein the immune response is not a therapeutically effective response, when administered in a vaccine composition to a subject relative to an immune response when the other epitope is administered in the absence of the immunodominant MHC class I epitope.
  • the cassette does not encode an epitope that stimulates a 5-fold, 10-fold, 20-fold, 30-fold, 40-fold, or 50-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject.
  • the cassette does not encode an epitope that stimulates a 100-fold, 200-fold, 300-fold, 400-fold, or 500-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject.
  • the cassette does not encode an epitope that stimulates a 1000-fold, 2000-fold, 3000-fold, 4000-fold, or 5000-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject.
  • the cassette does not encode an epitope that results in a 10,000-fold or greater immune response relative to another epitope encoded in the same cassette in a vaccine composition administered to a subject, where each antigen is capable of stimulating an immune response in the subject.
  • Vectors described herein can comprise a nucleic acid which encodes at least one antigen and the same or a separate vector can comprise a nucleic acid which encodes at least one immune modulator.
  • An immune modulator can include a binding molecule (e.g., an antibody such as an scFv) which binds to and blocks the activity of an immune checkpoint molecule.
  • An immune modulator can include a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL- 15, or IL-21.
  • An immune modulator can include a modified cytokine (e.g., peglL- 2).
  • Vectors can comprise an antigen cassette and one or more nucleic acid molecules encoding an immune modulator.
  • Illustrative immune checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, 4-1BB (CD137), 4-1BBL (CD137L), PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, y6, and memory CD8+ (aP) T cells), CD160 (also referred to as BY55), and CGEN-15049.
  • CTLA-4 CTLA-4
  • 4-1BB CD137
  • 4-1BBL CD137L
  • Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4, CD160, and CGEN-15049.
  • Illustrative immune checkpoint inhibitors include Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD-L1 monoclonal Antibody (Anti-B7-Hl; MEDI4736), ipilimumab, MK-3475 (PD-1 blocker), Nivolumab (anti-PDl antibody), Cemiplimab (anti-PDl antibody), CT-011 (anti-PDl antibody), BY55 monoclonal antibody, AMP224 (anti-PDLl antibody), BMS-936559 (anti-PDLl antibody), MPLDL3280A/Atezolizumab (anti-PDLl antibody), MSB0010718C (anti-PDLl antibody) and Yervoy/ipilimumab (anti-CTLA-4 checkpoint inhibitor).
  • CTLA-4 blocking antibody PD-L1 monoclonal Antibody
  • Anti-B7-Hl MEDI4736
  • ipilimumab MK-3475
  • Antibody-encoding sequences can be engineered into vectors such as C68 using ordinary skill in the art.
  • An exemplary method is described in Fang et al., Stable antibody expression at therapeutic levels using the 2A peptide. Nat Biotechnol. 2005 May;23(5):584-90. Epub 2005 Apr 17; herein incorporated by reference for all purposes.
  • Truncal peptides meaning those presented by all or most tumor subclones, can be prioritized for inclusion into a vaccine.
  • further peptides can be prioritized by estimating the number and identity of tumor subclones and choosing peptides so as to maximize the number of tumor subclones covered by a vaccine.
  • an integrated multi-dimensional model can be considered that places candidate antigens in a space with at least the following axes and optimizes selection using an integrative approach.
  • HLA genes large number of HLA molecules involved in the presentation of a set of antigens may lower the probability that a tumor will escape immune attack via downregulation or mutation of HLA molecules
  • antigens can be deprioritized (e.g., excluded) from the vaccination if they are predicted to be presented by HLA alleles lost or inactivated in either all or part of the patient’s tumor.
  • HLA allele loss can occur by either somatic mutation, loss of heterozygosity, or homozygous deletion of the locus.
  • Methods for detection of HLA allele somatic mutation are well known in the art, e.g. (Shukla et al., 2015). Methods for detection of somatic LOH and homozygous deletion (including for HLA locus) are likewise well described.
  • Antigens can also be deprioritized if mass-spectrometry data indicates a predicted antigen is not presented by a predicted HLA allele.
  • Alphaviruses are members of the family Togaviridae, and are positive-sense single stranded RNA viruses. Members are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbial Review 1994).
  • Old World such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses
  • New World such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbial Review 1994).
  • a natural alphavirus genome is typically around 12kb in length, the first two-thirds of which contain genes encoding non- structural proteins (nsPs) that form RNA replication complexes for self-replication of the viral genome, and the last third of which contains a subgenomic expression cassette encoding structural proteins for virion production (Frolov RNA 2001).
  • nsPs non- structural proteins
  • a model lifecycle of an alphavirus involves several distinct steps (Strauss Microbial Review 1994, Jose Future Microbiol 2009). Following virus attachment to a host cell, the virion fuses with membranes within endocytic compartments resulting in the eventual release of genomic RNA into the cytosol.
  • the genomic RNA which is in a plus-strand orientation and comprises a 5’ methylguanylate cap and 3’ polyA tail, is translated to produce non- structural proteins nsPl-4 that form the replication complex. Early in infection, the plus-strand is then replicated by the complex into a minus-stand template.
  • the replication complex is further processed as infection progresses, with the resulting processed complex switching to transcription of the minus-strand into both full-length positive-strand genomic RNA, as well as the 26S subgenomic positive-strand RNA containing the structural genes.
  • CSEs conserved sequence elements of alphavirus have been identified to potentially play a role in the various RNA replication steps including; a complement of the 5’ UTR in the replication of plus-strand RNAs from a minus-strand template, a 51 -nt CSE in the replication of minus-strand synthesis from the genomic template, a 24-nt CSE in the junction region between the nsPs and the 26S RNA in the transcription of the subgenomic RNA from the minus-strand, and a 3’ 19-nt CSE in minus-strand synthesis from the plus-strand template.
  • CSEs conserved sequence elements
  • virus particles are then typically assembled in the natural lifecycle of the virus.
  • the 26S RNA is translated and the resulting proteins further processed to produce the structural proteins including capsid protein, glycoproteins El and E2, and two small polypeptides E3 and 6K (Strauss 1994). Encapsidation of viral RNA occurs, with capsid proteins normally specific for only genomic RNA being packaged, followed by virion assembly and budding at the membrane surface.
  • Alphavirus as a delivery vector
  • Alphaviruses can be used to generate alphavirus-based delivery vectors (also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, selfamplifying mRNA (SAM) vectors, or samRNA vectors).
  • alphavirus vectors also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, selfamplifying mRNA (SAM) vectors, or samRNA vectors.
  • Alphaviruses have previously been engineered for use as expression vector systems (Pushko 1997, Rheme 2004). Alphaviruses offer several advantages, particularly in a vaccine setting where heterologous antigen expression can be desired.
  • alphavirus vectors Due to its ability to self-replicate in the host cytosol, alphavirus vectors are generally able to produce high copy numbers of the expression cassette within a cell resulting in a high level of heterologous antigen production. Additionally, the vectors are generally transient, resulting in improved biosafety as well as reduced induction of immunological tolerance to the vector.
  • the public in general, also lacks pre-existing immunity to alphavirus vectors as compared to other standard viral vectors, such as human adenovirus.
  • Alphavirus based vectors also generally result in cytotoxic responses to infected cells. Cytotoxicity, to a certain degree, can be important in a vaccine setting to properly stimulate an immune response to the heterologous antigen expressed.
  • an antigen expression vector described herein can utilize an alphavirus backbone that allows for a high level of antigen expression, stimulates a robust immune response to antigen, does not stimulate an immune response to the vector itself, and can be used in a safe manner.
  • the antigen expression cassette can be designed to stimulate different levels of an immune response through optimization of which alphavirus sequences the vector uses, including, but not limited to, sequences derived from VEE or its attenuated derivative TC-83.
  • a alphavirus vector design includes inserting a second copy of the 26S promoter sequence elements downstream of the structural protein genes, followed by a heterologous gene (Frolov 1993).
  • a heterologous gene (Frolov 1993).
  • an additional subgenomic RNA is produced that expresses the heterologous protein.
  • Another expression vector design makes use of helper virus systems (Pushko 1997). In this strategy, the structural proteins are replaced by a heterologous gene.
  • the 26S subgenomic RNA provides for expression of the heterologous protein.
  • additional vectors that expresses the structural proteins are then supplied in trans, such as by co-transfection of a cell line, to produce infectious virus.
  • a system is described in detail in USPN 8,093,021, which is herein incorporated by reference in its entirety, for all purposes.
  • the helper vector system provides the benefit of limiting the possibility of forming infectious particles and, therefore, improves biosafety.
  • the helper vector system reduces the total vector length, potentially improving the replication and expression efficiency.
  • an example of an antigen expression vector described herein can utilize an alphavirus backbone wherein the structural proteins are replaced by an antigen cassette, the resulting vector both reducing biosafety concerns, while at the same time promoting efficient expression due to the reduction in overall expression vector size.
  • Alphavirus delivery vectors are generally positive-sense RNA polynucleotides.
  • a convenient technique well-known in the art for RNA production is in vitro transcription IVT.
  • a DNA template of the desired vector is first produced by techniques well-known to those in the art, including standard molecular biology techniques such as cloning, restriction digestion, ligation, gene synthesis (e.g., chemical and/or enzymatic synthesis), and polymerase chain reaction (PCR).
  • the DNA template contains a RNA polymerase promoter at the 5’ end of the sequence desired to be transcribed into RNA. Promoters include, but are not limited to, bacteriophage polymerase promoters such as T3, T7, or SP6.
  • RNA polymerase enzyme RNA polymerase enzyme
  • buffer agents RNA polymerase enzyme
  • NTPs nucleotides
  • the resulting RNA polynucleotide can optionally be further modified including, but limited to, addition of a 5’ cap structure such as 7-methylguanosine or a related structure, and optionally modifying the 3’ end to include a polyadenylate (poly A) tail.
  • the RNA can then be purified using techniques well-known in the field, such as phenol-chloroform extraction or column purification (e.g., chromatography -based purification).
  • An important aspect to consider in vaccine vector design is immunity against the vector itself (Riley 2017). This may be in the form of preexisting immunity to the vector itself, such as with certain human adenovirus systems, or in the form of developing immunity to the vector following administration of the vaccine. The latter is an important consideration if multiple administrations of the same vaccine are performed, such as separate priming and boosting doses, or if the same vaccine vector system is to be used to deliver different antigen cassettes.
  • alphavirus vectors the standard delivery method is the previously discussed helper virus system that provides capsid, El, and E2 proteins in trans to produce infectious viral particles.
  • helper virus system that provides capsid, El, and E2 proteins in trans to produce infectious viral particles.
  • El and E2 proteins are often major targets of neutralizing antibodies (Strauss 1994).
  • the efficacy of using alphavirus vectors to deliver antigens of interest to target cells may be reduced if infectious particles are targeted by neutralizing antibodies.
  • Nanomaterials can be made of non-immunogenic materials and generally avoid eliciting immunity to the delivery vector itself.
  • These materials can include, but are not limited to, lipids, inorganic nanomaterials, and other polymeric materials.
  • Lipids can be cationic, anionic, or neutral. The materials can be synthetic or naturally derived, and in some instances biodegradable.
  • Lipids can include fats, cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, and fat soluble vitamins.
  • PEG polyethyleneglycol
  • Lipid nanoparticles are an attractive delivery system due to the amphiphilic nature of lipids enabling formation of membranes and vesicle like structures (Riley 2017). In general, these vesicles deliver the expression vector by absorbing into the membrane of target cells and releasing nucleic acid into the cytosol. In addition, LNPs can be further modified or functionalized to facilitate targeting of specific cell types. Another consideration in LNP design is the balance between targeting efficiency and cytotoxicity. Lipid compositions generally include defined mixtures of cationic, neutral, anionic, and amphipathic lipids.
  • lipid composition can influence overall LNP size and stability.
  • the lipid composition comprises dilinoleylmethyl- 4-dimethylaminobutyrate (MC3) or MC3-like molecules.
  • MC3 and MC3-like lipid compositions can be formulated to include one or more other lipids, such as a PEG or PEG- conjugated lipid, a sterol, or neutral lipids.
  • Nucleic-acid vectors such as expression vectors, exposed directly to serum can have several undesirable consequences, including degradation of the nucleic acid by serum nucleases or off-target stimulation of the immune system by the free nucleic acids. Therefore, encapsulation of the alphavirus vector can be used to avoid degradation, while also avoiding potential off-target affects.
  • an alphavirus vector is fully encapsulated within the delivery vehicle, such as within the aqueous interior of an LNP. Encapsulation of the alphavirus vector within an LNP can be carried out by techniques well-known to those skilled in the art, such as microfluidic mixing and droplet generation carried out on a microfluidic droplet generating device.
  • Such devices include, but are not limited to, standard T-junction devices or flow-focusing devices.
  • the desired lipid formulation such as MC3 or MC3-like containing compositions
