WO2023034571A1 - Anti-glyco-lamp1 antibodies and their uses - Google Patents

Anti-glyco-lamp1 antibodies and their uses Download PDF

Info

Publication number
WO2023034571A1
WO2023034571A1 PCT/US2022/042457 US2022042457W WO2023034571A1 WO 2023034571 A1 WO2023034571 A1 WO 2023034571A1 US 2022042457 W US2022042457 W US 2022042457W WO 2023034571 A1 WO2023034571 A1 WO 2023034571A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
lamp1
antibody
glyco
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/042457
Other languages
English (en)
French (fr)
Inventor
Hans Wandall
Julia SCHNABEL
Edwin Tan
Aaron GROEN
Richard JOHNSON MORSE JR.
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Go Therapeutics Inc
Original Assignee
Go Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Go Therapeutics Inc filed Critical Go Therapeutics Inc
Priority to EP22783104.7A priority Critical patent/EP4396232A1/en
Priority to AU2022339819A priority patent/AU2022339819A1/en
Priority to US18/688,464 priority patent/US20250066498A1/en
Priority to CN202280073228.6A priority patent/CN118355031A/zh
Priority to KR1020247010868A priority patent/KR20240101546A9/ko
Priority to JP2024514125A priority patent/JP2024534910A/ja
Priority to CA3230933A priority patent/CA3230933A1/en
Publication of WO2023034571A1 publication Critical patent/WO2023034571A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001129Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68037Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • Many cancers express aberrantly glycosylated proteins that are distinct from healthy tissues. Such aberrantly glycosylated proteins contain glycopeptide epitopes that may be suitable for immunotherapy of solid tumors, but only few such glycopeptide epitopes have been identified.
  • Lysosome associated membrane protein-1 is a heavily glycosylated lysosomal membrane protein involved in protecting the lysosomal membrane from intracellular proteolysis (Kundra and Kornfeld, 1999, J Biol Chem. 274:31039-31046; Saftig and Klumperman, 2009, Nat Rev Mol Cell Bio. 10:623-635). Although LAMP1 is primarily expressed in the endosome- lysosomal membrane of cells, it is also expressed in the plasma membrane (Parkinson- Lawrence et al., 2005, Cell Immunol. 236:161-166; Kannan et al., 1996, Cell Immunol. 171 :10- 19).
  • Elevated LAMP1 expression at the cell surface has also been detected in metastatic tumor cells (Kannan et al., supra, Adrejewski et al., 1999, J Biol Chem. 274:12692-12701 ; Sarafian et al., 1998, Int J Cancer. 75:105-111), with high LAMP1 expression in colorectal neoplasm compared with normal mucosa (Furuta et al., 2001 , Am J Pathol. 159:449-455).
  • LAMP1 has also been observed in other human cancers, including human fibrosarcoma, colon adenocarcinoma, melanoma, pancreatic adenocarcinoma, and astrocytoma (Sarafin et al., supra, Jensen et al., 2013, Int J Clin Exp Pathol. 6(7): 1294-1305; Kunzli et al., 2002, Cancer. 94(1):228-239).
  • Several monoclonal antibodies that have displayed promising results in tumors with high surface LAMP1 levels (see, e.g., Baudat et al., 2016, Cancer Res. 76(14 Supplement):!
  • glyco-LAMP1 epitopes that are overexpressed in cancer cells and new therapeutic modalities, such as antibodies and CARs, which target such glyco-LAMP1 epitopes.
  • the disclosure captures the tumor specificity of glycopeptide variants by providing therapeutic and diagnostic agents based on antibodies and antigen binding fragments that are selective for cancer-specific epitopes of glyco-LAMP1 .
  • the antibodies and antigen-binding fragments advantageously bind to both the LAMP1 backbone and its cancer specific O-linked glycans but not LAMP1 on healthy tissues.
  • the present disclosure provides anti-glyco-LAMP1 antibodies and antigen binding fragments thereof that bind to a cancer-specific glycosylation variant of LAMP1 .
  • the present disclosure further provides fusion proteins and antibody-drug conjugates comprising anti-glyco-LAMP1 antibodies and antigen binding fragments, and nucleic acids encoding the anti-glyco-LAMP1 antibodies, antigen binding fragments and fusion proteins.
  • the present disclosure further provides methods of using the anti-glyco-LAMP1 antibodies, antigen-binding fragments, fusion proteins, antibody-drug conjugates and nucleic acids for cancer therapy.
  • the disclosure provides bispecific and other multispecific anti-glyco- LAMP1 antibodies and antigen binding fragments that bind to a cancer-specific glycosylation variant of LAMP1 and to a second epitope, and fragments and variants thereof.
  • the second epitope can either be on LAMP1 itself, on another protein co-expressed on cancer cells with LAMP1 , or on another protein presented on a different cell, such as an activated T cell.
  • nucleic acids encoding such antibodies including nucleic acids comprising codon-optimized coding regions and nucleic acids comprising coding regions that are not codon-optimized for expression in a particular host cell.
  • the anti-glyco-LAMP1 antibodies and binding fragments can be in the form of fusion proteins containing a fusion partner.
  • the fusion partner can be useful to provide a second function, such as a signaling function of the signaling domain of a T cell signaling protein, a peptide modulator of T cell activation or an enzymatic component of a labeling system.
  • Exemplary T cell signaling proteins include 4-1 BB, CD28, CD2, and fusion peptides, e.g., CD28-CD3-zeta, 4-1 BB-CD3-zeta, CD2-CD3-zeta, CD28-CD2-CD3-zeta, and 4-1 BB-CD2- CD3-zeta.
  • 4-1 BB also known as CD137, is a co-stimulatory receptor of T cells; CD2 is a co- stimulatory receptor of T and NK cells; CD3-zeta is a signal-transduction component of the T- cell antigen receptor.
  • the moiety providing a second function can be a modulator of T cell activation, such as IL-15, IL-15Ra, or an IL-15/IL-15Ra fusion, can be an MHC-class l-chain- related (MIC) protein domain useful for making a MicAbody, or it can encode a label or an enzymatic component of a labeling system useful in monitoring the extent and/or location of binding in vivo or in vitro.
  • MIC MHC-class l-chain- related
  • T cells such as autologous T cells
  • Constructs encoding these prophylactically and therapeutically active biomolecules placed in the context of T cells, such as autologous T cells, provide a powerful platform for recruiting adoptively transferred T cells to prevent or treat a variety of cancers in some embodiments of the disclosure.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain CDR sequences (as defined by Kabat, Chothia, IMGT or their combined region of overlap) of the anti-glyco-LAMP1 antibodies 3C7.2C11.1C9 (sometimes referred to herein as “3C7”), 13C3.1C8.1C9 (sometimes referred to herein as “13C3”), or 13G2.1A10.2G5 (sometimes referred to herein as “13G2”) or humanized counterparts thereof.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain variable sequences (or encoded by the nucleotide sequences) of the anti-glyco-LAMP1 antibodies 3C7, 13C3, or 13G2 of humanized counterparts thereof.
  • the CDR and variable sequences (as well as their coding sequences) of the anti-glyco-LAMP1 antibodies 3C7, 13C3, and 13G2 are set forth in Tables 1 A through 1C, respectively.
  • anti-glyco-LAMP1 antibody when used in this document, it is intended to include monospecific and multi-specific (including bispecific) anti-glyco-LAMP1 antibodies, antigen-binding fragments of the monospecific and multi-specific antibodies, and fusion proteins and conjugates containing the antibodies and their antigenbinding fragments, unless the context dictates otherwise.
  • anti-glyco- LAMP1 antibody or antigen-binding fragment when used, it is also intended to include monospecific and multi-specific (including bispecific) anti-glyco-LAMP1 antibodies and their antigen-binding fragments, together with fusion proteins and conjugates containing such antibodies and antigen-binding fragments, unless the context dictates otherwise.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain CDR sequences (or encoded by the nucleotide sequences) set forth in Tables 1A-3D.
  • the CDR sequences set forth in Tables 1A-1C include CDR sequences defined according to the IMGT (Lefranc et al., 2003, Dev Comparat Immunol 27:55-77), Kabat (Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.), and Chothia (Al-Lazikani et al., 1997, J. Mol.
  • the CDR sequences set forth in Tables 1 D-1 F are consensus sequences derived from the CDR sequences set forth in Tables 1 A through 1C according to the IMGT, Kabat, and Chothia definitions, respectively.
  • the CDR sequences set forth in Tables 2A through 2C are the combined regions of overlap for the CDR sequences set forth in Tables 1 A through 1C, respectively, with the IMGT, Kabat and Chothia sequences shown in underlined bold text.
  • the CDR sequences set forth in Table 2D are the combined regions of overlap for the consensus CDR sequences set forth in Tables 2A-2C.
  • the CDR sequences set forth in Tables 3A-3C are the common regions of overlap for the CDR sequences shown in Tables 1A-1C, respectively.
  • the CDR sequences set forth in Table 3D are the common regions of overlap for the CDR sequences set forth in Tables 3A-3D.
  • the framework sequences for such anti-glyco-LAMP1 antibody and antigen-binding fragment can be the native murine framework sequences of the VH and VL sequences set forth in Tables 1A-1C or can be non-native (e.g., humanized or human) framework sequences.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain variable sequences of humanized anti-glyco- LAMP1 antibody 13C3 set forth in Tables 4A through 4G.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises CDRs comprising the amino acid sequences of any of the CDR combinations set forth in Tables 1A-3D.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises a CDR-H1 comprising the amino acid sequence of SEQ ID NO:127, a CDR-H2 comprising the amino acid sequence of SEQ ID NO:128, a CDR-H3 comprising the amino acid sequence of SEQ ID NO:129, a CDR-L1 comprising the amino acid sequence of SEQ ID NQ:130, a CDR-L2 comprising the amino acid sequence of SEQ ID NO:131 , and a CDR-L3 comprising the amino acid sequence of SEQ ID NO:132.
  • CDR-H1 comprises the amino acid sequence of SEQ ID NO:127.
  • CDR-H2 comprises the amino acid sequence of SEQ ID NO: 128.
  • CDR-H3 comprises the amino acid sequence of SEQ ID NO:129.
  • CDR-L1 comprises the amino acid sequence of SEQ ID NQ:130.