  • the droplet generating device can control the size range and size distribution of the LNPs produced.
  • the LNP can have a size ranging from 1 to 1000 nanometers in diameter, e.g., 1, 10, 50, 100, 500, or 1000 nanometers.
  • the delivery vehicles encapsulating the expression vectors can be further treated or modified to prepare them for administration.
  • V.E.l. Viral delivery with chimpanzee adenovirus
  • Vaccine compositions for delivery of one or more antigens can be created by providing adenovirus nucleotide sequences of chimpanzee origin, a variety of novel vectors, and cell lines expressing chimpanzee adenovirus genes.
  • a nucleotide sequence of a chimpanzee C68 adenovirus (also referred to herein as ChAdV68) can be used in a vaccine composition for antigen delivery (See SEQ ID NO: 1).
  • C68 adenovirus derived vectors Use of C68 adenovirus derived vectors is described in further detail in USPN 6,083,716, which is herein incorporated by reference in its entirety, for all purposes. ChAdV68- based vectors and delivery systems are described in detail in US App. Pub. No.
  • a recombinant adenovirus comprising the DNA sequence of a chimpanzee adenovirus such as C68 and an antigen cassette operatively linked to regulatory sequences directing its expression.
  • the recombinant virus is capable of infecting a mammalian, preferably a human, cell and capable of expressing the antigen cassette product in the cell.
  • the native chimpanzee El gene, and/or E3 gene, and/or E4 gene can be deleted.
  • An antigen cassette can be inserted into any of these sites of gene deletion.
  • the antigen cassette can include an antigen against which a primed immune response is desired.
  • a mammalian cell infected with a chimpanzee adenovirus such as C68.
  • a novel mammalian cell line which expresses a chimpanzee adenovirus gene (e.g., from C68) or functional fragment thereof.
  • a method for delivering an antigen cassette into a mammalian cell comprising the step of introducing into the cell an effective amount of a chimpanzee adenovirus, such as C68, that has been engineered to express the antigen cassette.
  • Still another aspect provides a method for stimulating an immune response in a mammalian host to treat cancer.
  • the method can comprise the step of administering to the host an effective amount of a recombinant chimpanzee adenovirus, such as C68, comprising an antigen cassette that encodes one or more antigens from the tumor against which the immune response is targeted.
  • a recombinant chimpanzee adenovirus such as C68
  • Still another aspect provides a method for stimulating an immune response in a mammalian host to treat or prevent a disease in a subject, such as cancer.
  • the method can comprise the step of administering to the host an effective amount of a recombinant chimpanzee adenovirus, such as C68, comprising an antigen cassette that encodes one or more antigens, such as from the cancer/tumor against which the immune response is targeted.
  • a non-simian mammalian cell that expresses a chimpanzee adenovirus gene obtained from the sequence of SEQ ID NO: 1.
  • the gene can be selected from the group consisting of the adenovirus El A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4 and L5 of SEQ ID NO: 1.
  • nucleic acid molecule comprising a chimpanzee adenovirus DNA sequence comprising a gene obtained from the sequence of SEQ ID NO: 1.
  • the gene can be selected from the group consisting of said chimpanzee adenovirus El A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4 and L5 genes of SEQ ID NO: 1.
  • the nucleic acid molecule comprises SEQ ID NO: 1.
  • the nucleic acid molecule comprises the sequence of SEQ ID NO: 1, lacking at least one gene selected from the group consisting of El A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4 and L5 genes of SEQ ID NO: 1.
  • a vector comprising a chimpanzee adenovirus DNA sequence obtained from SEQ ID NO: 1 and an antigen cassette operatively linked to one or more regulatory sequences which direct expression of the cassette in a heterologous host cell, optionally wherein the chimpanzee adenovirus DNA sequence comprises at least the ciselements necessary for replication and virion encapsidation, the cv.s-elements flanking the antigen cassette and regulatory sequences.
  • the chimpanzee adenovirus DNA sequence comprises a gene selected from the group consisting of El A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4 and L5 gene sequences of SEQ ID NO: 1.
  • the vector can lack the El A and/or E1B gene.
  • adenovirus vector comprising: a partially deleted E4 gene comprising a deleted or partially-deleted E4orf2 region and a deleted or partially-deleted E4orf3 region, and optionally a deleted or partially-deleted E4orf4 region.
  • the partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO: 1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO: 1.
  • the partially deleted E4 can comprise an E4 deletion of at least a partial deletion of nucleotides 34,916 to 34,942 of the sequence shown in SEQ ID NO: 1, at least a partial deletion of nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO: 1, and at least a partial deletion of nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO: 1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO: 1
  • the partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO: 1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO: 1.
  • the partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO: 1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO: 1.
  • the partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E40rf2, a fully deleted E40rf3, and at least a partial deletion of E40rf4.
  • the partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E40rf2, at least a partial deletion of E40rf3, and at least a partial deletion of E40rf4.
  • the partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orfl, a fully deleted E40rf2, and at least a partial deletion of E40rf3.
  • the partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E40rf2 and at least a partial deletion of E40rf3.
  • the partially deleted E4 can comprise an E4 deletion between the start site of E4Orfl to the start site of E40rf5.
  • the partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orfl.
  • the partially deleted E4 can be an E4 deletion adjacent to the start site of E40rf2.
  • the partially deleted E4 can be an E4 deletion adjacent to the start site of E40rf3.
  • the partially deleted E4 can be an E4 deletion adjacent to the start site of E40rf4.
  • the E4 deletion can be at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, at least 1200, at least 1300, at least 1400, at least 1500, at least 1600, at least 1700, at least 1800, at least 1900, or at least 2000 nucleotides.
  • the E4 deletion can be at least 700 nucleotides.
  • the E4 deletion can be at least 1500 nucleotides.
  • the E4 deletion can be 50 or less, 100 or less, 200 or less, 300 or less, 400 or less, 500 or less, 600 or less, 700 or less, 800 or less, 900 or less, 1000 or less, 1100 or less, 1200 or less, 1300 or less, 1400 or less, 1500 or less, 1600 or less, 1700 or less, 1800 or less, 1900 or less, or 2000 or less nucleotides.
  • the E4 deletion can be 750 nucleotides or less.
  • the E4 deletion can be at least 1550 nucleotides or less.
  • a partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO: 1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO: 1.
  • a partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO: 1 that lacks the E4 gene sequence shown in SEQ ID NO: 1 and that lacks at least nucleotides 34,916 to 34,942, nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO: 1, and nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO: 1.
  • a partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO: 1 and that lacks at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO: 1.
  • a partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO: 1 and that lacks at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO: 1.
  • the adenovirus vector having A partially deleted E4 gene can have a cassette, wherein the cassette comprises at least one payload nucleic acid sequence, and wherein the cassette comprises at least one promoter sequence operably linked to the at least one payload nucleic acid sequence.
  • the adenovirus vector having A partially deleted E4 gene can have one or more genes or regulatory sequences of the ChAdV68 sequence shown in SEQ ID NO: 1, optionally wherein the one or more genes or regulatory sequences comprise at least one of the chimpanzee adenovirus inverted terminal repeat (ITR), El A, E1B, E2A, E2B, E3, E4, LI, L2, L3, L4, and L5 genes of the sequence shown in SEQ ID NO: 1.
  • ITR chimpanzee adenovirus inverted terminal repeat
  • the adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO: 1, wherein A partially deleted E4 gene is 3’ of the nucleotides 2 to 34,915, and optionally the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO: 1 corresponding to an El deletion and/or lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO: 1 corresponding to an E3 deletion.
  • the adenovirus vector having A partially deleted E4 gene can have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO: 1, and wherein A partially deleted E4 gene is 5’ of the nucleotides 35,643 to 36,518.
  • the adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO: 1, wherein A partially deleted E4 gene is 3’ of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO: 1 corresponding to an El deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO: 1 corresponding to an E3 deletion.
  • the adenovirus vector having A partially deleted E4 gene can have nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO: 1, wherein A partially deleted E4 gene is 3’ of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO: 1 corresponding to an El deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO: 1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO: 1, and wherein A partially deleted E4 gene is 5’ of the nucleotides 35,643 to 36,518.
  • a partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO: 1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO: 1, nucleotides 2 to 34,915 of the sequence shown in SEQ ID NO: 1, wherein A partially deleted E4 gene is 3’ of the nucleotides 2 to 34,915, the nucleotides 2 to 34,915 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO: 1 corresponding to an El deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO: 1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO: 1, and wherein A partially deleted E4 gene is 5’ of the nucleotides 35,643 to 36,518.
  • Also disclosed herein is a host cell transfected with a vector disclosed herein such as a C68 vector engineered to expression an antigen cassette. Also disclosed herein is a human cell that expresses a selected gene introduced therein through introduction of a vector disclosed herein into the cell.
  • Also disclosed herein is a method for delivering an antigen cassette to a mammalian cell comprising introducing into said cell an effective amount of a vector disclosed herein, such as a ChAd vector or self-amplifying RNA vector engineered to express an antigen cassette.
  • a vector disclosed herein such as a ChAd vector or self-amplifying RNA vector engineered to express an antigen cassette.
  • Also disclosed herein is a method for producing an antigen comprising introducing a vector disclosed herein into a mammalian cell, culturing the cell under suitable conditions and producing the antigen.
  • the function of the deleted gene region if essential to the replication and infectivity of the virus, can be supplied to the recombinant virus by a helper virus or cell line, i.e., a complementation or packaging cell line.
  • a helper virus or cell line i.e., a complementation or packaging cell line.
  • a cell line can be used which expresses the El gene products of the human or chimpanzee adenovirus; such a cell line can include HEK293 or variants thereof.
  • the protocol for the generation of the cell lines expressing the chimpanzee El gene products (Examples 3 and 4 of USPN 6,083,716) can be followed to generate a cell line which expresses any selected chimpanzee adenovirus gene.
  • An AAV augmentation assay can be used to identify a chimpanzee adenovirus El- expressing cell line. This assay is useful to identify El function in cell lines made by using the El genes of other uncharacterized adenoviruses, e.g., from other species. That assay is described in Example 4B of USPN 6,083,716.
  • a selected chimpanzee adenovirus gene can be under the transcriptional control of a promoter for expression in a selected parent cell line.
  • Inducible or constitutive promoters can be employed for this purpose.
  • inducible promoters are included the sheep metallothionine promoter, inducible by zinc, or the mouse mammary tumor virus (MMTV) promoter, inducible by a glucocorticoid, particularly, dexamethasone.
  • MMTV mouse mammary tumor virus
  • Other inducible promoters such as those identified in International patent application WO95/13392, incorporated by reference herein can also be used in the production of packaging cell lines.
  • a parent cell can be selected for the generation of a novel cell line expressing any desired C68 gene.
  • a parent cell line can be HeLa [ATCC Accession No. CCL 2], A549 [ATCC Accession No. CCL 185], KB [CCL 17], Detroit [e.g., Detroit 510, CCL 72] and WI-38 [CCL 75] cells.
  • Other suitable parent cell lines can be obtained from other sources.
  • Parent cell lines can include CHO, HEK293 or variants thereof, 911, HeLa, A549, LP- 293, PER.C6, or AEl-2a.
  • An El -expressing cell line can be useful in the generation of recombinant chimpanzee adenovirus El deleted vectors.
  • Cell lines constructed using essentially the same procedures that express one or more other chimpanzee adenoviral gene products are useful in the generation of recombinant chimpanzee adenovirus vectors deleted in the genes that encode those products.
  • cell lines which express other human Ad El gene products are also useful in generating chimpanzee recombinant Ads.
  • compositions disclosed herein can comprise viral vectors, that deliver at least one antigen to cells.
  • viral vectors comprise a chimpanzee adenovirus DNA sequence such as C68 and an antigen cassette operatively linked to regulatory sequences which direct expression of the cassette.
  • the C68 vector is capable of expressing the cassette in an infected mammalian cell.
  • the C68 vector can be functionally deleted in one or more viral genes.
  • An antigen cassette comprises at least one antigen under the control of one or more regulatory sequences such as a promoter.
  • Optional helper viruses and/or packaging cell lines can supply to the chimpanzee viral vector any necessary products of deleted adenoviral genes.
  • the term "functionally deleted” means that a sufficient amount of the gene region is removed or otherwise altered, e.g., by mutation or modification, so that the gene region is no longer capable of producing one or more functional products of gene expression. Mutations or modifications that can result in functional deletions include, but are not limited to, nonsense mutations such as introduction of premature stop codons and removal of canonical and non- canonical start codons, mutations that alter mRNA splicing or other transcriptional processing, or combinations thereof. If desired, the entire gene region can be removed.
  • nucleic acid sequences forming the vectors disclosed herein including sequence deletions, insertions, and other mutations may be generated using standard molecular biological techniques and are within the scope of this invention.
  • the chimpanzee adenovirus C68 vectors useful in this invention include recombinant, defective adenoviruses, that is, chimpanzee adenovirus sequences functionally deleted in the El a or Elb genes, and optionally bearing other mutations, e.g., temperature-sensitive mutations or deletions in other genes. It is anticipated that these chimpanzee sequences are also useful in forming hybrid vectors from other adenovirus and/or adeno-associated virus sequences. Homologous adenovirus vectors prepared from human adenoviruses are described in the published literature [see, for example, Kozarsky I and II, cited above, and references cited therein, U.S. Pat. No. 5,240,846],
  • a range of adenovirus nucleic acid sequences can be employed in the vectors.
  • a vector comprising minimal chimpanzee C68 adenovirus sequences can be used in conjunction with a helper virus to produce an infectious recombinant virus particle.
  • the helper virus provides essential gene products required for viral infectivity and propagation of the minimal chimpanzee adenoviral vector.
  • the deleted gene products can be supplied in the viral vector production process by propagating the virus in a selected packaging cell line that provides the deleted gene functions in trans.
  • a minimal chimpanzee Ad C68 virus is a viral particle containing just the adenovirus cis-elements necessary for replication and virion encapsidation. That is, the vector contains the cis-acting 5' and 3' inverted terminal repeat (ITR) sequences of the adenoviruses (which function as origins of replication) and the native 5' packaging/enhancer domains (that contain sequences necessary for packaging linear Ad genomes and enhancer elements for the El promoter).
  • ITR inverted terminal repeat
  • Recombinant, replication-deficient adenoviruses can also contain more than the minimal chimpanzee adenovirus sequences.
  • Ad vectors can be characterized by deletions of various portions of gene regions of the virus, and infectious virus particles formed by the optional use of helper viruses and/or packaging cell lines.
  • suitable vectors may be formed by deleting all or a sufficient portion of the C68 adenoviral immediate early gene Ela and delayed early gene Elb, so as to eliminate their normal biological functions.
  • Replication-defective El -deleted viruses are capable of replicating and producing infectious virus when grown on a chimpanzee adenovirus-transformed, complementation cell line containing functional adenovirus Ela and Elb genes which provide the corresponding gene products in trans.
  • the resulting recombinant chimpanzee adenovirus is capable of infecting many cell types and can express antigen(s), but cannot replicate in most cells that do not carry the chimpanzee El region DNA unless the cell is infected at a very high multiplicity of infection.
  • all or a portion of the C68 adenovirus delayed early gene E3 can be eliminated from the chimpanzee adenovirus sequence which forms a part of the recombinant virus.
  • Chimpanzee adenovirus C68 vectors can also be constructed having a deletion of the E4 gene. Still another vector can contain a deletion in the delayed early gene E2a.
  • Deletions can also be made in any of the late genes LI through L5 of the chimpanzee C68 adenovirus genome. Similarly, deletions in the intermediate genes IX and IVa2 can be useful for some purposes. Other deletions may be made in the other structural or non- structural adenovirus genes.
  • deletions can be used individually, i.e., an adenovirus sequence can contain deletions of El only. Alternatively, deletions of entire genes or portions thereof effective to destroy or reduce their biological activity can be used in any combination.
  • the adenovirus C68 sequence can have deletions of the El genes and the E4 gene, or of the El, E2a and E3 genes, or of the El and E3 genes, or of El, E2a and E4 genes, with or without deletion of E3, and so on. As discussed above, such deletions can be used in combination with other mutations, such as temperature-sensitive mutations, to achieve a desired result.
  • the cassette comprising antigen(s) be inserted optionally into any deleted region of the chimpanzee C68 Ad virus. Alternatively, the cassette can be inserted into an existing gene region to disrupt the function of that region, if desired.
  • helper adenovirus or non-replicating virus fragment can be used to provide sufficient chimpanzee adenovirus gene sequences to produce an infective recombinant viral particle containing the cassette.
  • Useful helper viruses contain selected adenovirus gene sequences not present in the adenovirus vector construct and/or not expressed by the packaging cell line in which the vector is transfected.
  • a helper virus can be replication-defective and contain a variety of adenovirus genes in addition to the sequences described above.
  • the helper virus can be used in combination with the El -expressing cell lines described herein.
  • the "helper" virus can be a fragment formed by clipping the C terminal end of the C68 genome with SspI, which removes about 1300 bp from the left end of the virus. This clipped virus is then co-transfected into an El -expressing cell line with the plasmid DNA, thereby forming the recombinant virus by homologous recombination with the C68 sequences in the plasmid.
  • Assembly of the selected DNA sequences of the adenovirus, the antigen cassette, and other vector elements into various intermediate plasmids and shuttle vectors, and the use of the plasmids and vectors to produce a recombinant viral particle can all be achieved using conventional techniques.
  • Such techniques include conventional cloning techniques of cDNA, in vitro recombination techniques (e.g., Gibson assembly), use of overlapping oligonucleotide sequences of the adenovirus genomes, polymerase chain reaction, and any suitable method which provides the desired nucleotide sequence.
  • Standard transfection and co-transfection techniques are employed, e.g., CaPO4 precipitation techniques or liposome-mediated transfection methods such as lipofectamine.
  • Other conventional methods employed include homologous recombination of the viral genomes, plaquing of viruses in agar overlay, methods of measuring signal generation, and the like.
  • the vector can be transfected in vitro in the presence of a helper virus into the packaging cell line. Homologous recombination occurs between the helper and the vector sequences, which permits the adenovirus-antigen sequences in the vector to be replicated and packaged into virion capsids, resulting in the recombinant viral vector particles.
  • the resulting recombinant chimpanzee C68 adenoviruses are useful in transferring an antigen cassette to a selected cell.
  • the El -deleted recombinant chimpanzee adenovirus demonstrates utility in transferring a cassette to a non-chimpanzee, preferably a human, cell.
  • the resulting recombinant chimpanzee C68 adenovirus containing the antigen cassette (produced by cooperation of the adenovirus vector and helper virus or adenoviral vector and packaging cell line, as described above) thus provides an efficient gene transfer vehicle which can deliver antigen(s) to a subject in vivo or ex vivo.
  • a chimpanzee viral vector bearing an antigen cassette can be administered to a patient, preferably suspended in a biologically compatible solution or pharmaceutically acceptable delivery vehicle.
  • a suitable vehicle includes sterile saline.
  • Other aqueous and non-aqueous isotonic sterile injection solutions and aqueous and non-aqueous sterile suspensions known to be pharmaceutically acceptable carriers and well known to those of skill in the art may be employed for this purpose.
  • the chimpanzee adenoviral vectors are administered in sufficient amounts to transduce the human cells and to provide sufficient levels of antigen transfer and expression to provide a therapeutic benefit without undue adverse or with medically acceptable physiological effects, which can be determined by those skilled in the medical arts.
  • Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to the liver, intranasal, intravenous, intramuscular, subcutaneous, intradermal, oral and other parental routes of administration. Routes of administration may be combined, if desired.
  • Dosages of the viral vector will depend primarily on factors such as the condition being treated, the age, weight and health of the patient, and may thus vary among patients. The dosage will be adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
  • the levels of expression of antigen(s) can be monitored to determine the frequency of dosage administration.
  • Recombinant, replication defective adenoviruses can be administered in a "pharmaceutically effective amount", that is, an amount of recombinant adenovirus that is effective in a route of administration to transfect the desired cells and provide sufficient levels of expression of the selected gene to provide a vaccinal benefit, i.e., some measurable level of protective immunity.
  • C68 vectors comprising an antigen cassette can be co-administered with adjuvant.
  • Adjuvant can be separate from the vector (e.g., alum) or encoded within the vector, in particular if the adjuvant is a protein. Adjuvants are well known in the art.
  • routes of administration include, but are not limited to, intranasal, intramuscular, intratracheal, subcutaneous, intradermal, rectal, oral and other parental routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the immunogen or the disease. For example, in prophylaxis of rabies, the subcutaneous, intratracheal and intranasal routes are preferred. The route of administration primarily will depend on the nature of the disease being treated.
  • the levels of immunity to antigen(s) can be monitored to determine the need, if any, for boosters. Following an assessment of antibody titers in the serum, for example, optional booster immunizations may be desired.
  • An antigen can be administered in an amount sufficient to stimulate a CTL response.
  • An antigen can be administered in an amount sufficient to stimulate a T cell response.
  • An antigen can be administered in an amount sufficient to stimulate a B cell response.
  • An antigen can be administered in an amount sufficient to stimulate both a T cell response and a B cell response
  • An antigen can be administered alone or in combination with other therapeutic agents.
  • Therapeutic agents can include those that target an infectious disease organism, such as an anti-viral or antibiotic agent.
  • a subject can be further administered an anti- immunosuppressive/immunostimulatory agent such as a checkpoint inhibitor.
  • an anti-CTLA antibody or anti-PD-1 or anti-PD-Ll can enhance the immune response to cancerous cells in the patient.
  • CTLA-4 blockade has been shown effective when following a vaccination protocol.
  • an antigen or its variant can be prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, intramuscular (i.m.) injection.
  • Methods of injection include s.c., i.d., i.p., i.m., and i.v.
  • Methods of DNA or RNA injection include i.d., i.m., s.c., i.p. and i.v.
  • Other methods of administration of the vaccine composition are known to those skilled in the art.
  • a vaccine can be compiled so that the selection, number and/or amount of antigens present in the composition is/are tissue, cancer, infectious disease, and/or patient-specific. For instance, the exact selection of peptides can be guided by expression patterns of the parent proteins in a given tissue or guided by mutation or disease status of a patient. The selection can be dependent on the specific type of cancer, the status of the disease, the goal of the vaccination (e.g., preventative or targeting an ongoing disease), earlier treatment regimens, the immune status of the patient, and, of course, the HLA-haplotype of the patient. Furthermore, a vaccine can contain individualized components, according to personal needs of the particular patient. Examples include varying the selection of antigens according to the expression of the antigen in the particular patient or adjustments for secondary treatments following a first round or scheme of treatment.
  • a patient can be identified for administration of an antigen vaccine through the use of various diagnostic methods, e.g., patient selection methods described further below.
  • Patient selection can involve identifying mutations in, or expression patterns of, one or more genes.
  • patient selection involves identifying the haplotype of the patient.
  • the various patient selection methods can be performed in parallel, e.g., a sequencing diagnostic can identify both the mutations and the haplotype of a patient.
  • the various patient selection methods can be performed sequentially, e.g., one diagnostic test identifies the mutations and separate diagnostic test identifies the haplotype of a patient, and where each test can be the same (e.g., both high- throughput sequencing) or different (e.g., one high-throughput sequencing and the other Sanger sequencing) diagnostic methods.
  • compositions to be used as a vaccine for cancer or an infectious disease antigens with similar normal self-peptides that are expressed in high amounts in normal tissues can be avoided or be present in low amounts in a composition described herein.
  • the tumor or infected cell of a patient expresses high amounts of a certain antigen
  • the respective pharmaceutical composition for treatment of this cancer or infection can be present in high amounts and/or more than one antigen specific for this particularly antigen or pathway of this antigen can be included.
  • compositions comprising an antigen can be administered to an individual already suffering from cancer.
  • compositions are administered to a subject in an amount sufficient to stimulate an immune response, such as stimulating an effective CTL response to the tumor antigen and to cure or at least partially arrest symptoms and/or complications.
  • An immune response can include a reduction in tumor size or volume.
  • Reduction in tumor size or volume can include at least a 5%, at least a 10%, at least a 15%, at least a 20%, at least a 25%, at least a 30%, at least a 35%, at least a 40%, at least a 45%, at least a 50%, at least a 55%, at least a 60%, at least a 65%, at least a 70%, at least a 75%, at least a 80%, at least a 85%, at least a 90%, or at least a 95% reduction.
  • Reduction in tumor size or volume can include at least a 15% reduction.
  • Reduction in tumor size or volume can include at least a 20% reduction.
  • An immune response can include stabilization of tumor size or volume.
  • An immune response can result in amelioration of a subject’s disease, such a complete response (CR), partial response (PR), or stable disease (SD) (e.g., as assessed by criteria set forth in a clinical study).