  • CDR-L2 comprises the amino acid sequence of SEQ ID NO:131.
  • CDR-L3 comprises the amino acid sequence of SEQ ID NO:132.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:3-5 and light chain CDRs of SEQ ID NOS:6-8.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:9-11 and light chain CDRs of SEQ ID NOS: 12-14.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS: 15-17 and light chain CDRs of SEQ ID NOS:18-20.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:85-87 and light chain CDRs of SEQ ID NOS:88-90.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:25-27 and light chain CDRs of SEQ ID NOS:28-30.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:31-33 and light chain CDRs of SEQ ID NOS:32-34.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:35-37 and light chain CDRs of SEQ ID NQS:38-40.
  • an anti-glyco-LAMP1 antibody or antigenbinding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:91-93 and light chain CDRs of SEQ ID NOS:94-96.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:47-49 and light chain CDRs of SEQ ID NQS:50-52.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:53-55 and light chain CDRs of SEQ ID NOS:56-58.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:59-61 and light chain CDRs of SEQ ID NOS:62-64.
  • an anti-glyco-LAMP1 antibody or antigenbinding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:97-99 and light chain CDRs of SEQ ID NQS:100-102.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:67-69 and light chain CDRs of SEQ ID NQS:70-72.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:73-75 and light chain CDRs of SEQ ID NOS:76-78.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:79-81 and light chain CDRs of SEQ ID NOS:82-84.
  • an anti-glyco-LAMP1 antibody or antigenbinding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS: 103-105 and light chain CDRs of SEQ ID NOS: 106-108.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises a CDR-H1 comprising the amino acid sequence of SEQ ID NO:67, 73, 79, 85, 91 , 97, 103, 109, 115, 121 , or 127; a CDR-H2 comprising the amino acid sequence of SEQ ID NO:68, 74, 80, 86, 92, 98, 104, 110, 116, 122, or 128; a CDR-H3 comprising the amino acid sequence of SEQ ID NO:69, 75, 81 , 87, 93, 99, 105, 111 , 117, 123, or 129; a CDR-L1 comprising the amino acid sequence of SEQ ID NQ:70, 76, 82, 88, 94, 100, 106, 112, 118, 124, or 130; a CDR-L2 comprising the amino acid sequence of SEQ ID NO:
  • the antibodies and antigen-binding fragments of the disclosure can be murine, chimeric, humanized or human.
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with an antibody or antigen binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:1 and 2, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS:1 and 2, respectively.
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with an antibody or antigen binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:23 and 24, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS:23 and 24, respectively.
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with an antibody or antigen binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:45 and 46, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS:45 and 46, respectively.
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with an antibody or antigen binding fragment comprising a heavy chain variable region of any one of SEQ ID NOS: 133-144 and a light chain variable region of any one of SEQ ID NOS: 145-153.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having a heavy variable region having at least 95%, 98%, 99%, or 99.5% sequence identity of any one of SEQ ID NOS: 133-134 and a light variable region having at least 95%, 98%, 99%, or 99.5% sequence identity of any one of SEQ ID NOS:145-153.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure is a single-chain variable fragment (scFv).
  • An exemplary scFv comprises the heavy chain variable fragment N-terminal to the light chain variable fragment.
  • the scFv heavy chain variable fragment and light chain variable fragment are covalently bound to a linker sequence of 4-15 amino acids.
  • the scFv can be in the form of a bi-specific T-cell engager or within a chimeric antigen receptor (CAR).
  • the anti-glyco-LAMP1 antibodies and antigen-binding fragments can be in the form of a multimer of a single-chain variable fragment, a bispecific single-chain variable fragment and a multimer of a bispecific single-chain variable fragment.
  • the multimer of a single chain variable fragment is selected a divalent single-chain variable fragment, a tribody or a tetrabody.
  • the multimer of a bispecific single-chain variable fragment is a bispecific T-cell engager.
  • nucleic acids encoding the anti-glyco- LAMP1 antibodies and antibody-binding fragments of the disclosure are drawn to nucleic acids encoding the anti-glyco- LAMP1 antibodies and antibody-binding fragments of the disclosure.
  • the portion of the nucleic acid nucleic acid encoding an anti-glyco-LAMP1 antibody or antigenbinding fragment is codon-optimized for expression in a human cell.
  • the disclosure provides an anti-glyco-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions encoded by a heavy chain nucleotide sequence having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NO:21 , 43, or 65 and a light chain nucleotide sequence having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NO:22, 44 or 66.
  • Vectors e.g., a viral vector such as a lentiviral vector
  • host cells comprising the nucleic acids are also within the scope of the disclosure.
  • the heavy and light chains coding sequences can be present on a single vector or on separate vectors.
  • composition comprising an anti-glyco-LAMP1 antibody, antigen-binding fragment, nucleic acid (or pair of nucleic acids), vector (or pair of vectors) or host cell according to the disclosure, and a physiologically suitable buffer, adjuvant or diluent.
  • Still another aspect of the disclosure is a method of making a chimeric antigen receptor comprising incubating a cell comprising a nucleic acid or a vector according to the disclosure, under conditions suitable for expression of the coding region and collecting the chimeric antigen receptor.
  • Another aspect of the disclosure is a method of detecting cancer comprising contacting biological sample (e.g., a cell, tissue sample, or extracellular vesicle) with an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure and detecting whether the antibody is bound to the biological sample (e.g., cell, tissue sample, or extracellular vesicle).
  • biological sample e.g., a cell, tissue sample, or extracellular vesicle
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure e.g., cell, tissue sample, or extracellular vesicle
  • Yet another aspect of the disclosure is an anti-glyco-LAMP1 antibody or antigen-binding fragment according to the disclosure of the disclosure for use in detecting cancer.
  • Yet another aspect of the disclosure is a method of treating cancer comprising administering a prophylactically or therapeutically effective amount of an anti-glyco-LAMP1 antibody, antigen-binding fragment, nucleic acid, vector, host cell or pharmaceutical composition according to the disclosure to a subject in need thereof.
  • Yet another aspect of the disclosure is an anti-glyco-LAMP1 antibody, antigen-binding fragment, nucleic acid, vector, host cell or pharmaceutical composition according to the disclosure for use in the treatment of cancer.
  • Yet another aspect of the disclosure is use of an anti-glyco-LAMP1 antibody, antigenbinding fragment, nucleic acid, vector, host cell or pharmaceutical composition according to the disclosure for the manufacture of a medicament for the treatment of cancer.
  • Glyco-LAMP1 peptides are also provided herein.
  • the peptides can be 13-30 amino acids in length and comprise amino acids 1-11 , 1-12, 1-13, 1-14, 1-15, 1-16, 1-17, 1-18, 1-19, 1-20, 2-11 , 2-12, 2-13, 2-14, 2-15, 2-16, 2-17, 2-18, 2-19, 2-20, 3-11 , 3-12, 3-13, 3-14, 3-15, 3- 16, 3-17, 3-18, 3-19, 3-20, 4-11 , 4-12, 4-13, 4-14, 4-15, 4-16, 4-17, 4-18, 4-19, 4-20, 5-11 , 5-12, 5-13, 5-14, 5-15, 5-16, 5-17, 5-18, 5-19, 5-20, 6-11 , 6-12, 6-13, 6-14, 6-15, 6-16, 6-17, 6-18, 6- 19, or 6-20 of SEQ ID N0:200 (CEQDRPSPTTAPPAPPSPSP, glycosylated with GalNAc on the th
  • the glyco-LAMP1 peptides are describe in Section 5.10 and numbered embodiments 739 to 765.
  • the peptides can be included in a composition, as described in Section 5.10.1 and numbered embodiments 766 and 767.
  • the glyco-LAMP1 peptides can be used in methods for producing antibodies in an animal and/or eliciting an immune response in an animal. Methods for using the glyco-LAMP1 peptides are described in Section 5.10.2 and numbered embodiments 768 to 771.
  • FIGS. 1A-1 B-5 Flow cytometry analysis of LAMP1 mouse antibodies on T47D COSMC-KO and T47D cells.
  • FIG. 1A Representative histograms for staining of 3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5, anti-Golgi, mouse IgG isotype control, and anti-LAMP1 antibodies on T47D COSMC-KO and T47D cells.
  • FIG. 1 B1-1 B4 Titration of 3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5 on cell surface antigens found on T47D COSMC-KO and T47D cells.
  • FIG. 1 B-5 legend for FIG. 1 B1 to 1 B4.
  • FIG. 2 Immunofluorescence staining of 3C7.2C11.1C9, 13C3.1C8.1C9, 13G2.1A10.2G5, anti-LAMP1 and anti-Tn antibodies on T47D COSMC-KO and T47D cells.
  • FIG. 3 Immunohistochemistry of LAMP1 mouse antibodies, staining of 3C7.2C11.1C9, 13C3.1C8.1C9 , and 13G2.1A10.2G5 antibodies on prostate cancer and normal tissues.
  • FIGS. 4A-1-4B-2 Immunohistochemistry of LAMP1 mouse antibodies.
  • FIG. 4A-1 Staining of 13C3.1C8.1C9 antibody on FDA normal tissue microarray (FDA999x). Stats shown in FIGS. 4A-2 and 4A-3.
  • FIG. 4B-1 Staining of 13C3.1C8.1C9 antibody on breast (TMA- BC08013d) and lung (TMA-LC121 b) cancer tissues. Positive samples had ⁇ 70% of cancer cells that had strong cellular surface stain. Roughly 10-20% of analyzed cancer tissue had specific cellular surface stain ⁇ 70% of cancer cells. Stats shown in FIG. 4B-2.
  • FIGS. 5A-1-5B Cell killing assay of LAMP1 ADCs.
  • FIG. 5A-1-5A-3 Cytotoxicity of LAMP1 ADCs (3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5, respectively) on T47D COSMC-KO cells. The drug conjugate was covalently linked DX8951 (with maleimide).
  • DX8951 with maleimide
  • 5B Cytotoxicity of humanized LAMP1-ADC (13C3.1C8.1C9) on T47D COSMC-KO cells.
  • the drug conjugate was covalently linked cleavable MMAE with maleimide (vc-PAB-MMAE).
  • GO- 13C3-Human-v1 is HV-72A/KV2A
  • GO-13C3-Human-v2 is HV23B/KV2A.