  • An amount adequate to accomplish this is defined as a "therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. It should be kept in mind that compositions can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations, especially when the cancer has metastasized. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of an antigen, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these compositions.
  • administration can begin at the detection or surgical removal of tumors. This can be followed by boosting doses until at least symptoms are substantially abated and for a period thereafter, or immunity is considered to be provided e.g., a memory B cell or T cell population, or antigen specific B cells or antibodies are produced).
  • Compositions comprising an antigen can be administered as an adjuvant therapy or maintenance therapy as a combination therapy with an additional therapy, such as administered in combination with chemotherapy, immune checkpoint inhibitor therapy, radiation therapy, or combinations thereof.
  • Combination therapies can include fluoropyrimidine, bevacizumab, and/or an immune checkpoint inhibitor therapy.
  • Combination therapies can include fluoropyrimidine and bevacizumab.
  • Combination therapies can include fluoropyrimidine, bevacizumab, and an immune checkpoint inhibitor therapy (e.g., an anti-PD-1 or anti-PD-Ll antibody).
  • Immune checkpoint inhibitors can include (1) an anti-PD-1 antibody or an antigenbinding fragment thereof, (2) an anti-PD-Ll antibody or an antigen-binding fragment thereof, and/or (3) an anti-CTLA-4 antibody or an antigen-binding fragment thereof.
  • Immune checkpoint inhibitor therapy can include administration of an anti-CTLA-4 antibody or an antigen-binding fragment thereof only with the priming dose and the first boosting dose.
  • Immune checkpoint inhibitor therapy can include the anti-CTLA-4 antibody ipilimumab.
  • Immune checkpoint inhibitor therapy can include ipilimumab administered at a dose of 30 mg subcutaneously.
  • Immune checkpoint inhibitor therapy can include administration of an anti-PD-Ll antibody or an antigen-binding fragment thereof every 4 weeks (Q4W).
  • Immune checkpoint inhibitor therapy can include the anti-PD-Ll antibody atezolizumab or nivolumab.
  • Atezolizumab can be administered at a dose of 1680 mg intravenously.
  • Nivolumab is administered at a dose of 480 mg intravenously.
  • Immune checkpoint inhibitor therapy can include at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 separate administrations, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 separate administrations on or about every 28 days (or every 4 weeks and/or every month).
  • Immune checkpoint inhibitor therapy can include administration of the anti-PD-Ll antibody or an antigen-binding fragment thereof including at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month).
  • Immune checkpoint inhibitor therapy can include at least 13 separate administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month).
  • the administration of the anti-PD-Ll antibody or an antigen-binding fragment thereof comprises at least 13 administrations, e.g., on or about every 28 days (or every 4 weeks and/or every month).
  • a ChAdV-based expression system can be administered as a boosting dose on or about day 140 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about week 20 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about month 5 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or after day 140 after the priming dose of the ChAdV-based expression system.
  • a ChAdV- based expression system can be administered as a boosting dose on or after week 20 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or after month 5 after the priming dose of the ChAdV-based expression system.
  • a self-replicating alphavirus-based expression system can be administered as at least two boosting doses.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 28 days apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 4 weeks (Q4W) apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least one month apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 56 days apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 8 weeks (Q8W) apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 2 months apart.
  • a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system.
  • a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV- based expression system.
  • a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.
  • a self-replicating alphavirus-based expression system can be administered as at least four boosting doses.
  • a self-replicating alphavirus-based expression system can be administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system.
  • a self-replicating alphavirus-based expression system can be administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system.
  • a self-replicating alphavirus-based expression system can be administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 28 days apart.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 4 weeks (Q4W) apart.
  • a ChAdV- based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least one month apart.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 56 days apart.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two or more boosting doses at least 8 weeks (Q8W) apart.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirusbased expression system can be administered as at least two or more boosting doses at least 2 months apart.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about days 28 and 84 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about weeks 4 and 12 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least two boosting doses on or about months 1 and 3 after the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered as at least four boosting doses.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about days 28, 84, 196, and 252 relative to the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about weeks 4, 12, 28, and 40 relative to the priming dose of the ChAdV-based expression system.
  • a ChAdV-based expression system can be administered as a boosting dose on or about, or after day 140 (or week 20 and/or month 5) after the priming dose of the ChAdV-based expression system, and a self-replicating alphavirus-based expression system can be administered on or about months 1, 3, 7, and 10 relative to the priming dose of the ChAdV-based expression system.
  • compositions for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration.
  • a pharmaceutical compositions can be administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly.
  • the compositions can be administered at a site of surgical excision to stimulate a local immune response to a tumor.
  • the compositions can be administered to target specific tissues, organs, and/or cells of a subject.
  • compositions for parenteral administration which comprise a solution of the antigen and vaccine compositions are dissolved or suspended in an acceptable carrier, e.g., an aqueous carrier.
  • aqueous carriers can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. The resulting aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
  • compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
  • auxiliary substances such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
  • Antigens can also be administered via liposomes, which target them to a particular cells tissue, such as lymphoid tissue. Liposomes are also useful in increasing half-life. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like.
  • the antigen to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions.
  • a molecule which binds to e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions.
  • liposomes filled with a desired antigen can be directed to the site of lymphoid cells, where the liposomes then deliver the selected therapeutic/immunogenic compositions.
  • Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol.
  • lipids are generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream.
  • a variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369.
  • a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells.
  • a liposome suspension can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.
  • nucleic acids encoding a peptide and optionally one or more of the peptides described herein can also be administered to the patient.
  • a number of methods are conveniently used to deliver the nucleic acids to the patient.
  • the nucleic acid can be delivered directly, as "naked DNA". This approach is described, for instance, in Wolff et al., Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466.
  • the nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered. Alternatively, DNA can be adhered to particles, such as gold particles.
  • Approaches for delivering nucleic acid sequences can include viral vectors, mRNA vectors, and DNA vectors with or without electroporation.
  • the nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids.
  • cationic compounds such as cationic lipids.
  • Lipid-mediated gene delivery methods are described, for instance, in 9618372WOAWO 96/18372; 9324640WOAWO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833 Rose U.S. Pat. No. 5,279,833; 9106309WOAWO 91/06309; and Feigner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).
  • Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev.
  • viral vector-based vaccine platforms such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus
  • this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides.
  • the sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science.
  • a means of administering nucleic acids uses minigene constructs encoding one or multiple epitopes.
  • a human codon usage table is used to guide the codon choice for each amino acid.
  • These epitopeencoding DNA sequences are directly adjoined, creating a continuous polypeptide sequence. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design.
  • minigene sequence examples include: helper T lymphocyte, epitopes, a leader (signal) sequence, and an endoplasmic reticulum retention signal.
  • MHC presentation of CTL epitopes can be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL epitopes.
  • the minigene sequence is converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) are synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides are joined using T4 DNA ligase. This synthetic minigene, encoding the CTL epitope polypeptide, can then cloned into a desired expression vector.
  • Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). A variety of methods have been described, and new techniques can become available. As noted above, nucleic acids are conveniently formulated with cationic lipids. In addition, glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non-condensing (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
  • PINC protective, interactive, non-condensing
  • Also disclosed is a method of manufacturing a vaccine comprising performing the steps of a method disclosed herein; and producing a vaccine comprising a plurality of antigens or a subset of the plurality of antigens.
  • Antigens disclosed herein can be manufactured using methods known in the art.
  • a method of producing an antigen or a vector (e.g., a vector including at least one sequence encoding one or more antigens) disclosed herein can include culturing a host cell under conditions suitable for expressing the antigen or vector wherein the host cell comprises at least one polynucleotide encoding the antigen or vector, and purifying the antigen or vector.
  • Standard purification methods include chromatographic techniques, electrophoretic, immunological, precipitation, dialysis, filtration, concentration, and chromatofocusing techniques.
  • Host cells can include a Chinese Hamster Ovary (CHO) cell, NS0 cell, yeast, or a HEK293 cell.
  • Host cells can be transformed with one or more polynucleotides comprising at least one nucleic acid sequence that encodes an antigen or vector disclosed herein, optionally wherein the isolated polynucleotide further comprises a promoter sequence operably linked to the at least one nucleic acid sequence that encodes the antigen or vector.
  • the isolated polynucleotide can be cDNA. VII. Antigen Use and Administration
  • a vaccination protocol can be used to dose a subject with one or more antigens.
  • a priming vaccine and a boosting vaccine can be used to dose the subject.
  • Vaccination methods, protocols, and schedules that can be used include, but are not limited to, those described in international application publication WO2021092095, herein incorporated by reference for all purposes.
  • a priming vaccine can be based on C68 (e.g., the sequences shown in SEQ ID NO: 1 or 2) or samRNA (e.g., the sequences shown in SEQ ID NO:3 or 4).
  • a boosting vaccine can also be based on C68 (e.g., the sequences shown in SEQ ID NO: 1 or 2) or samRNA (e.g., the sequences shown in SEQ ID NO:3 or 4).
  • Each vector in a prime/boost strategy typically includes a cassette that includes antigens.
  • Cassettes can include about 1-50 antigens, separated by spacers such as the natural sequence that normally surrounds each antigen or other non-natural spacer sequences such as AAY.
  • Cassettes can also include MHCII antigens such a tetanus toxoid antigen and PADRE antigen, which can be considered universal class II antigens.
  • Cassettes can also include a targeting sequence such as a ubiquitin targeting sequence.
  • each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) an immune modulator.
  • Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a checkpoint inhibitor (CPI).
  • CPI checkpoint inhibitor
  • CPI can include those that inhibit CTLA4, PD1, and/or PDL1 such as antibodies or antigen-binding portions thereof.
  • Such antibodies can include atezolizumab, ipilimumab, nivolumamb, cemiplimab, tremelimumab or durvalumab.
  • Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL- 15, or IL-21.
  • a cytokine such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL- 15, or IL-21.
  • a modified cytokine e.g., pegIL-2
  • pegIL-2 cytokine
  • a vaccine boost (boosting vaccine) can be injected (e.g., intramuscularly) after prime vaccination.
  • a boosting vaccine can be administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks, e.g., every 4 weeks and/or 8 weeks after the prime. Bilateral injections per dose can be used.
  • ChAdV68 e.g., total dose IxlO 12 viral particles
  • one or more injections of SAM vectors at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used
  • one or more injections of SAM vectors at high vaccine dose selected from the range 1 to 100 ug RNA, in particular 10 or 100 ug can be used.
  • Anti-CTLA-4 (e.g., tremelimumab) can also be administered to the subject.
  • anti-CTLA4 can be administered subcutaneously near the site of the intramuscular vaccine injection (ChAdV68 prime or samRNA low doses) to ensure drainage into the same lymph node.
  • Tremelimumab is a selective human IgG2 mAb inhibitor of CTLA-4.
  • Target Anti- CTLA-4 (tremelimumab) subcutaneous dose is typically 70-75 mg (in particular 75 mg) with a dose range of, e.g., 1-100 mg or 5-420 mg.
  • an anti-PD-Ll antibody can be used such as durvalumab (MEDI 4736).