  • FIG. 6 Cell killing assay of LAMP1 CARTs, killing of LAMP1 CARTs (3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5) on HaCAT COSMC-KO and HaCAT target cells with ratios of T cells to target cells (10:1).
  • FIG. 7 In vivo activity of mouse LAMP-ADC in solid tumor CDx mouse model.
  • T47D COSMC-KO solid tumor model established by flank injection (CDx).
  • the tumor volume at ADC injection was 100 mm3 and mice were treated with cleavable13C3-vc-PAB-MMAE by IP injection (5 doses every 3 days with dose 1 at day 0). Tumor volume was measured by caliper.
  • FIGS. 8A-8C Exemplary LAMP1 CART constructs 3C7-CART (FIG. 8A), 13C3-CART (FIG. 8B), and 13G2-CART (FIG. 8C). Testing of the constructs is described in Example 5.
  • FIGS. 9A-9B Amino acid alignment of antibody heavy (FIG. 9A) and light (FIG. 9B) chains of wild type mAb237, 3C7.2C11.1C9 (3C7) , 13C3.1C8.1C9 (13C3), and 13G2.1A10.2G5 (13G2). Depicted CDRs follow the IMGT definition.
  • the disclosure provides novel antibodies that are directed to a glycoform of LAMP1 present on tumor cells. These are exemplified by the antibodies 3C7.2C11.1C9 (hereinafter, “3C7”), 13C3.1C8.1C9 (hereinafter, “13C3”), and 13G2.1A10.2G5 (hereinafter, “13G2”).
  • 3C7.2C11.1C9 hereinafter, “3C7”
  • 13C3.1C8.1C9 hereinafter, “13C3”
  • 13G2.1A10.2G5 hereinafter, “13G2”.
  • 3C7, 13C3, and 13G2 were identified in a screen for antibodies that bind to a glycosylated peptide present in LAMP1 : CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 154), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text so as to mimic the glycosylation pattern of LAMP1 present on tumor cells.
  • anti-glyco-LAMP1 antibodies of the disclosure exemplified by antibodies 3C7, 13C3, and 13G2, are useful as tools in cancer diagnosis and therapy.
  • the disclosure provides antibodies and antigen binding fragments that bind to a glycoform of LAMP1 present on tumor cells (referred to herein as “glyco-LAMP1”), and preferably to the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 154), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text.
  • glyco-LAMP1 a glycoform of LAMP1 present on tumor cells
  • the disclosure provides antibodies and antigen binding fragments that bind to the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID N0:200), glycosylated with GalNAc on the threonine residue shown in bold underlined text.
  • the disclosure provides antibodies and antigen binding fragments that bind to the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:216), glycosylated with GalNAc on the threonine residues shown in bold underlined text.
  • the disclosure provides antibodies and antigen binding fragments that bind to the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:217), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text.
  • the disclosure provides antibodies and antigen binding fragments that specifically compete for binding to a glyco-LAMP1 peptide described herein (e.g., one of SEQ ID NOS:154, 200, 216, and 217).
  • the anti-glyco-LAMP1 antibodies of the disclosure may be polyclonal, monoclonal, genetically engineered, and/or otherwise modified in nature, including but not limited to chimeric antibodies, humanized antibodies, human antibodies, primatized antibodies, single chain antibodies, bispecific antibodies, dual-variable domain antibodies, etc.
  • the antibodies comprise all or a portion of a constant region of an antibody.
  • the constant region is an isotype selected from: IgA (e.g., IgAi or lgA 2 ), IgD, IgE, IgG (e.g., IgGi, lgG 2 , lgG 3 or lgG ), and IgM.
  • the anti-glyco-LAMP1 antibodies of the disclosure comprise an IgGi constant region isotype.
  • the term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
  • a monoclonal antibody is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, by any means available or known in the art.
  • Monoclonal antibodies useful with the present disclosure can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. In many uses of the present disclosure, including in vivo use of the anti-glyco-LAMP1 antibodies in humans, chimeric, primatized, humanized, or human antibodies can suitably be used.
  • chimeric antibody refers to an antibody having variable sequences derived from a non-human immunoglobulin, such as a rat or a mouse antibody, and human immunoglobulin constant regions, typically chosen from a human immunoglobulin template.
  • Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, 1985, Science 229(4719): 1202-7; Di et al., 1986, BioTechniques 4:214-221 ; Gillies et al., 1985, J. Immunol. Methods 125:191-202; U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816397, which are incorporated herein by reference in their entireties.
  • “Humanized” forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins that contain minimal sequences derived from non-human immunoglobulin.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions (FR) are those of a human immunoglobulin sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
  • Human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins. Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences. See U.S. Pat. Nos.
  • Fully human antibodies that recognize a selected epitope can be generated using a technique referred to as “guided selection.” In this approach, a selected non-human monoclonal antibody, e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope (see, Jespers et al., 1988, Biotechnology 12:899-903).
  • Primary antibodies comprise monkey variable regions and human constant regions. Methods for producing primatized antibodies are known in the art. See, e.g., U.S. Pat. Nos. 5,658,570; 5,681 ,722; and 5,693,780, which are incorporated herein by reference in their entireties.
  • Anti-glyco-LAMP1 antibodies of the disclosure include both full-length (intact) antibody molecules, as well as antigen-binding fragments that are capable of binding glyco-LAMP1 .
  • antigen-binding fragments include by way of example and not limitation, Fab, Fab', F (ab') 2 , Fv fragments, single chain Fv fragments and single domain fragments.
  • a Fab fragment contains the constant domain of the light chain (CL) and the first constant domain (CH1) of the heavy chain.
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
  • F(ab') fragments are produced by cleavage of the disulfide bond at the hinge cysteines of the F(ab') 2 pepsin digestion product. Additional chemical couplings of antibody fragments are known to those of ordinary skill in the art.
  • Fab and F(ab')i fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation of animals, and may have less non-specific tissue binding than an intact antibody (see, e.g., Wahl et al., 1983, J. Nucl. Med. 24:316).
  • An “Fv” fragment is the minimum fragment of an antibody that contains a complete target recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in a tight, non-covalent association (V H -V dimer). It is in this configuration that the three CDRs of each variable domain interact to define a target binding site on the surface of the V H -V dimer. Often, the six CDRs confer target binding specificity to the antibody. However, in some instances even a single variable domain (or half of an Fv comprising only three CDRs specific for a target) can have the ability to recognize and bind target, although at a lower affinity than the entire binding site.
  • Single-chain Fv or “scFv” antigen-binding fragments comprise the V H and V domains of an antibody, where these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V domains which enables the scFv to form the desired structure for target binding.
  • Single domain antibodies are composed of single V H or V L domains which exhibit sufficient affinity to glyco-LAMP1 .
  • the single domain antibody is a camelized antibody (see, e.g., Riechmann, 1999, Journal of Immunological Methods 231 :25- 38).
  • the anti-glyco-LAMP1 antibodies of the disclosure may also be bispecific and other multiple specific antibodies.
  • Bispecific antibodies are monoclonal, often human or humanized, antibodies that have binding specificities for two different epitopes on the same or different antigen.
  • one of the binding specificities can be directed towards glyco-LAMP1 , the other can be for any other antigen, e.g., for a cell-surface protein, receptor, receptor subunit, tissue-specific antigen, virally derived protein, virally encoded envelope protein, bacterially derived protein, or bacterial surface protein, etc.
  • the bispecific and other multispecific anti-glyco-LAMP1 antibodies and antigen binding fragments specifically bind to a second LAMP1 epitope, an epitope on another protein co-expressed on cancer cells with LAMP1 , or an epitope on another protein presented on a different cell, such as an activated T cell.
  • Bispecific antibodies of the disclosure include IgG format bispecific antibodies and single chain-based bispecific antibodies.
  • IgG format bispecific antibodies of the disclosure can be any of the various types of IgG format bispecific antibodies known in the art, such as quadroma bispecific antibodies, “knobs- in-holes” bispecific antibodies, CrossMab bispecific antibodies (/.e., bispecific domain- exchanged antibodies), charge paired bispecific antibodies, common light chain bispecific antibodies, one-arm single-chain Fab-immunoglobulin gamma bispecific antibodies, disulfide stabilized Fv bispecific antibodies, DuetMabs, controlled Fab-arm exchange bispecific antibodies, strand-exchange engineered domain body bispecific antibodies, two-arm leucine zipper heterodimeric monoclonal bispecific antibodies, KA-body bispecific antibodies, dual variable domain bispecific antibodies, and cross-over dual variable domain bispecific antibodies.
  • quadroma bispecific antibodies such as quadroma bispecific antibodies, “knobs- in-holes” bispecific antibodies, CrossMab bispecific antibodies (/.e., bispecific domain- exchanged antibodies), charge paired bispecific
  • the bispecific antibodies of the disclosure are domain exchanged antibodies referred to in the scientific and patent literature as CrossMabs. See, e.g., Schaefer et al., 2011 , Proc Natl Acad Sci USA 108:11187-92.
  • the CrossMab technology is described in detail in WO 2009/080251 , WO 2009/080252, WO 2009/080253, WO 2009/080254, WO 2013/026833, WO 2016/020309, and Schaefer et al., 2011 , Proc Natl Acad Sci USA 108:11187-92, which are incorporated herein by reference in their entireties.
  • a CrossMab bispecific antibody of the disclosure can be a “CrossMab FAB ” antibody, in which the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged.
  • a CrossMab bispecific antibody of the disclosure can be a “CrossMab VH ' VL ” antibody, in which the only the variable domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged.
  • a CrossMab bispecific antibody of the disclosure can be a “CrossMab CH1 ' CL ” antibody, in which only the constant domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged.
  • CrossMab CH1 ’ CL antibodies in contrast to CrossMab FAB and CrossMab VH ' VL , do not have predicted side products and, therefore, in some embodiments CrossMab CH1 ’ CL bispecific antibodies are preferred. See, Klein et al., 2016, mAbs, 8(6):1010- 1020.
  • the bispecific antibodies of the disclosure are controlled Fab-arm exchange bispecific antibodies.
  • Methods for making Fab-arm exchange bispecific antibodies are described in PCT Publication No. WO2011/131746 and Labrijn et al., 2014 Nat Protoc. 9(10):2450-63, incorporated herein by reference in their entireties.
  • controlled Fab-arm exchange bispecific antibodies can be made by separately expressing two parental IgG 1s containing single matching point mutations in the CH3 domain, mixing the parental lgG1s under redox conditions in vitro to enable recombination of half-molecules, and removing the reductant to allow reoxidation of interchain disulfide bonds, thereby forming the bispecific antibodies.
  • the bispecific antibodies of the disclosure are “bottle opener,” “mAb-Fv,” “mAb-scFv,” “central-scFv,” “central-Fv,” “one-armed central-scFv” or “dual scFv” format bispecific antibodies.
  • Bispecific antibodies of these formats are described in PCT Publication No. WO 2016/182751 , the contents of which are incorporated herein by reference in their entireties. Each of these formats relies on the self-assembling nature of Fc domains of antibody heavy chains, whereby two Fc subunit containing “monomers” assemble into a Fc domain containing “dimer.”
  • the first monomer comprises a scFv covalently linked to the N-terminus of a Fc subunit, optionally via a linker
  • the second monomer comprises a heavy chain (comprising a VH, CH1 , and second Fc subunit).
  • a bottle opener format bispecific antibody further comprises a light chain capable of pairing with the second monomer to form a Fab.
  • a mAb-Fv bispecific antibody format relies upon an “extra” VH domain attached to the C-terminus of one heavy chain monomer and an “extra” VL domain attached to the other heavy chain monomer, forming a third antigen binding domain.
  • a mAb-Fv bispecific antibody comprises a first monomer comprising a first VH domain, CH1 domain and a first Fc subunit, with a VL domain covalently attached to the C-terminus.
  • the second monomer comprises a VH domain, a CH1 domain a second Fc subunit, and a VH covalently attached to the C-terminus of the second monomer.
  • the two C-terminally attached variable domains make up a Fv.
  • the mAb-Fv further comprises two light chains, which when associated with the first and second monomers form Fabs.
  • the mAb-scFv bispecific format relies on the use of a C-terminal attachment of a scFv to one of the monomers of a mAb, thus forming a third antigen binding domain.
  • the first monomer comprises a first heavy chain (comprising a VH, CH1 and a first Fc subunit), with a C- terminally covalently attached scFv.
  • mAb-scFv bispecific antibodies further comprise a second monomer (comprising a VH, CH1 , and first Fc subunit) and two light chains, which when associated with the first and second monomers form Fabs.
  • the central-scFv bispecific format relies on the use of an inserted scFv domain in a mAb, thus forming a third antigen binding domain.
  • the scFv domain is inserted between the Fc subunit and the CH1 domain of one of the monomers, thus providing a third antigen binding domain.
  • the first monomer can comprise a VH domain, a CH1 domain (and optional hinge) and a first Fc subunit, with a scFv covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit using optional domain linkers.
  • the other monomer can be a standard Fab side monomer.
  • Central-scFv bispecific antibodies further comprise two light chains, which when associated with the first and second monomers form Fabs.
  • the central-Fv bispecific format relies on the use of an inserted Fv domain thus forming a third antigen binding domain.
  • Each monomer can contain a component of the Fv (e.g. one monomer comprises a variable heavy domain and the other a variable light domain).
  • one monomer can comprise a VH domain, a CH1 domain, a first Fc subunit and a VL domain covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit, optionally using domain linkers.
  • the other monomer can comprise a VH domain, a CH1 domain, a second Fc subunit and an additional VH domain covalently attached between the C-terminus of the CH1 domain and the N-terminus of the second Fc domain, optionally using domain linkers.
  • Central-Fv bispecific antibodies further comprise two light chains, which when associated with the first and second monomers form Fabs.
  • the one-armed central-scFv bispecific format comprises one monomer comprising just a Fc subunit, while the other monomer comprises an inserted scFv domain thus forming a second antigen binding domain.
  • one monomer can comprise a VH domain, a CH1 domain and a first Fc subunit, with a scFv covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit, optionally using domain linkers.
  • the second monomer can comprise an Fc domain.
  • This embodiment further utilizes a light chain comprising a variable light domain and a constant light domain, that associates with the first monomer to form a Fab.
  • the dual scFv bispecific format comprises a first monomer comprising a scFv covalently attached to the N-terminus of a first Fc subunit, optionally via a linker, and second monomer comprising a scFv covalently attached to the N-terminus of a second Fc subunit, optionally via a linker.
  • Bispecific antibodies of the disclosure can comprise an Fc domain composed of a first and a second subunit.
  • the Fc domain is an IgG Fc domain.
  • the Fc domain is an IgG 1 Fc domain.
  • the Fc domain is an lgG 4 Fc domain.
  • the Fc domain is an lgG 4 Fc domain comprising an amino acid substitution at position S228 (Kabat EU index numbering), particularly the amino acid substitution S228P.
  • the Fc domain is a human Fc domain.
  • the Fc domain is a human IgG 1 Fc domain.
  • An exemplary sequence of a human IgGi Fc region is:
  • the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain.
  • the site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain.
  • said modification is in the CH3 domain of the Fc domain.
  • said modification promoting the association of the first and the second subunit of the Fc domain is a so-called “knob-into-hole” modification, comprising a “knob” modification in one of the two subunits of the Fc domain and a “hole” modification in the other one of the two subunits of the Fc domain.
  • the knob-into-hole technology is described e.g. in US 5,731 ,168; US 7,695,936; Ridgway et a!., 1996, Prot Eng 9:617-621 , and Carter, J, 2001 , Immunol Meth 248:7-15.
  • the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
  • Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine).
  • an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
  • said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W).
  • said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V).
  • the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
  • the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V) and optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbering according to Kabat EU index).
  • the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second subunit of the Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numbering according to Kabat EU index).
  • the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W
  • the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
  • electrostatic steering e.g., as described in Gunasekaran et al., 2010, J Biol Chem 285(25): 19637-466 can be used to promote the association of the first and the second subunit of the Fc domain.
  • the Fc domain comprises one or more amino acid substitutions that reduces binding to an Fc receptor and/or effector function.
  • the Fc receptor is an Fey receptor. In one embodiment the Fc receptor is a human Fc receptor. In one embodiment the Fc receptor is an activating Fc receptor. In a specific embodiment the Fc receptor is an activating human Fey receptor, more specifically human FcyRllla, FcyRI or FcyRlla, most specifically human FcyRllla.
  • the effector function is one or more selected from the group of complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibodydependent cellular phagocytosis (ADCP), and cytokine secretion. In a particular embodiment, the effector function is ADCC.
  • the same one or more amino acid substitution is present in each of the two subunits of the Fc domain.
  • the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor.
  • the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
  • the Fc domain comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329 (numberings according to Kabat EU index). In a more specific embodiment, the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index). In some embodiments, the Fc domain comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index). In one such embodiment, the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain. In one embodiment, the Fc domain comprises an amino acid substitution at position P329.
  • the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index).
  • the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numberings according to Kabat EU index).
  • the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S.
  • the Fc domain comprises amino acid substitutions at positions P329, L234 and L235 (numberings according to Kabat EU index).
  • the Fc domain comprises the amino acid mutations L234A, L235A and P329G (which can be referred to using the shorthand terms “P329G LALA”, “PGLALA” or“LALAPG”).
  • each subunit of the Fc domain comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e.
  • the leucine residue at position 234 is replaced with an alanine residue (L234A)
  • the leucine residue at position 235 is replaced with an alanine residue (L235A)
  • the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
  • the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain.
  • Single chain-based bispecific antibodies of the disclosure can be any of the various types of single chain-based bispecific antibodies known in the art, such as bispecific T-cell engagers (BiTEs), diabodies, tandem diabodies (tandabs), dual-affinity retargeting molecules (DARTs), and bispecific killer cell engagers.
  • BiTEs bispecific T-cell engagers
  • diabodies diabodies
  • tandem diabodies tandem diabodies
  • DARTs dual-affinity retargeting molecules
  • bispecific killer cell engagers bispecific killer cell engagers
  • the bispecific antibodies of the disclosure are bispecific T-cell engagers (BiTEs).
  • BiTEs are single polypeptide chain molecules having two antigen-binding domains, one of which binds to a T-cell antigen and the second of which binds to an antigen present on the surface of a target (see, PCT Publication WO 05/061547; Baeuerle et al., 2008, Drugs of the Future 33: 137-147; Bargou, et al., 2008, Science 321 :974-977, incorporated herein by reference in their entireties).
  • the BiTEs of the disclosure have an antigen binding domain that binds to a T-cell antigen, and a second antigen binding domain that is directed towards glyco-LAMP1 .
  • the bispecific antibodies of the disclosure are dual-affinity retargeting molecules (DARTs).
  • DARTs comprise at least two polypeptide chains that associate (especially through a covalent interaction) to form at least two epitope binding sites, which may recognize the same or different epitopes.
  • Each of the polypeptide chains of a DART comprise an immunoglobulin light chain variable region and an immunoglobulin heavy chain variable region, but these regions do not interact to form an epitope binding site.
  • the immunoglobulin heavy chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin light chain variable region of a different (e.g., the second) DARTTM polypeptide chain to form an epitope binding site.
  • the immunoglobulin light chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin heavy chain variable region of a different (e.g., the second) DART polypeptide chain to form an epitope binding site.
  • DARTs may be monospecific, bispecific, trispecific, etc., thus being able to simultaneously bind one, two, three or more different epitopes (which may be of the same or of different antigens).
  • DARTs may additionally be monovalent, bivalent, trivalent, tetravalent, pentavalent, hexavalent, etc., thus being able to simultaneously bind one, two, three, four, five, six or more molecules.
  • These two attributes of DARTs (/.e., degree of specificity and valency may be combined, for example to produce bispecific antibodies (/.e., capable of binding two epitopes) that are tetravalent (/.e., capable of binding four sets of epitopes), etc.
  • DART molecules are disclosed in PCT Publications WO 2006/113665, WO 2008/157379, and WO 2010/080538, which are incorporated herein by reference in their entireties.
  • one of the binding specificities is directed towards glyco-LAMP1 , and the other is directed to an antigen expressed on immune effector cells.
  • immune effector cell or “effector cell” as used herein refers to a cell within the natural repertoire of cells in the mammalian immune system which can be activated to affect the viability of a target cell.