  • Durvalumab is a selective, high affinity human IgGl mAb that blocks PD-L1 binding to PD-1 and CD80.
  • Durvalumab is generally administered at 20 mg/kg i.v. every 4 weeks.
  • Immune monitoring can be performed before, during, and/or after vaccine administration. Such monitoring can inform safety and efficacy, among other parameters.
  • PBMCs are commonly used. PBMCs can be isolated before prime vaccination, and after prime vaccination (e.g. 4 weeks and 8 weeks). PBMCs can be harvested just prior to boost vaccinations and after each boost vaccination (e.g. 4 weeks and 8 weeks).
  • Immune responses can be assessed as part of an immune monitoring protocol. For example, the ability of a vaccine composition described herein to stimulate an immune response can be monitored and/or assessed.
  • “stimulate an immune response” refers to any increase in a immune response, such as initiating an immune response (e.g., a priming vaccine stimulating the initiation of an immune response in a naive subject) or enhancement of an immune response (e.g., a boosting vaccine stimulating the enhancement of an immune response in a subject having a pre-existing immune response to an antigen, such as a pre-existing immune response initiated by a priming vaccine).
  • T cell responses can be measured using one or more methods known in the art such as ELISpot, intracellular cytokine staining, cytokine secretion and cell surface capture, T cell proliferation, MHC multimer staining, or by cytotoxicity assay.
  • T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines, such as IFN- gamma, using an ELISpot assay.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines captured intracellularly or extracellularly, such as IFN-gamma, using flow cytometry.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring T cell populations expressing T cell receptors specific for epitope/MHC class I complexes using MHC multimer staining.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring the ex vivo expansion of T cell populations following 3H-thymidine, bromodeoxyuridine and carboxyfluoresceine- diacetate- succinimidylester (CFSE) incorporation.
  • CFSE carboxyfluoresceine- diacetate- succinimidylester
  • B cell responses can be measured using one or more methods known in the art such as assays used to determine B cell differentiation (e.g., differentiation into plasma cells), B cell or plasma cell proliferation, B cell or plasma cell activation (e.g., upregulation of costimulatory markers such as CD80 or CD86), antibody class switching, and/or antibody production (e.g., an ELISA).
  • Antibodies can also be assessed for function, such as assessed for neutralizing ability.
  • disease status of a subject can be monitored following administration of any of the vaccine compositions described herein.
  • disease status may be monitored using isolated cell-free DNA (cfDNA) from a subject (also referred to as circulating tumor DNA “ctDNA”).
  • efficacy of a vaccine therapy may be monitored using isolated cfDNA from a subject.
  • cfDNA minotoring can include the steps of: a. isolating or having isolated cfDNA from a subject; b. sequencing or having sequenced the isolated cfDNA; c. determining or having determined a frequency of one or more mutations in the cfDNA relative to a wild-type germline nucleic acid sequence of the subject, and d.
  • the method can also include, following step (c) above, d. performing more than one iteration of steps (a)-(c) for the given subject and comparing the frequency of the one or more mutations determined in the more than one iterations; and f. assessing or having assessed from step (d) the status of a disease in the subject.
  • the more than one iterations can be performed at different time points, such as a first iteration of steps (a)-(c) performed prior to administration of the vaccine composition and a second iteration of steps (a)- (c) is performed subsequent to administration of the vaccine composition.
  • Step (c) can include comparing: the frequency of the one or more mutations determined in the more than one iterations, or the frequency of the one or more mutations determined in the first iteration to the frequency of the one or more mutations determined in the second iteration.
  • An increase in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as disease progression.
  • a decrease in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as a response.
  • the response is a Complete Response (CR) or a Partial Response (PR).
  • a therapy can be administered to a subject following an assessment step, such as where assessment of the frequency of the one or more mutations in the cfDNA indicates the subject has the disease.
  • the cfDNA isolation step can use centrifugation to separate cfDNA from cells or cellular debris.
  • cfDNA can be isolated from whole blood, such as by separating the plasma layer, buffy coat, and red bloods.
  • cfDNA sequencing can use next generation sequencing (NGS), Sanger sequencing, duplex sequencing, whole-exome sequencing, whole-genome sequencing, de novo sequencing, phased sequencing, targeted amplicon sequencing, shotgun sequencing, or combinations thereof, and may include enriching the cfDNA for one or more polynucleotide regions of interest prior to sequencing (e.g., polynucleotides known or suspected to encode the one or more mutations, coding regions, and/or tumor exome polynucleotides).
  • Enriching the cfDNA may include hybridizing one or more polynucleotide probes, which may be modified (e.g., biotinylated), to the one or more polynucleotide regions of interest.
  • modified e.g., biotinylated
  • any number of mutations may be monitored simultaneously or in parallel.
  • Response to treatment may be determined by radiological assessment and/or a molecular response by monitoring neoantigen ctDNA (e.g., variant allele frequency “VAF”) as described, for example, in Zhang et al. Cancer Discov. 2020; 10: 1842- 1853, Parikh et al. Clin Cancer Res. 2020; 26: 1877-1885, and Vega et al. JCO Precision Oncology 2022; 6:e2100372 or neoantigen mutated haploid genome equivalents (mutated hGE) as described, for example, in Palmer et al. Nat. Med. 2022;28: 1619-1629 and Chabon et al.
  • neoantigen ctDNA e.g., variant allele frequency “VAF”
  • VAF variant allele frequency
  • Molecular response may be defined as a decrease in ctDNA relative to baseline ctDNA, for example a > 20%, > 30%, > 40%, > 50%, > 60%, > 70%, > 80%, > 90%, or > 95% decrease in ctDNA relative to baseline ctDNA. In some embodiments, molecular response is defined as > 30% decrease in ctDNA relative to baseline ctDNA.
  • molecular response is defined as > 30% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 24 months, by 18 months, by 12 months, or by 6 months of treatment.
  • molecular response is defined as > 30% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 12 weeks, by 8 weeks, by 4 weeks, or by 2 weeks of treatment.
  • molecular response is defined as > 50% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 24 months, by 18 months, by 12 months, or by 6 months of treatment.
  • molecular response is defined as > 50% decrease in ctDNA relative to baseline ctDNA.
  • molecular response is defined as > 50% decrease in ctDNA relative to baseline ctDNA, wherein the decrease in ctDNA occurs by 12 weeks, by 8 weeks, by 4 weeks, or by 2 weeks of treatment.
  • Molecular response may be observed during early on- treatment radiological stable disease (SD) and/or in patients with radiological progressive disease (PD).
  • SD radiological stable disease
  • PD radiological progressive disease
  • Immunoprecipitation was performed using antibodies coupled to beads where the antibody is specific for HLA molecules.
  • a pan-Class I HLA immunoprecipitation a panClass I CR antibody is used, for Class II HLA - DR, an HLA-DR antibody is used.
  • Antibody is covalently attached to NHS-sepharose beads during overnight incubation. After covalent attachment, the beads were washed and aliquoted for IP.
  • Immunoprecipitations can also be performed with antibodies that are not covalently attached to beads. Typically this is done using sepharose 121 or magnetic beads coated with Protein A and/or Protein G to hold the antibody to the column.
  • the clarified tissue lysate is added to the antibody beads for the immunoprecipitation.
  • the beads are removed from the lysate and the lysate stored for additional experiments, including additional IPs.
  • the IP beads are washed to remove nonspecific binding and the HLA/peptide complex is eluted from the beads using standard techniques.
  • the protein components are removed from the peptides using a molecular weight spin column or Cl 8 fractionation.
  • the resultant peptides are taken to dryness by SpeedVac evaporation and in some instances are stored at -20C prior to MS analysis.
  • HLA IPs can also be performed in 96well plate format using plates that contain filter bottoms. Use of the plates allows for multiple IPs to be performed in tandem.
  • Dried peptides are reconstituted in an HPLC buffer suitable for reverse phase chromatography and loaded onto a C-18 microcapillary HPLC column for gradient elution in a Fusion Lumos mass spectrometer (Thermo).
  • MSI spectra of peptide mass/charge (m/z) were collected in the Orbitrap detector at high resolution followed by MS2 low resolution scans collected in the ion trap detector after HCD fragmentation of the selected ion.
  • MS2 spectra can be obtained using either CID or ETD fragmentation methods or any combination of the three techniques to attain greater amino acid coverage of the peptide.
  • MS2 spectra can also be measured with high resolution mass accuracy in the Orbitrap detector with targeted method known as parallel reaction monitoring.
  • MS2 spectra from each analysis are searched against a protein database using Comet (61, 62) and the peptide identification are scored using Percolator (63-65). Additional sequencing is performed using PEAKS studio (Bioinformatics Solutions Inc.) and other search engines or sequencing methods can be used including spectral matching and de novo sequencing (97). Targeted MSI and MS2 spectra can be processed through Skyline (104).
  • Presentation models can be used to identify likelihoods of peptide presentation in patients.
  • Various presentation models are known to those skilled in the art, for example the presentation models described in more detail in US Pat No. 10,055,540, US Application Pub. No. US20200010849A1 and US20110293637, and international patent application publications WO/2018/195357, WO/2018/208856, and WO2016187508, each herein incorporated by reference, in their entirety, for all purposes.
  • Training modules can be used to construct one or more presentation models based on training data sets that generate likelihoods of whether peptide sequences will be presented by MHC alleles associated with the peptide sequences.
  • Various training modules are known to those skilled in the art, for example the presentation models described in more detail in US Pat No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
  • a training module can construct a presentation model to predict presentation likelihoods of peptides on a per-allele basis.
  • a training module can also construct a presentation model to predict presentation likelihoods of peptides in a multiple-allele setting where two or more MHC alleles are present.
  • a prediction module can be used to receive sequence data and select candidate antigens in the sequence data using a presentation model.
  • the sequence data may be DNA sequences, RNA sequences, and/or protein sequences extracted from tumor tissue cells of patients.
  • a prediction module may identify candidate neoantigens that are mutated peptide sequences by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify portions containing one or more mutations.
  • a prediction module may identify candidate antigens that have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify improperly expressed candidate antigens.
  • a presentation module can apply one or more presentation model to processed peptide sequences to estimate presentation likelihoods of the peptide sequences.
  • the prediction module may select one or more candidate antigen peptide sequences that are likely to be presented on tumor HLA molecules by applying presentation models to the candidate antigens.
  • the presentation module selects candidate antigen sequences that have estimated presentation likelihoods above a predetermined threshold.
  • the presentation model selects the N candidate antigen sequences that have the highest estimated presentation likelihoods (where N is generally the maximum number of epitopes that can be delivered in a vaccine).
  • a vaccine including the selected candidate antigens for a given patient can be injected into a subject to stimulate immune responses.
  • a cassette design module can be used to generate a vaccine cassette sequence based on selected candidate peptides for injection into a patient.
  • Various cassette design modules are known to those skilled in the art, for example the cassette design modules described in more detail in US Pat No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
  • a set of therapeutic epitopes may be generated based on the selected peptides determined by a prediction module associated with presentation likelihoods above a predetermined threshold, where the presentation likelihoods are determined by the presentation models.
  • the set of therapeutic epitopes may be generated based on any one or more of a number of methods (alone or in combination), for example, based on binding affinity or predicted binding affinity to HLA class I or class II alleles of the patient, binding stability or predicted binding stability to HLA class I or class II alleles of the patient, random sampling, and the like.
  • Therapeutic epitopes may correspond to selected peptides themselves. Therapeutic epitopes may also include C- and/or N-terminal flanking sequences in addition to the selected peptides. N- and C-terminal flanking sequences can be the native N- and C-terminal flanking sequences of the therapeutic vaccine epitope in the context of its source protein. Therapeutic epitopes can represent a fixed-length epitope Therapeutic epitopes can represent a variable- length epitope, in which the length of the epitope can be varied depending on, for example, the length of the C- or N-flanking sequence. For example, the C-terminal flanking sequence and the N-terminal flanking sequence can each have varying lengths of 2-5 residues, resulting in 16 possible choices for the epitope.
  • a cassette design module can also generate cassette sequences by taking into account presentation of junction epitopes that span the junction between a pair of therapeutic epitopes in the cassette.
  • Junction epitopes are novel non-self but irrelevant epitope sequences that arise in the cassette due to the process of concatenating therapeutic epitopes and linker sequences in the cassette.
  • the novel sequences of junction epitopes are different from the therapeutic epitopes of the cassette themselves.
  • a cassette design module can generate a cassette sequence that reduces the likelihood that junction epitopes are presented in the patient. Specifically, when the cassette is injected into the patient, junction epitopes have the potential to be presented by HLA class I or HLA class II alleles of the patient, and stimulate a CD8 or CD4 T-cell response, respectively. Such reactions are often times undesirable because T-cells reactive to the junction epitopes have no therapeutic benefit, and may diminish the immune response to the selected therapeutic epitopes in the cassette by antigenic competition. 76
  • a cassette design module can iterate through one or more candidate cassettes, and determine a cassette sequence for which a presentation score of junction epitopes associated with that cassette sequence is below a numerical threshold.
  • the junction epitope presentation score is a quantity associated with presentation likelihoods of the junction epitopes in the cassette, and a higher value of the junction epitope presentation score indicates a higher likelihood that junction epitopes of the cassette will be presented by HLA class I or HLA class II or both.
  • a cassette design module may determine a cassette sequence associated with the lowest junction epitope presentation score among the candidate cassette sequences.
  • a cassette design module may iterate through one or more candidate cassette sequences, determine the junction epitope presentation score for the candidate cassettes, and identify an optimal cassette sequence associated with a junction epitope presentation score below the threshold.
  • a cassette design module may further check the one or more candidate cassette sequences to identify if any of the junction epitopes in the candidate cassette sequences are self-epitopes for a given patient for whom the vaccine is being designed. To accomplish this, the cassette design module checks the junction epitopes against a known database such as BLAST. In one embodiment, the cassette design module may be configured to design cassettes that avoid junction self-epitopes.
  • a cassette design module can perform a brute force approach and iterate through all or most possible candidate cassette sequences to select the sequence with the smallest junction epitope presentation score.
  • the number of such candidate cassettes can be prohibitively large as the capacity of the vaccine increases.
  • the cassette design module has to iterate through ⁇ 10 18 possible candidate cassettes to determine the cassette with the lowest junction epitope presentation score. This determination may be computationally burdensome (in terms of computational processing resources required), and sometimes intractable, for the cassette design module to complete within a reasonable amount of time to generate the vaccine for the patient.
  • accounting for the possible junction epitopes for each candidate cassette can be even more burdensome.
  • a cassette design module may select a cassette sequence based on ways of iterating through a number of candidate cassette sequences that are significantly smaller than the number of candidate cassette sequences for the brute force approach.
  • a cassette design module can generate a subset of randomly or at least pseudo- randomly generated candidate cassettes, and selects the candidate cassette associated with a junction epitope presentation score below a predetermined threshold as the cassette sequence. Additionally, the cassette design module may select the candidate cassette from the subset with the lowest junction epitope presentation score as the cassette sequence. For example, the cassette design module may generate a subset of ⁇ 1 million candidate cassettes for a set of 20 selected epitopes, and select the candidate cassette with the smallest junction epitope presentation score.
  • a cassette design module can determine an improved cassette configuration by formulating the epitope sequence for the cassette as an asymmetric traveling salesman problem (TSP).
  • TSP traveling salesman problem
  • the TSP determines a sequence of nodes associated with the shortest total distance to visit each node exactly once and return to the original node. For example, given cities A, B, and C with known distances between each other, the solution of the TSP generates a closed sequence of cities, for which the total distance traveled to visit each city exactly once is the smallest among possible routes.
  • the asymmetric version of the TSP determines the optimal sequence of nodes when the distance between a pair of nodes are asymmetric. For example, the “distance” for traveling from node A to node B may be different from the “distance” for traveling from node B to node A.
  • the cassette design module can find a cassette sequence that results in a reduced presentation score across the junctions between epitopes of the cassette.
  • the solution of the asymmetric TSP indicates a sequence of therapeutic epitopes that correspond to the order in which the epitopes should be concatenated in a cassette to minimize the junction epitope presentation score across the junctions of the cassette.
  • a cassette sequence determined through this approach can result in a sequence with significantly less presentation of junction epitopes while potentially requiring significantly less computational resources than the random sampling approach, especially when the number of generated candidate cassette sequences is large.
  • Illustrative examples of different computational approaches and comparisons for optimizing cassette design are described in more detail in US Pat No. 10,055,540, US Application Pub. No. US20200010849A1, and international patent application publications WO/2018/195357 and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
  • Shared (neo)antigen sequences for inclusion in a shared antigen vaccine and appropriate patients for treatment with such vaccine can be chosen by one of skill in the art, e.g., as described in US App. No. 17/058,128, herein incorporated by reference for all purposes.
  • Mass spectrometry (MS) validation of candidate shared (neo)antigens can performed as part of the selection process.
  • a computer can be used for any of the computational methods described herein.
  • One skilled in the art will recognize a computer can have different architectures. Examples of computers are known to those skilled in the art, for example the computers described in more detail US Pat No. 10,055,540, US Application Pub. No. US20200010849A1, and in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
  • the epitope-containing 25mer amino acid sequences i.e., epitope flanked by native N and C terminal amino acid linkers
  • Table 2A The antigen-encoding sequences of the cassettes for the various constructs were constructed by directly linking each 25mer sequence to each other (/. ⁇ ., no additional amino acids in between consecutive 25mer sequences) in the order and number described in the examples below, e.g., see FIGs. 1A, 2A, 3A, and 4A.
  • the cassettes containing the full-length antigen-encoding sequences containing the multiple distinct epitopes linked together, as well as universal MHC class II antigens tetanus toxoid and PADRE (bolded sequence), are presented in Table 2B.
  • the complete exogenous nucleotide insertions into the vectors include from 5’ to 3’: a Kozak sequence (GCCACC), nucleotides encoding three amino acids MAG (ATGGCCGGG), one of the cassette sequences of Table 2B, and two stop codons (TAATGA).
  • Further cassettes were generated with 4 iterations of individual KRAS mutations G12V, G12C, and G12D (z.e., separate concatemers of SEQ ID NOs 57, 58, or 59).
  • a modified ChAdV68 vector for the antigen expression system was generated based on AC_00001 E l with El (nt 577 to 3403) and E3 (nt 27,125- 31,825) sequences deleted and the corresponding ATCC VR-594 (Independently sequenced Full-Length VR-594 C68 SEQ ID NO: 10) nucleotides substituted at five positions.
  • the full-length ChAdVC68 AC 000011.1 sequence with corresponding ATCC VR-594 nucleotides substituted at five positions is referred to as “ChAdV68.5WTnf ’ (SEQ ID NO: 1).
  • Antigen cassettes under the control of the CMV promoter/enhancer were inserted in place of deleted El sequences.
  • a representative ChAdV68 vector containing 20 model antigens in an antigen cassette is “ChAdV68.5WTnt.MAG25mer” (SEQ ID NO:2).
  • the vectors featuring antigen cassettes described below having the MAG25mer cassette can be replaced by the antigen cassettes described above, e.g., in Table 2B.
  • ChAdV68 virus production was performed in 293F cells grown in 293 FreeStyleTM (ThermoFisher) media in an incubator at 8% CO2. On the day of infection cells were diluted to 10 6 cells per mL, with 98% viability and 400 mL were used per production run in IL Shake flasks (Coming). 4 mL of the tertiary viral stock with a target MOI of >3.3 was used per infection. The cells were incubated for 48-72h until the viability was ⁇ 70% as measured by Trypan blue.
  • the infected cells were then harvested by centrifugation, full speed bench top centrifuge and washed in 1XPBS, re-centrifuged and then re-suspended in 20 mL of lOmM Tris pH7.4.
  • the cell pellet was lysed by freeze thawing 3X and clarified by centrifugation at 4,300Xg for 5 minutes.
  • Viral DNA was purified by CsCl centrifugation. Two discontinuous gradient runs were performed. The first to purify virus from cellular components and the second to further refine separation from cellular components and separate defective from infectious particles. [00474] 10 mL of 1.2 (26.8g CsCl dissolved in 92 mL of 10 mM Tris pH 8.0) CsCl was added to polyallomer tubes. Then 8 mL of 1.4 CsCl (53g CsCl dissolved in 87 mL of 10 mM Tris pH 8.0) was carefully added using a pipette delivering to the bottom of the tube. The clarified virus was carefully layered on top of the 1.2 layer.
  • the tubes were then placed in a SW-32Ti rotor and centrifuged for 2h 30 min at 10°C. The tube was then removed to a laminar flow cabinet and the virus band pulled using an 18 gauge needle and a 10 mL syringe. Care was taken not to remove contaminating host cell DNA and protein. The band was then diluted at least 2X with 10 mM Tris pH 8.0 and layered as before on a discontinuous gradient as described above. The run was performed as described before except that this time the run was performed overnight. The next day the band was pulled with care to avoid pulling any of the defective particle band.
  • the virus was then dialyzed using a Slide-a-LyzerT M Cassette (Pierce) against ARM buffer (20 mM Tris pH 8.0, 25 mM NaCl, 2.5% Glycerol). This was performed 3X, Ih per buffer exchange. The virus was then aliquoted for storage at -80°C.
  • VP concentration was performed by using an OD 260 assay based on the extinction coefficient of l.lx 10 12 viral particles (VP) is equivalent to an Absorbance value of 1 at OD260 nm.
  • Two dilutions (1 :5 and 1 : 10) of adenovirus were made in a viral lysis buffer (0.1% SDS, 10 mM Tris pH 7.4, ImM EDTA).
  • OD was measured in duplicate at both dilutions and the VP concentration/ mL was measured by multiplying the OD260 value X dilution factor X l.lx 10 12 VP.
  • An infectious unit (IU) titer was calculated by a limiting dilution assay of the viral stock.
  • the virus was initially diluted 100X in DMEM/5% NS/ IX PS and then subsequently diluted using 10-fold dilutions down to lx 10' 7 .
  • 100 pL of these dilutions were then added to 293 A cells that were seeded at least an hour before at 3e5 cells/ well of a 24 well plate. This was performed in duplicate. Plates were incubated for 48h in a CO2 (5%) incubator at 37 °C. The cells were then washed with 1XPBS and were then fixed with 100% cold methanol (-20 °C).
  • the plates were then incubated at -20 °C for a minimum of 20 minutes.
  • the wells were washed with 1XPBS then blocked in lXPBS/0.1% BSA for 1 h at room temperature.
  • a rabbit anti-Ad antibody (Abeam, Cambridge, MA) was added at 1 :8,000 dilution in blocking buffer (0.25 ml per well) and incubated for 1 h at room temperature.
  • the wells were washed 4X with 0.5 mL PBS per well.
  • a HRP conjugated Goat anti-Rabbit antibody (Bethyl Labs, Montgomery Texas) diluted 1000X was added per well and incubated for Ih prior to a final round of washing.
  • the number of infectious viruses/ mL can be determined by the number of stained cells per grid multiplied by the number of grids per field of view multiplied by a dilution factor 10. Similarly, when working with GFP expressing cells fl orescent can be used rather than capsid staining to determine the number of GFP expressing virions per mL.
  • RNA alphavirus backbone for the antigen expression system was generated from a self-replicating Venezuelan Equine Encephalitis (VEE) virus (Kinney, 1986, Virology 152: 400- 413) by deleting the structural proteins of VEE located 3’ of the 26S sub-genomic promoter (VEE sequences 7544 to 11,175 deleted; numbering based on Kinney et al 1986; SEQ ID NO: 6).
  • VEE Venezuelan Equine Encephalitis
  • SAM self-amplifying mRNA
  • a representative SAM vector containing 20 model antigens is “VEE- MAG25mer” (SEQ ID NO:4).
  • the vectors featuring the antigen cassettes described having the MAG25mer cassette can be replaced by the SARS-CoV-2 cassettes and/or full-length proteins described herein.
  • SAM vectors were generated as “AU-SAM” vectors.
  • a modified T7 RNA polymerase promoter (TAATACGACTCACTATA [SEQ ID NO:89]), which lacks the canonical 3’ dinucleotide GG, was added to the 5’ end of the SAM vector to generate the in vitro transcription template DNA (e.g., the sequence set forth in SEQ ID NO:6; SAM with 7544 to 11,175 deleted without an inserted antigen cassette).
  • lx transcription buffer 40 mM Tris-HCL [pH7.9], 10 mM dithiothreitol, 2 mM spermidine, 0.002% Triton X-100, and 27 mM magnesium chloride
  • E2040S final concentrations of lx T7 RNA polymerase mix
  • 0.025 mg/mL DNA transcription template linearized by restriction digest
  • 8 mM CleanCap Reagent AU Cat. No. N-7114
  • a 7-methylguanosine or a related 5’ cap structure can be enzymatically added following transcription using a vaccinia capping system (NEB Cat. No. M2080) containing mRNA 2’-O-methyltransferase and S- Adenosyl methionine.
  • a vaccinia capping system NEB Cat. No. M2080
  • transgenic mice expressing a chimeric HLA-A11 :01 (Taconic Model #9660 - [CB6Fl-Tg(HLA-A*l 101/H2-Kb)Al 1.01]) were injected with 8xl0 10 viral particles (VP) or 5xl0 10 VP, as indicated, in 100 pL volume, bilateral intramuscular injection (50 pL per leg).
  • RNA-LNP complexes in 100 pL volume were administered as a bilateral intramuscular injection (50 pL per leg).
  • Splenocytes were isolated 14 days post-immunization. Spleens for each mouse were pooled in 3 mL of complete RPMI (RPMI, 10% FBS, penicillin/streptomycin). Mechanical dissociation was performed using the gentleMACS Dissociator (Miltenyi Biotec), following manufacturer’s protocol. Dissociated cells were filtered through a 40 micron filter and red blood cells were lysed with ACK lysis buffer (150mM NH4Q, lOmM KHCO3, 0. ImM Na2EDTA). Cells were filtered again through a 30 micron filter and then resuspended in complete RPMI. Cells were counted on the Cytoflex LX (Beckman Coulter) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis.
  • ELISPOT analysis was performed according to ELISPOT harmonization guidelines ⁇ DOI: 10.1038/nprot.2015.068 ⁇ with the mouse IFNg ELISpotPLUS kit (MABTECH).