  • Immune effector cells include cells of the lymphoid lineage such as natural killer (NK) cells, T cells including cytotoxic T cells, or B cells, but also cells of the myeloid lineage can be regarded as immune effector cells, such as monocytes or macrophages, dendritic cells and neutrophilic granulocytes.
  • said effector cell is preferably an NK cell, a T cell, a B cell, a monocyte, a macrophage, a dendritic cell or a neutrophilic granulocyte.
  • Recruitment of effector cells to aberrant cells means that immune effector cells are brought in close vicinity to the aberrant target cells such that the effector cells can directly kill, or indirectly initiate the killing of the aberrant cells that they are recruited to.
  • the bispecific antibodies of the disclosure specifically recognize antigens on immune effector cells that are at least overexpressed by these immune effector cells compared to other cells in the body.
  • Target antigens present on immune effector cells may include CD3, CD8, CD16, CD25, CD28, CD64, CD89, NKG2D and NKp46.
  • the antigen on immune effector cells is CD3 expressed on T cells.
  • CD3 refers to any native CD3 from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
  • the term encompasses “full- length,” unprocessed CD3 as well as any form of CD3 that results from processing in the cell.
  • the term also encompasses naturally occurring variants of CD3, e.g., splice variants or allelic variants.
  • the most preferred antigen on an immune effector cell is the CD3 epsilon chain. This antigen has been shown to be very effective in recruiting T cells to aberrant cells.
  • a bispecific antibody of the disclosure preferably specifically recognizes CD3 epsilon.
  • the amino acid sequence of human CD3 epsilon is shown in UniProt (uniprot.org) accession no. P07766 (version 144), or NCBI (ncbi.nlm.nih.gov/) RefSeq NP_000724.1.
  • the amino acid sequence of cynomolgus [Macaca fascicularis] CD3 epsilon is shown in NCBI GenBank no. BAB71849.1.
  • bispecific antibodies in which the CD3-binding domain specifically binds to human CD3 (e.g., the human CD3 epsilon chain) are used.
  • bispecific antibodies in which the CD3-binding domain specifically binds to the CD3 in the species utilized for the preclinical testing (e.g., cynomolgus CD3 for primate testing) can be used.
  • a binding domain that “specifically binds to” or “specifically recognizes” a target antigen from a particular species does not preclude the binding to or recognition of the antigen from other species, and thus encompasses antibodies in which one or more of the binding domains have inter-species cross-reactivity.
  • a CD3-binding domain that “specifically binds to” or “specifically recognizes” human CD3 may also bind to or recognize cynomolgus CD3, and vice versa.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody H2C (described in PCT publication no. W02008/119567) for binding an epitope of CD3.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody V9 (described in Rodrigues et al., 1992, Int J Cancer Suppl 7:45-50 and U.S. Pat. No. 6,054,297) for binding an epitope of CD3.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody FN18 (described in Nooij et al., 1986, Eur J Immunol 19:981-984) for binding an epitope of CD3.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody SP34 (described in Pessano et al., 1985, EMBO J 4:337-340) for binding an epitope of CD3.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody mAb1 (described in U.S. Pat. No. 10,730,944) for binding an epitope of CD8.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody YTS169 (described in US2015/ 0191543) for binding an epitope of CD8.
  • a bispecific antibody of the disclosure can compete with monoclonal antibodies 4C9 5F4 (described in W01987/005912) for binding an epitope of CD8.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody 3G8_(described in W02006/064136) for binding an epitope of CD16.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody VEP13 (described in Ziegler-Heitbrock et al., 1984, Clin. Exp. Immunol. 58:470-477) for binding an epitope of CD16.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody B73.1 (described in Perussia et al., 1983, J. Immunol.130(5) :2142-2148) for binding an epitope of CD16.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody daclizumab and its variants (described in WO2014/145000) for binding an epitope of CD25.
  • a bispecific antibody of the disclosure can compete with monoclonal antibodies AB1 , AB7, AB11 , or AB12 (described in W02004/045512) for binding an epitope of CD25.
  • a bispecific antibody of the disclosure can compete with monoclonal antibodies ALD25H1 , ALD25H2, or ALD25H4 (described in WO2020/234399) for binding an epitope of CD25.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody FR104 (described in WO2017/103003) for binding an epitope of CD28.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody hCD28.3 (described in WO2011/101791) for binding an epitope of CD28.
  • a bispecific antibody of the disclosure can compete with monoclonal antibodies MS or 21 F2 (described in W02009/077483) for binding an epitope of NKG2D.
  • a bispecific antibody of the disclosure can compete with monoclonal antibodies 5C5, 320, 230, 013, 296 or 395 (described in WO2021/009146) for binding an epitope of NKG2D.
  • a bispecific antibody of the disclosure can compete with monoclonal antibody KYK-2.0 (described in W02010/017103) for binding an epitope of NKG2D.
  • the anti-glyco-LAMP1 antibodies of the disclosure include derivatized antibodies.
  • derivatized antibodies are typically modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc.
  • the derivative can contain one or more non-natural amino acids, e.g., using ambrx technology (see, e.g., Wolfson, 2006, Chem. Biol. 13(10):1011-2).
  • the anti-glyco-LAMP1 antibodies or binding fragments may be antibodies or fragments whose sequences have been modified to alter at least one constant region-mediated biological effector function.
  • an anti-glyco-LAMP1 antibody may be modified to reduce at least one constant region-mediated biological effector function relative to the unmodified antibody, e.g., reduced binding to the Fc receptor (FcyR).
  • FcyR binding can be reduced by mutating the immunoglobulin constant region segment of the antibody at particular regions necessary for FcyR interactions (see, e.g., Canfield and Morrison, 1991 , J. Exp. Med. 173:1483-1491 ; and Lund et al., 1991 , J.
  • the anti-glyco-LAMP1 antibody or binding fragments described herein include antibodies and/or binding fragments that have been modified to acquire or improve at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., to enhance FcyR interactions (see, e.g., US 2006/0134709).
  • an anti-glyco-LAMP1 antibody of the disclosure can have a constant region that binds FcyRIIA, FcyRIIB and/or FcyRIIIA with greater affinity than the corresponding wild type constant region.
  • antibodies of the disclosure may have alterations in biological activity that result in increased or decreased opsonization, phagocytosis, or ADCC. Such alterations are known in the art. For example, modifications in antibodies that reduce ADCC activity are described in U.S. Pat. No. 5,834,597.
  • An exemplary ADCC lowering variant corresponds to “mutant 3” (shown in FIG. 4 of U.S. Pat. No. 5,834,597) in which residue 236 is deleted and residues 234, 235 and 237 (using EU numbering) are substituted with alanines.
  • Another exemplary ADCC lowering variant comprises amino acid mutations L234A, L235A and P329G (which can be referred to using the shorthand term “P329G LALA”).
  • the anti-glyco-LAMP1 antibodies of the disclosure have low levels of, or lack, fucose.
  • Antibodies lacking fucose have been correlated with enhanced ADCC activity, especially at low doses of antibody. See Shields et al., 2002, J. Biol. Chem. 277:26733- 26740; Shinkawa et al., 2003, J. Biol. Chem. 278:3466-73.
  • Methods of preparing fucose-less antibodies include growth in rat myeloma YB2/0 cells (ATCC CRL 1662). YB2/0 cells express low levels of FUT8 mRNA, which encodes a-1 , 6-fucosyltransferase, an enzyme necessary for fucosylation of polypeptides.
  • the anti-glyco-LAMP1 antibodies or binding fragments include bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to an Fc domain is bisected by GIcNAc.
  • Such variants may have reduced fucosylation and/or improved ADCC function as described above. Examples of such antibody variants are described, e.g., in Umana et al., 1999, Nat Biotechnol 17:176-180; Ferrara et al., 2006, Biotechn Bioeng 93: 851- 861 ; WO 99/54342; WO 2004/065540; and WO 2003/011878.
  • the anti-glyco-LAMP1 antibodies or binding fragments include modifications that increase or decrease their binding affinities to the fetal Fc receptor, FcRn, for example, by mutating the immunoglobulin constant region segment at particular regions involved in FcRn interactions (see, e.g., WO 2005/123780).
  • an anti- glyco-LAMP1 antibody of the IgG class is mutated such that at least one of amino acid residues 250, 314, and 428 of the heavy chain constant region is substituted alone, or in any combinations thereof, such as at positions 250 and 428, or at positions 250 and 314, or at positions 314 and 428, or at positions 250, 314, and 428, with positions 250 and 428 a specific combination.
  • the substituting amino acid residue can be any amino acid residue other than threonine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, valine, tryptophan, or tyrosine.
  • the substituting amino acid residue can be any amino acid residue other than leucine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine.
  • the substituting amino acid residues can be any amino acid residue other than methionine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine.
  • Specific combinations of suitable amino acid substitutions are identified in Table 1 of U.S. Pat. No. 7,217,797, which is incorporated herein by reference. Such mutations increase binding to FcRn, which protects the antibody from degradation and increases its half-life.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure has one or more amino acids inserted into one or more of its hypervariable regions, for example as described in Jung and Pluckthun, 1997, Protein Engineering 10:9, 959-966; Yazaki et al., 2004, Protein Eng. Des Sei. 17(5):481-9. Epub 2004 Aug. 17; and U.S. Pat. App. No. 2007/0280931.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure is attached to a detectable moiety.
  • Detectable moieties include a radioactive moiety, a colorimetric molecule, a fluorescent moiety, a chemiluminescent moiety, an antigen, an enzyme, a detectable bead (such as a magnetic or electrodense (e.g., gold) bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin)).
  • Radioisotopes or radionuclides may include 3 H, 14 C, 15 N, 35 S, 90 Y, "Tc, 111 ln, 125 l, 131 l.
  • Fluorescent labels may include rhodamine, lanthanide phosphors, fluorescein and its derivatives, fluorochrome, GFP (GFP for “Green Fluorescent Protein”), dansyl, umbelliferone, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine.
  • GFP Green Fluorescent Protein
  • Enzymatic labels may include horseradish peroxidase, p galactosidase, luciferase, alkaline phosphatase, glucose-6-phosphate dehydrogenase (“G6PDH”), alpha-D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase and peroxidase.