  • IxlO 5 splenocytes were incubated with lOuM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISPOT analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells > 10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count + 2 x (spot count x %confluence /[100% - %confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
  • Vaccine efficacy with cassettes having repeated (i.e., iterated) neoepitopes was compared against cassettes having only a single copy of a given neoepitope.
  • Mice engineered to express human HLA-A11 :01 were immunized with 8xl0 10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by IFNy ELISpot.
  • HLA-A11 :01 was previously predicted to present KRAS G12C, G12V, and G12D neoepitopes (data not shown).
  • Vaccine efficacy with cassettes having a potentially immunodominant TP53 neoepitope capable of stimulating an immune response was compared against cassettes without a TP53 neoepitope capable of stimulating an immune response.
  • Mice engineered to express human HLA-A11 :01 were immunized with 5xl0 10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by ELISpot.
  • HLA-A11 :01 was previously predicted to present KRAS G12C, G12V, G12D, and TP53 S127Y neoepitopes (data not shown).
  • Mass spectrometry (MS) validation of candidate KRAS epitopes was performed using targeted mass spectrometry methods. Either donor tumor resections (multi-allelic; allele assignment from EDGE prediction) or single allelic K562 lines engineered to express the indicated multi-epitope cassettes (Table 2B) or the indicated neoepitope containing 25mer sequences in Table 2A were assessed. Mass spectrometry analysis methods are described in more detail in Gillete et al. (Nat Methods. 2013 Jan;10(l):28-34), herein incorporated by reference in its entirety for all purposes.
  • NA not applicable (either tumor or cell line not available/generated to test)
  • Vaccine efficacy with various cassettes having repeated (i.e., iterated) neoepitopes or a single copy of a given neoepitope were evaluated.
  • Mice engineered to express human HLA- A11 :01 for KRAS G12 mutations or human HLA-A01 :01 for KRAS Q61H were immunized with 5xlO 10 VP using the ChAdV68 delivery vectors described below and efficacy was assessed by IFNy ELISpot.
  • Cassettes featuring either a single copy of KRAS neoepitopes (“4x1”) or 4 iterations of each of the KRAS neoepitopes (“4x4”) were compared.
  • vaccination with vectors featuring multiple iterations of the neoepitopes demonstrated increased spot forming colonies (SFC), indicating repetition of epitope-encoding sequences in a cassette led to an increased antigen-specific immune response against KRAS neoepitopes, specifically G12V and G12D neoepitopes, using a ChAdV68 delivery system.
  • the purpose of this study is to evaluate the dose, safety, immunogenicity and early clinical activity of a ChAdV vector (GRT-C903) and a samRNA vector (GRT-R904), neoantigen-based therapeutic cancer vaccines, in combination with immune checkpoint blockade, in patients with advanced or metastatic non-small cell lung cancer, microsatellite stable colorectal cancer, pancreatic cancer, and shared neoantigen-positive tumors.
  • Tumors harboring non-synonymous deoxyribonucleic acid (DNA) mutations can present peptides containing these mutations as non-self antigens in the context of HLA on the tumor cell surface.
  • a fraction of mutated peptides result in neoantigens capable of generating T-cell responses that exclusively target tumor cells.
  • Some of these tumor-specific neoantigens are known or expected to be common across a subset of patients and are called shared neoantigens.
  • This study targets shared neoantigens using a heterologous prime/boost therapeutic vaccine approach (GRT-C903 first followed by GRT-R904) in combination with checkpoint blockade to stimulate an immune response.
  • GRT-C903 heterologous prime/boost therapeutic vaccine approach
  • This study explores the safety and early clinical activity of this neoantigen-based immunotherapy in inducing T-cell responses specific for the shared neoantigens contained within the therapeutic vaccine.
  • Phase 1 tests multiple doses and combinations with checkpoint blockade and Phase 2 tests for early signs of clinical activity using a vaccine regimen based on Phase 1 data.
  • a cancer vaccine encoding the iterated KRAS neoepitope cassettes described herein (“SLATE v2” or “SLATE-KRAS”) is administered in combination with immune checkpoint blockade in patients with advanced cancer.
  • the SLATE heterologous prime/boost vaccine regimen involves (1) a ChAdV that is used as a prime vaccination and (2) a samRNA formulated in a LNP that is used for boost vaccinations following the ChAdV vector.
  • Both the ChAdV and samRNA vectors encode the same iterated KRAS neoepitope cassette, which also encodes two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid).
  • PDARE universal CD4 T-cell epitopes
  • tumors are used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood is used for HLA typing.
  • the ChAdV vector is a replication-defective, El, E3, E4 open reading frames 2-4 (ORF2-4) deleted adenoviral vector based on chimpanzee adenovirus 68 (C68, 68/SAdV-25, originally designated as Pan 9), which is a subgroup E adenovirus [ChAdV68-Empty-E4deleted; see SEQ ID NO:83 which represents SEQ ID NO: 1 with an El deletion (577 to 3403), E3 deletion (27,125-31,825), and a partial E4 deletion spanning ORF2-4 (34,916 to 35,642)].
  • ORF2-4 open reading frames 2-4
  • the ChAdV vector is formulated in solution at 5* 10 11 vp/mL and 1.0 mL is injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used).
  • the samRNA vector is derived from an alphavirus.
  • the samRNA vector encodes the viral proteins and the 5’ and 3’ RNA sequences required for RNA amplification but encoded no structural proteins.
  • the samRNA vector is formulated in LNPs composed of 4 lipids: an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid to encapsulate the samRNA and form samRNA-LNPs.
  • the samRNA vector contains the same neoantigen expression cassette as used in the ChAdV vector.
  • Ipilimumab is a human monoclonal IgGl antibody that binds to the cytotoxic T- lymphocyte associated antigen 4 (CTLA-4). Ipilimumab is formulated in solution at 5 mg/mL and is injected SC proximally (within ⁇ 2 cm) to each of the bilateral vaccination sites. The SC route of ipilimumab is distinct from the approved IV route of administration. Ipilimumab is administered at a dose of 30 mg in one of two methods listed below:
  • Nivolumab is a human monoclonal IgG4 antibody that blocks the interaction of PD-1 and its ligands, PD-L1 and PD-L2.
  • Nivolumab is formulated in solution at 10 mg/mL and is administered as an IV infusion through a 0.2-micron to 1.2-micron pore size, low-protein binding in-line filter at the protocol-specified doses. It is not administered as an IV push or bolus injection.
  • the dose is fixed (e.g., 240 mg flat dose)
  • nivolumab injection may be infused undiluted or diluted so as not to exceed a total infusion volume of 160 mL.
  • Nivolumab infusion is promptly followed by a flush of diluent to clear the line.
  • Nivolumab is administered following each vaccination (/. ⁇ ., each of the samRNA or ChAdV vaccines) with or without ipilimumab on the same day.
  • the dose and route of nivolumab is based on the Food and Drug Administration approved dose and route. Doses of nivolumab may be interrupted, delayed, or discontinued depending on how well the participant tolerates the treatment. Dosing visits are not skipped, only delayed. Vaccination does not occur in the absence of nivolumab unless the Investigator and Sponsor believe treatment with samRNA vectors in the absence of nivolumab is in the best interest of the patient.
  • Cemiplimab may be administered in place of nivolumab, e.g., according to manufacturer’s directions and/or appropriate dosing determined as recognized by one skilled in the art.
  • Other PD1 and/or PD-L1 checkpoint inhibitors may alternatively be used.
  • Dose Level 1 Following the initial demonstration of the safety and tolerability of Dose Level 1 (30 pg), patients were treated at Dose Level 2 which incorporated SC ipilimumab (30 mg) at the same dose of the samRNA vector as in Dose Level 1 (30 pg).
  • the dose of the SAM vector was escalated to Dose Level 3 (100 pg) followed by Dose Level 4 (300 pg) with all patients continuing to receive SC ipilimumab (30 mg).
  • Phase 2 involves tumor-specific expansion cohorts and a cohort of mutation-positive tumors outside of tumor types already represented by other expansion cohorts.
  • Cohorts 1 and 4 enroll patients who have not experienced disease progression to routine therapy and Cohorts 2, 3, 5, and 6 enroll patients who experienced disease progression on, or after, routine therapy.
  • Patients in Phase 2 receive SC ipilimumab at the dose determined to be well tolerated in Phase 1.
  • Patients receive IV nivolumab at 480 mg Q4W throughout Phase 1 and 2. Details of the Phase 1/2 trials are illustrated in FIG. 8 and FIG. 11.
  • Phase 2 arms include both a monthly treatment schedule or a treatment schedule of every two months.
  • FIG. 17 shows the two-month treatment schedule.
  • Microsatellite-stable colorectal cancer (MSS-CRC) who are currently receiving systemic treatment with a fluoropyrimidine and oxaliplatin and/or irinotecan that may include a VEGF or EGFR targeting therapy as their IL therapy for metastatic disease OR who have experienced disease progression following treatment with a fluoropyrimidine, oxaliplatin, and irinotecan that may include a VEGF or EGFR targeting therapy and have not received additional lines of systemic therapy in the metastatic setting.
  • MSS-CRC Microsatellite-stable colorectal cancer
  • Non-small cell lung cancer who are currently receiving systemic treatment with an anti-PD-(L)l antibody in combination with cytotoxic, platinum -based chemotherapy OR who have experienced disease progression following treatment with an anti-PD-(L)l antibody in combination with cytotoxic, platinum -based chemotherapy (or anti-PD-(L)l alone if patient refuses platinum based chemotherapy), and have not received additional lines of systemic therapy in the metastatic setting.
  • NSCLC Non-small cell lung cancer
  • PDA Pancreatic ductal adenocarcinoma
  • tumor possesses one of the mutations listed below, and is determined to express a HLA allele for antigen presentation of the identified tumor mutation (Table 10): KRAS G12C or NRAS_G12C; KRAS G12D or NRAS G12D; KRAS G12V or NRAS G12V; KRAS Q61H or NRAS Q61H.
  • Inclusion criteria also includes: ECOG Performance Status 0 or 1; Measurable disease according to RECIST vl. l; Adequate organ function, as measured by laboratory values.
  • Exclusion criteria also includes: Tumors with genetic characteristics as follows: (a) For NSCLC, patients with a known genetic driver alteration in EGFR, ALK, ROS1, RET, or TRK; (b) Patients with known MSI-high disease based on institutional standard; Known exposure to chimpanzee adenovirus or any history of anaphylaxis in reaction to a vaccination; Bleeding disorder (e.g., factor deficiency, coagulopathy) or history of significant bruising or bleeding following IM injections or blood draws; History of allogenic/ solid organ transplant; Active, known, or suspected autoimmune disease; Active tuberculosis or recent ( ⁇ 2 week) clinically significant infection, or evidence of active hepatitis B or hepatitis C; Known history of positive test for human immunodeficiency (HIV) or known acquired immunodeficiency syndrome (AIDS).
  • HAV human immunodeficiency
  • AIDS acquired immunodeficiency syndrome
  • the cancer vaccine encoding the optimized SLATE v2 iterated KRAS neoepitope cassette was administered to a SLATE patient (S31) that was 41-year-old male with metastatic NSCLC identified as having a KRAS G12V mutation as well as haplotyped as A*03:01.
  • S31 had prior treatment with pembrolizumab, carboplatin, and pemetrexed for 16 months with progressive disease.
  • S31 received Dose 1- ChAdV vector in combination with SC ipilimumab (30 mg) and IV nivolumab (480 mg) as the prime vaccination followed by dosing visits every 4 weeks as follows:
  • T cell responses were assessed and compared between the patient S31 administered the optimized SLATE v2 cassette that included the iterated KRAS neoepitopes and a SLATE patient (S21) that was administered the prior SLATE “version 1” (vl) cassette.
  • patient S31 receiving the SLATE v2 cassette demonstrated an increased response (-100- fold) relative to the patient receiving the SLATE vl cassette, in particular for the KRAS G12V peptide.
  • the cassette featuring the iterated KRAS neoepitopes demonstrated an improved immune response stimulatory capacity.
  • patient S31 demonstrated a 37% reduction in tumor size at week 8 (FIG.
  • the cancer vaccine encoding the optimized SLATE v2 iterated KRAS neoepitope cassette was administered to a SLATE patient (S37) that was 64-year-old female with metastatic CRC identified as having a KRAS G12V mutation as well as haplotyped as A* 11 :01. S37 had prior treatment with FOLFOX/FOLFIR/bevacizumab for 23 months with progressive disease.
  • T cell responses were assessed and compared between the patient S37 administered the optimized SLATE v2 cassette that included the iterated KRAS neoepitopes and a SLATE patient (S21) that was administered the prior SLATE “version 1” (vl) cassette.
  • patient S31 receiving the SLATE v2 cassette demonstrated an increased response (-100- fold) relative to the patient receiving the SLATE vl cassette, in particular for the KRAS G12V peptide.
  • patient S37 demonstrated a 23% reduction in tumor size at week 24 (FIG. 13 right panels; week 24), as well as a molecular response as assessed by monitoring neoantigen ctDNA (FIG. 13 left top panel) and standard serum tumor markers CEA and CA 19-9 (FIG. 13 left bottom panel), demonstrating potential clinical efficacy.
  • Clinical efficacy was assessed in patients with NSCLC. Molecular responses (reduction in ctDNA >30%) and survival probabilities are shown in FIG. 14, demonstrating a trend of improved overall survival in patients with NSCLC with a molecular response compared to those without.
  • FIG. 15 A summary of clinical results for patients with NSCLC is presented FIG. 15, demonstrating early signals of durability and molecular response in NSCLC subjects following immune-checkpoint blockade (anti-PD-(L)l therapy).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2022/076680 2021-09-17 2022-09-19 Kras neoantigen therapies Ceased WO2023044493A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
JP2024516894A JP2024535855A (ja) 2021-09-17 2022-09-19 Krasネオ抗原療法
KR1020247010184A KR20240070547A (ko) 2021-09-17 2022-09-19 Kras 신생항원 요법
CA3231297A CA3231297A1 (en) 2021-09-17 2022-09-19 Kras neoantigen therapies
CN202280063132.1A CN117957015A (zh) 2021-09-17 2022-09-19 Kras新抗原疗法
AU2022346048A AU2022346048A1 (en) 2021-09-17 2022-09-19 Kras neoantigen therapies
IL311258A IL311258A (en) 2021-09-17 2022-09-19 Kras neoantigen therapies
EP22871019.0A EP4401766A4 (en) 2021-09-17 2022-09-19 Neo-antigenic anti-Kras therapies
US18/607,061 US20240238397A1 (en) 2021-09-17 2024-03-15 Kras-neoantigen therapies

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US202163245703P 2021-09-17 2021-09-17
US63/245,703 2021-09-17
US202163281029P 2021-11-18 2021-11-18
US63/281,029 2021-11-18
US202263321587P 2022-03-18 2022-03-18
US63/321,587 2022-03-18
US202263374888P 2022-09-07 2022-09-07
US63/374,888 2022-09-07

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/607,061 Continuation US20240238397A1 (en) 2021-09-17 2024-03-15 Kras-neoantigen therapies

Publications (2)

Publication Number Publication Date
WO2023044493A2 true WO2023044493A2 (en) 2023-03-23
WO2023044493A3 WO2023044493A3 (en) 2023-05-04

Family

ID=85603659

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/076680 Ceased WO2023044493A2 (en) 2021-09-17 2022-09-19 Kras neoantigen therapies

Country Status (8)

Country Link
US (1) US20240238397A1 (cg-RX-API-DMAC7.html)
EP (1) EP4401766A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024535855A (cg-RX-API-DMAC7.html)
KR (1) KR20240070547A (cg-RX-API-DMAC7.html)
AU (1) AU2022346048A1 (cg-RX-API-DMAC7.html)
CA (1) CA3231297A1 (cg-RX-API-DMAC7.html)
IL (1) IL311258A (cg-RX-API-DMAC7.html)
WO (1) WO2023044493A2 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024102332A1 (en) * 2022-11-07 2024-05-16 Himv Llc Vaccine compositions comprising a neoantigen of kras
WO2024112821A1 (en) * 2022-11-22 2024-05-30 Elixirgen Therapeutics, Inc. Antigens for cancer immunotherapy

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025213185A1 (en) * 2024-04-05 2025-10-09 Revolution Medicines, Inc. Peptide conjugates

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021092094A1 (en) * 2019-11-04 2021-05-14 Gritstone Oncology, Inc. Antigen-binding proteins targeting shared neoantigens
WO2021092095A1 (en) * 2019-11-04 2021-05-14 Gritstone Oncology, Inc. Neoantigen vaccine therapy
KR20220098379A (ko) * 2019-11-15 2022-07-12 그릿스톤 바이오, 인코포레이티드 공유 네오항원을 표적으로 하는 항원-결합 단백질
CN116438308A (zh) * 2020-08-06 2023-07-14 磨石生物公司 多表位疫苗盒

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024102332A1 (en) * 2022-11-07 2024-05-16 Himv Llc Vaccine compositions comprising a neoantigen of kras
WO2024112821A1 (en) * 2022-11-22 2024-05-30 Elixirgen Therapeutics, Inc. Antigens for cancer immunotherapy

Also Published As

Publication number Publication date
CA3231297A1 (en) 2023-03-23
US20240238397A1 (en) 2024-07-18
WO2023044493A3 (en) 2023-05-04
EP4401766A2 (en) 2024-07-24
KR20240070547A (ko) 2024-05-21
EP4401766A4 (en) 2025-10-29
IL311258A (en) 2024-05-01
JP2024535855A (ja) 2024-10-02
AU2022346048A1 (en) 2024-04-04

Similar Documents

Publication Publication Date Title
EP3796927A1 (en) Shared antigens
US20220125919A1 (en) Alphavirus neoantigen vectors and interferon inhibitors
US20210213122A1 (en) Immune checkpoint inhibitor co-expression vectors
WO2022032196A2 (en) Multiepitope vaccine cassettes
US20240238397A1 (en) Kras-neoantigen therapies
US20250276049A1 (en) Egfr vaccine cassettes
CN115803049A (zh) 抗原编码盒
US20240216501A1 (en) Neoantigen adjuvant and maintenance therapy
CN117957015A (zh) Kras新抗原疗法
US20250269002A1 (en) Cta vaccine cassettes
US20250255946A1 (en) Low-dose neoantigen vaccine therapy
WO2026055615A1 (en) Personalized cancer vaccines and methods of use
WO2025207975A1 (en) Personalized cancer vaccines and methods of use
CN118302188A (zh) 新抗原辅助和维持治疗
CN118302195A (zh) 泛冠状病毒疫苗

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22871019

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 311258

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 3231297

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2024516894

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280063132.1

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 2022346048

Country of ref document: AU

Ref document number: AU2022346048

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 20247010184

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022346048

Country of ref document: AU

Date of ref document: 20220919

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022871019

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022871019

Country of ref document: EP

Effective date: 20240417