  • G6PDH glucose-6-phosphate dehydrogenase
  • Chemiluminescent labels or chemiluminescers such as isoluminol, luminol and the dioxetanes.
  • detectable moieties include molecules such as biotin, digoxygenin or 5- bromodeoxyuridine.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure may be used in a detection system to detect a biomarker in a sample, such as, e.g., a patient-derived biological sample.
  • the biomarker may be a protein biomarker (e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosylated with GalNAc on the threonine residue shown in bold underlined text) present on the surface of or within, e.g., a cancer cell (e.g., from a tissue biopsy or a circulating tumor cell) or a cancer-derived extracellular vesicle).
  • a protein biomarker e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosylated with GalNAc on the threonine residue shown in bold underlined text
  • a cancer cell e.g., from a tissue biopsy or a circulating tumor cell
  • Extracellular vesicles are lipid membranous vesicles released from almost all cell types. EVs carry complex molecular cargoes, such as proteins, RNAs (e.g., mRNA and noncoding RNAs (microRNA, transfer RNA, circular RNA and long noncoding RNA)), and DNA fragments.
  • RNAs e.g., mRNA and noncoding RNAs (microRNA, transfer RNA, circular RNA and long noncoding RNA)
  • DNA fragments DNA fragments.
  • the molecular contents of EVs largely reflect the cell of origin and thus show celltype specificity.
  • cancer-derived EVs contain and present on their surfaces cancerspecific molecules expressed by parental cancer cells (see, e.g., Yanez-M6 et al., 2015, J Extracell Vesicles. 4:27066; and Li et al., 2015, Cell Res. 25:981-984)
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure is used in a method of detecting a biomarker in a sample comprising EVs (e.g., a liquid biopsy).
  • the biomarker is recognized by the anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure.
  • the biomarker may be present on the surface of EVs.
  • Exemplary methods of detecting the biomarker include, but are not limited to, immunoassays, such as immunoprecipitation; Western blot; ELISA; immunohistochemistry; immunocytochemistry; flow cytometry; and immuno-PCR.
  • an immunoassay can be a chemiluminescent immunoassay.
  • an immunoassay can be a high-throughput and/or automated immunoassay platform.?
  • the method of detecting a biomarker in a sample comprises contacting a sample with an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure. In some embodiments, such methods further comprise contacting the sample with one or more detection labels. In some embodiments, an anti-glyco-LAMP1 antibody or antigenbinding fragment of the disclosure is labeled with one or more detection labels.
  • a capture assay is performed to selectively capture EVs from a sample such as a liquid biopsy sample exemplary examples of capture assays for EVs are described in US2021/0214806, which is hereby incorporated by reference in its entirety.
  • a capture assay is performed to selectively capture EVs of a certain size range, and/or certain characteristic(s), for example, EVs associated with cancer (e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosylated with GalNAc on the threonine residue shown in bold underlined text), glycosylated with GalNAc on the threonine residue shown in bold underlined text).
  • cancer e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosylated with GalNAc on the threonine residue shown in bold underlined text
  • GalNAc glycosylated with GalNAc
  • a sample prior to performing the capture assay, a sample may be pre-processed to remove non-EVs, including but not limited to, e.g., soluble proteins and interfering entities such as, e.g., cell debris.
  • EVs are purified from a sample using size exclusion chromatography.
  • the method for detecting a biomarker comprises analyzing individual EVs (e.g., a single EV assay).
  • an assay may involve (i) a capture assay such as an antibody capture assay and (ii) one or more detection assays for at least one or more additional biomarkers, wherein the capture assay is performed prior to the detection assay. See, e.g., US2021/0214806.C
  • a capture assay comprises a step of contacting a sample with at least one capture agent comprising an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure.
  • the capture agent may be immobilized on a solid substrate.
  • the solid substrate may be provided in a form that is suitable for capturing EVs and does not interfere with downstream handling, processing, and/or detection.
  • a solid substrate may be or comprise a bead (e.g., a magnetic bead).
  • a solid substrate may be or comprise a surface.
  • such a surface may be a capture surface of an assay chamber (e.g., a tube, a well, a microwell, a plate, a filter, a membrane, a matrix, etc.), in some embodiments, a capture agent is ar comprises a magnetic bead comprising a capture moiety (e.g., an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure) conjugated thereto. See, e.g., US2021/0214806.
  • a capture moiety e.g., an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with 3C7, or an antibody or antigen binding fragment comprising heavy and light chain variable regions of 3C7 (SEQ ID NOS:1 and 2, respectively).
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with 13C3 or an antibody or antigen binding fragment comprising heavy chain variable region of murine or humanized 13C3 (e.g., SEQ ID NO: 23 (murine) and SEQ ID NOS: 133-147 (exemplary humanized sequences)) and a light chain variable region of murine or humanized 13C3 (e.g., SEQ ID NO: 24 (murine) and SEQ ID NO: 148-153 (exemplary humanized sequences)).
  • heavy chain variable region of murine or humanized 13C3 e.g., SEQ ID NO: 23 (murine) and SEQ ID NOS: 133-147 (exemplary humanized sequences)
  • a light chain variable region of murine or humanized 13C3 e.g., SEQ ID NO: 24 (murine) and SEQ ID NO: 148-153 (exemplary humanized sequences)
  • an anti-glyco-LAMP1 antibody or antigen binding fragment of the disclosure competes with 13G2, or an antibody or antigen binding fragment comprising heavy and light chain variable regions of 13G2 (SEQ ID NOS:45 and 46, respectively).
  • Competition can be assayed on cells that express the glyco-LAMP1 epitope bound by 3C7, 13C3, or 13G2 or on a glycosylated LAMP1 peptide containing the epitope bound by 3C7, 13C3, or 13G2, e.g., (i) the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NQ:200), glycosylated with GalNAc on the threonine residue shown in bold and underlined text; (ii) the peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:216), glycosylated with GalNAc on the serine and threonine residues shown in bold and underlined text; (iii) the peptide CEQDRPSPTTAPPSPSP (SEQ ID NO:217), glycosylated with GalNAc on the serine and threonine residues shown in bold and underlined text; and (iv) the peptide CEQDR
  • Cells on which a competition assay can be carried out include but are not limited to the prostate, breast, skin cell lines (e.g., breast cancer cell line T47D) and recombinant cells that are engineered to express the glyco-LAMP1 epitope.
  • T47D cells which express LAMP1 but are inherently Tn-negative, are engineered to express the LAMP1 Tn-antigen by knockout of the COSMC chaperone. Wildtype cells expressing the unglycosylated form of LAMP1 can be used as a negative control.
  • Assays for competition include, but are not limited to, a radioactive material labeled immunoassay (RIA), an enzyme-linked immunosorbent assay (ELISA), a sandwich ELISA, fluorescence activated cell sorting (FACS) assays, surface plasmon resonance (e.g., Biacore) assays, and bio-layer interferometry (BLI) assays.
  • RIA radioactive material labeled immunoassay
  • ELISA enzyme-linked immunosorbent assay
  • FACS fluorescence activated cell sorting
  • Biacore surface plasmon resonance
  • BLI bio-layer interferometry
  • antibody competition assays can be carried out using BLI (e.g., using an Octet-HTX system (Molecular Devices)).
  • Antibody competition or epitope binning of monoclonal antibodies can be assessed in tandem against their specific antigen using BLI.
  • the antigen in a BLI assay, can be immobilized onto a biosensor and presented to two competing antibodies in consecutive steps. The binding to nonoverlapping epitopes occurs if saturation with the first antibody does not block the binding of the second antibody.
  • antibody competition assays can be carried out using surface plasmon resonance (e.g., using a Biacore system (Cytiva)).
  • one or more antibodies can be immobilized onto a biosensor and presented with an analyte (e.g., the glyco-LAMP1 peptides of SEQ ID NOS: 154, 200, 216, or 217, or a negative control analyte such as an unglycosylated LAMP1 peptide of SEQ ID NO: 155).
  • analyte e.g., the glyco-LAMP1 peptides of SEQ ID NOS: 154, 200, 216, or 217, or a negative control analyte such as an unglycosylated LAMP1 peptide of SEQ ID NO: 155.
  • the antibodies are contacted with a saturating concentration of the analyte, for example a concentration of at least about 0.5 pM. In some embodiments the saturating concentration is about 1 pM, about 1 .5 pM, or about 2 pM.
  • the affinities of both antibodies are preferably measured using the
  • a detectable label such as a fluorophore, biotin or an enzymatic (or even radioactive) label to enable subsequent identification.
  • a detectable label such as a fluorophore, biotin or an enzymatic (or even radioactive) label
  • cells expressing glyco-LAMP1 are incubated with unlabeled test antibody, labeled reference antibody is added, and the intensity of the bound label is measured. If the test antibody competes with the labeled reference antibody by binding to an overlapping epitope, the intensity will be decreased relative to a control reaction carried out without test antibody.
  • the concentration of labeled reference antibody that yields 80% of maximal binding (“conc 8 o%”) under the assay conditions is first determined, and a competition assay carried out with 10 x conc 8 o% of unlabeled test antibody and conc 80 % of labeled reference antibody.
  • the inhibition can be expressed as an inhibition constant, or Kj, which is calculated according to the following formula:
  • Ki ICso/(1 + [reference Ab concentration]/K d ), where IC 5 o is the concentration of test antibody that yields a 50% reduction in binding of the reference antibody and K d is the dissociation constant of the reference antibody, a measure of its affinity for glyco-LAMP1 .
  • Antibodies that compete with anti-glyco-LAMP1 antibodies disclosed herein can have a Kj from 10 pM to 10 nM under assay conditions described herein.
  • a test antibody is considered to compete with a reference antibody if it decreases binding of the reference antibody by at least about 20% or more, for example, by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or even more, or by a percentage ranging between any of the foregoing values, at a reference antibody concentration that is 80% of maximal binding under the specific assay conditions used, and a test antibody concentration that is 10-fold higher than the reference antibody concentration.
  • the glycosylated LAMP1 peptide of one of SEQ ID NOS: 154, 200, 216, or 217 is adhered onto a solid surface, e.g., a microwell plate, by contacting the plate with a solution of the peptide (e.g., at a concentration of 1 pg/mL in PBS over night at 4°C).
  • a solution of the peptide e.g., at a concentration of 1 pg/mL in PBS over night at 4°C.
  • the plate is washed (e.g., 0.1% Tween 20 in PBS) and blocked (e.g., in Superblock, Thermo Scientific, Rockford, IL).
  • a mixture of sub-saturating amount of biotinylated 3C7, 13C3, or 13G2 e.g., at a concentration of 80 ng/mL
  • unlabeled 3C7, 13C3, or 13G2 the “reference” antibody
  • competing anti-glyco-LAMP1 antibody the "test” antibody
  • serial dilution e.g., at a concentration of 2.8 pg/mL, 8.3 pg/mL, or 25 pg/mL
  • ELISA buffer e.g., 1% BSA and 0.1% Tween 20 in PBS
  • the plate is washed, 1 pg/mL HRP-conjugated Streptavidin diluted in ELISA buffer is added to each well and the plates incubated for 1 hour. Plates are washed and bound antibodies were detected by addition of substrate (e.g., TMB, Biofx Laboratories Inc., Owings Mills, MD). The reaction is terminated by addition of stop buffer (e.g., Bio FX Stop Reagents, Biofx Laboratories Inc., Owings Mills, MD) and the absorbance is measured at 650 nm using microplate reader (e.g., VERSAmax, Molecular Devices, Sunnyvale, CA).
  • substrate e.g., TMB, Biofx Laboratories Inc., Owings Mills, MD
  • stop buffer e.g., Bio FX Stop Reagents, Biofx Laboratories Inc., Owings Mills, MD
  • the absorbance is measured at 650 nm using microplate reader (e.g.,
  • Variations on this competition assay can also be used to test competition between 3C7, 13C3, or 13G2 and another anti-glyco-LAMP1 antibody.
  • the anti-glyco-LAMP1 antibody is used as a reference antibody and 3C7, 13C3, or 13G2 is used as a test antibody.
  • a membrane-bound glyco-LAMP1 expressed on the cell surface for example on the surface of one of the cell types mentioned above can be used.
  • about 10 4 to 10 6 transfectants e.g., about 10 5 transfectants, are used.
  • Other formats for competition assays are known in the art and can be employed.
  • an anti-glyco-LAMP1 antibody of the disclosure reduces the binding of labeled 3C7, 13C3, or 13G2 by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by a percentage ranging between any of the foregoing values (e.g., an anti-glyco-LAMP1 antibody of the disclosure reduces the binding of labeled 3C7, 13C3, or 13G2 by 50% to 70%) when the anti-glyco-LAMP1 antibody is used at a concentration of 0.08 pg/mL, 0.4 pg/mL, 2 pg/mL, 10 pg/mL, 50 pg/mL, 100 pg/mL or at a concentration ranging between any of the foregoing values (e.g., at a concentration ranging from 2 pg/mL to 10 pg/mL).
  • 3C7, 13C3, or 13G2 reduces the binding of a labeled anti-glyco- LAMP1 antibody of the disclosure by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by a percentage ranging between any of the foregoing values (e.g., 3C7, 13C3, or 13G2 reduces the binding of a labeled an anti-glyco- LAMP1 antibody of the disclosure by 50% to 70%) when 3C7, 13C3, or 13G2 is used at a concentration of 0.4 pg/mL, 2 pg/mL, 10 pg/mL, 50 pg/mL, 250 pg/mL or at a concentration ranging between any of the foregoing values (e.g., at a concentration ranging from 2 pg/mL to 10 pg/mL).
  • the 3C7, 13C3, or 13G2 antibody can be replaced by any antibody or antigen-binding fragment comprising the CDRs or the heavy and light chain variable regions of 3C7, 13C3, or 13G2, such as a humanized or chimeric counterpart of 3C7, 13C3, or 13G2.
  • Exemplary humanized heavy and light chain variable regions of 13C3 are provided in Tables 4A-4G.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure has an epitope which is the same or similar to the epitope of 3C7, 13C3, or 13G2.
  • the epitope of an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure can be characterized by performing, for example, alanine scanning.
  • SEQ ID NO: 154 A library of glycopeptides, each varying from the LAMP1 glycopeptide (SEQ ID NO: 154) by an alanine point mutation at one amino acid position of SEQ ID NO: 154 (or, where the LAMP1 peptide has an alanine, by a glycine point mutation
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain variable sequences (or encoded by the nucleotide sequences) set forth in Tables 1A-1C (murine) and 4A-4G (humanized).
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain CDR sequences (or encoded by the nucleotide sequences) set forth in Tables 1A-3D.
  • the framework sequences for such anti-glyco-LAMP1 antibody and antigenbinding fragment can be the native murine framework sequences of the VH and VL sequences set forth in Tables 1A-1C or can be non-native (e.g., humanized or human) framework sequences.
  • Humanized framework sequences of the VH and VL sequences of 13C3 are set forth in Tables 4A-4G.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS: 1 and 2, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS: 23 and 24, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of SEQ ID NOS: 45 and 46, respectively.
  • the disclosure provides an anti-LAMP1 antibody or antigen binding fragment having a heavy chain variable region having at least 95%, 98%, 99%, or 99.5% sequence identity of one of SEQ ID NOS:133-147 and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity of one of SEQ ID NOS: 148-153.
  • an anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure is a single-chain variable fragment (scFv).
  • An exemplary scFv comprises the heavy chain variable fragment N-terminal to the light chain variable fragment.
  • Another exemplary scFv comprises the light chain variable fragment N-terminal to the heavy chain variable fragment.
  • the scFv heavy chain variable fragment and light chain variable fragment are covalently bound to a linker sequence of 4-15 amino acids.
  • the scFv can be in the form of a bi-specific T-cell engager or within a chimeric antigen receptor (CAR).
  • the anti-glyco-LAMP1 antibodies of the disclosure specifically bind to the LAMP1 glycoprotein CEQDRPSPTTAPPAPPSPSP (SEQ ID N0:200), glycosylated with GalNAc on the threonine residue shown in bold underlined text.
  • the anti-glyco-LAMP1 antibodies of the disclosure specifically bind to the LAMP1 glycoprotein CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:216), glycosylated with GalNAc on the threonine residues shown in bold underlined text.
  • the anti-glyco-LAMP1 antibodies of the disclosure specifically bind to the LAMP1 glycoprotein CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:217), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text.
  • the anti-glyco-LAMP1 antibodies of the disclosure specifically bind to the LAMP1 glycoprotein CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:154), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text.
  • the anti-glyco-LAMP1 antibodies of the disclosure specifically binds to a LAMP1 glycoprotein described above, and does not specifically bind to one or more of: the unglycosylated LAMP1 peptide CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 155) (the “unglycosylated LAMP1 peptide”); the MUC1 tandem repeat (VTSAPDTRPAPGSTAPPAHG) 3 (SEQ ID NO:208) that has been glycosylated in vitro using purified recombinant human glycosyltransferases GalNAc-T1 , GalNAc-T2, and GalNAc-T4 (“the first MUC1 glycopeptide”); the MUC1 peptide TAPPAHGVTSAPDTRPAPGSTAPPAHGVT (SEQ ID NO:209) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text (the “second MUC
  • CD44v6 glycopeptide the MUC4 peptide CTIPSTAMHTRSTAAPIPILP (SEQ ID NO:213) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text (the “MUC4 glycopeptide”); and the cMET peptide PTKSFISGGSTITGVGKNLN (SEQ ID NO:214) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text (the “cMET glycopeptide”).
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the unglycosylated LAMP1 peptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the first MUC1 glycopeptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the second MUC1 glycopeptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the PDPN glycopeptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the CD44v6 glycopeptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the MUC4 glycopeptide.
  • an anti-glyco-LAMP1 antibody of the disclosure has a binding affinity to the LAMP1 glycopeptide which is at least 3 times, at least 5 times, at least 10 times, at least 20 times, at least 50 times, at least 100 times, or at least 1000 times the binding affinity of the anti-glyco-LAMP1 antibody to the cMET glycopeptide.
  • affinity is measured by surface plasmon resonance (e.g., Biacore).
  • affinity is measured by surface plasmon resonance (e.g., Biacore).
  • ADCs antibody drug conjugates
  • the ADCs generally comprise an anti-glyco-LAMP1 antibody and/or binding fragment as described herein having one or more cytotoxic and/or cytostatic agents linked thereto by way of one or more linkers.
  • the ADCs are compounds according to structural formula (I):
  • [D-L-XY] n -Ab or salts thereof where each “D” represents, independently of the others, a cytotoxic and/or cytostatic agent (“drug”); each “L” represents, independently of the others, a linker; “Ab” represents an anti-glyco-LAMP1 antigen binding domain, such as an anti-glyco-LAMP1 antibody or binding fragment described herein; each “XY” represents a linkage formed between a functional group R x on the linker and a "complementary" functional group R y on the antibody, and n represents the number of drugs linked to, or drug-to-antibody ratio (DAR), of the ADC.
  • DAR drug-to-antibody ratio
  • Specific embodiments of the various antibodies (Ab) that can comprise the ADCs include the various embodiments of anti-glyco-LAMP1 antibodies and/or binding fragments described above.
  • each D is the same and/or each L is the same.
  • cytotoxic and/or cytostatic agents (D) and linkers (L) that can comprise the anti-glyco-LAMP1 ADCs of the disclosure, as well as the number of cytotoxic and/or cytostatic agents linked to the ADCs, are described in more detail below.
  • the cytotoxic and/or cytostatic agents may be any agents known to inhibit the growth and/or replication of and/or kill cells, and in particular cancer and/or tumor cells. Numerous agents having cytotoxic and/or cytostatic properties are known in the literature. Non-limiting examples of classes of cytotoxic and/or cytostatic agents include, by way of example and not limitation, radionuclides, alkylating agents, topoisomerase I inhibitors, topoisomerase II inhibitors, DNA intercalating agents (e.g., groove binding agents such as minor groove binders), RNA/DNA antimetabolites, cell cycle modulators, kinase inhibitors, protein synthesis inhibitors, histone deacetylase inhibitors, mitochondria inhibitors, and antimitotic agents.
  • radionuclides include, by way of example and not limitation, radionuclides, alkylating agents, topoisomerase I inhibitors, topoisomerase II inhibitors, DNA intercalating agents (e.g., groove binding agents such as minor groove bind
  • Alkylating Agents asaley ((L-Leucine, N-[N-acetyl-4-[bis-(2-chloroethyl)amino]-DL- phenylalanyl]-, ethylester; NSC 167780; CAS Registry No. 3577897)); AZQ ((1 ,4- cyclohexadiene- 1 ,4-dicarbamic acid, 2,5-bis(1-aziridinyl)-3,6-dioxo-, diethyl ester; NSC 182986; CAS Registry No.
  • BCNU ((N,N'-Bis(2-chloroethyl)-N-nitrosourea; NSC 409962; CAS Registry No. 154938)); busulfan (1 ,4-butanediol dimethanesulfonate; NSC 750; CAS Registry No. 55981); (carboxyphthalato)platinum (NSC 27164; CAS Registry No. 65296813); CBDCA ((cis-(1 ,1-cyclobutanedicarboxylato)diammineplatinum(ll)); NSC 241240; CAS Registry No.
  • CCNU ((N-(2-chloroethyl)-N'-cyclohexyl-N-nitrosourea; NSC 79037; CAS Registry No. 13010474)); CHIP (iproplatin; NSC 256927); chlorambucil (NSC 3088; CAS Registry No. 305033); chlorozotocin ((2-[[[(2-chloroethyl) nitrosoamino]carbonyl]amino]-2- deoxy-D-glucopyranose; NSC 178248; CAS Registry No. 54749905)); cis-platinum (cisplatin; NSC 119875; CAS Registry No.
  • PCNU ((1-(2-chloroethyl)-3-(2,6-dioxo-3-piperidyl)-1 -nitrosourea; NSC 95466; CAS Registry No. 13909029)); piperazine alkylator ((1-(2-chloroethyl)-4-(3- chloropropyl)-piperazine dihydrochloride; NSC 344007)); piperazinedione (NSC 135758; CAS Registry No. 41109802); pipobroman ((N,N-bis(3-bromopropionyl) piperazine; NSC 25154; CAS Registry No.
  • uracil nitrogen mustard desmethyldopan; NSC 34462; CAS Registry No. 66751; Yoshi-864 ((bis(3-mesyloxy propyl)amine hydrochloride; NSC 102627; CAS Registry No. 3458228).
  • Topoisomerase I Inhibitors camptothecin (NSC 94600; CAS Registry No. 7689-03-4); various camptothecin derivatives and analogs (for example, NSC 100880, NSC 603071 , NSC 107124, NSC 643833, NSC 629971 , NSC 295500, NSC 249910, NSC 606985, NSC 74028, NSC 176323, NSC 295501 , NSC 606172, NSC 606173, NSC 610458, NSC 618939, NSC 610457, NSC 610459, NSC 606499, NSC 610456, NSC 364830, and NSC 606497); morpholinisoxorubicin (NSC 354646; CAS Registry No.
  • Topoisomerase II Inhibitors doxorubicin (NSC 123127; CAS Registry No. 25316409); amonafide (benzisoquinolinedione; NSC 308847; CAS Registry No. 69408817); m-AMSA ((4'- (9-acridinylamino)-3'-methoxymethanesulfonanilide; NSC 249992; CAS Registry No. 51264143)); anthrapyrazole derivative ((NSC 355644); etoposide (VP-16; NSC 141540; CAS Registry No.
  • pyrazoloacridine (pyrazolo[3,4,5-kl]acridine-2(6H)-propanamine, 9- methoxy-N, N-dimethyl-5-nitro-, monomethanesulfonate; NSC 366140; CAS Registry No. 99009219); bisantrene hydrochloride (NSC 337766; CAS Registry No. 71439684); daunorubicin (NSC 821151 ; CAS Registry No. 23541506); deoxydoxorubicin (NSC 267469; CAS Registry No. 63950061); mitoxantrone (NSC 301739; CAS Registry No.
  • DNA Intercalating Agents anthramycin (CAS Registry No. 4803274); chicamycin A (CAS Registry No. 89675376); tomaymycin (CAS Registry No. 35050556); DC-81 (CAS Registry No. 81307246); sibiromycin (CAS Registry No. 12684332); pyrrolobenzodiazepine derivative (CAS Registry No.
  • RNA/DNA Antimetabolites L-alanosine (NSC 153353; CAS Registry No. 59163416); 5- azacytidine (NSC 102816; CAS Registry No. 320672); 5-fluorouracil (NSC 19893; CAS Registry No. 51218); acivicin (NSC 163501 ; CAS Registry No.
  • methotrexate derivative N-[[4-[[(2,4-diamino-6- pteridinyl)methyl]methylamino]-1-naphthalenyl]car- bonyl]L-glutamic acid; NSC 174121); PALA ((N-(phosphonoacetyl)-L-aspartate; NSC 224131 ; CAS Registry No. 603425565); pyrazofurin (NSC 143095; CAS Registry No. 30868305); trimetrexate (NSC 352122; CAS Registry No. 82952645).
  • DNA Antimetabolites 3-HP (NSC 95678; CAS Registry No. 3814797); 2'-deoxy-5- fluorouridine (NSC 27640; CAS Registry No. 50919); 5-HP (NSC 107392; CAS Registry No. 19494894); a-TGDR (a-2'-deoxy-6-thioguanosine; NSC 71851 CAS Registry No. 2133815); aphidicolin glycinate (NSC 303812; CAS Registry No. 92802822); ara C (cytosine arabinoside; NSC 63878; CAS Registry No. 69749); 5-aza-2'-deoxycytidine (NSC 127716; CAS Registry No.
  • Cell Cycle Modulators silibinin (CAS Registry No. 22888-70-6); epigallocatechin gallate (EGCG; CAS Registry No. 989515); procyanidin derivatives (e.g., procyanidin A1 [CAS Registry No. 103883030], procyanidin B1 [CAS Registry No. 20315257], procyanidin B4 [CAS Registry No. 29106512], arecatannin B1 [CAS Registry No. 79763283]); isoflavones (e.g., genistein [4%5,7-trihydroxyisoflavone; CAS Registry No. 446720], daidzein [4',7- di hydroxyisoflavone, CAS Registry No.
  • procyanidin derivatives e.g., procyanidin A1 [CAS Registry No. 103883030], procyanidin B1 [CAS Registry No. 20315257], procyanidin B4 [CAS Registry No. 29106512], arecatannin B1 [CAS Registry No
  • indole-3-carbinol (CAS Registry No. 700061); quercetin (NSC 9219; CAS Registry No. 117395); estramustine (NSC 89201 ; CAS Registry No. 2998574); nocodazole (CAS Registry No. 31430189); podophyllotoxin (CAS Registry No. 518285); vinorelbine tartrate (NSC 608210; CAS Registry No. 125317397); cryptophycin (NSC 667642; CAS Registry No. 124689652).
  • Kinase Inhibitors afatinib (CAS Registry No. 850140726); axitinib (CAS Registry No. 319460850); ARRY-438162 (binimetinib) (CAS Registry No. 606143899); bosutinib (CAS Registry No. 380843754); cabozantinib (CAS Registry No. 1140909483); ceritinib (CAS Registry No. 1032900256); crizotinib (CAS Registry No. 877399525); dabrafenib (CAS Registry No. 1195765457); dasatinib (NSC 732517; CAS Registry No.
  • nintedanib (CAS Registry No. 656247175); palbociclib (CAS Registry No. 571190302); pazopanib (NSC 737754; CAS Registry No. 635702646); pegaptanib (CAS Registry No. 222716861); ponatinib (CAS Registry No. 1114544318); rapamycin (NSC 226080; CAS Registry No. 53123889); regorafenib (CAS Registry No. 755037037); AP 23573 (ridaforolimus) (CAS Registry No. 572924540); INCB018424 (ruxolitinib) (CAS Registry No.
  • ARRY-142886 (selumetinib) (NSC 741078; CAS Registry No. 606143-52-6); sirolimus (NSC 226080; CAS Registry No. 53123889); sorafenib (NSC 724772; CAS Registry No. 475207591); sunitinib (NSC 736511 ; CAS Registry No. 341031547); tofacitinib (CAS Registry No. 477600752); temsirolimus (NSC 683864; CAS Registry No. 163635043); trametinib (CAS Registry No. 871700173); vandetanib (CAS Registry No.
  • vemurafenib (CAS Registry No. 918504651); SU6656 (CAS Registry No. 330161870); CEP- 701 (lesaurtinib) (CAS Registry No. 111358884); XL019 (CAS Registry No. 945755566); PD- 325901 (CAS Registry No. 391210109); PD-98059 (CAS Registry No. 167869218); ATP- competitive TORC1/TORC2 inhibitors including PI-103 (CAS Registry No. 371935749), PP242 (CAS Registry No. 1092351671), PP30 (CAS Registry No. 1092788094), Torin 1 (CAS Registry No.
  • Protein Synthesis Inhibitors acriflavine (CAS Registry No. 65589700); amikacin (NSC 177001 ; CAS Registry No. 39831555); arbekacin (CAS Registry No. 51025855); astromicin (CAS Registry No. 55779061); azithromycin (NSC 643732; CAS Registry No. 83905015); bekanamycin (CAS Registry No. 4696768); chlortetracycline (NSC 13252; CAS Registry No. 64722); clarithromycin (NSC 643733; CAS Registry No. 81103119); clindamycin (CAS Registry No. 18323449); clomocycline (CAS Registry No.
  • neomycin B framycetin
  • gentamycin NSC 82261 ; CAS Registry No. 1403663
  • glycylcyclines such as tigecycline (CAS Registry No. 220620097)
  • hygromycin B CAS Registry No. 31282049
  • isepamicin CAS Registry No. 67814760
  • josamycin NSC 122223; CAS Registry No. 16846245
  • kanamycin CAS Registry No. 8063078
  • ketolides such as telithromycin (CAS Registry No. 191114484), cethromycin (CAS Registry No. 205110481), and solithromycin (CAS Registry No.
  • lincomycin (CAS Registry No. 154212); lymecycline (CAS Registry No. 992212); meclocycline (NSC 78502; CAS Registry No. 2013583); metacycline (rondomycin; NSC 356463; CAS Registry No. 914001); midecamycin (CAS Registry No. 35457808); minocycline (NSC 141993; CAS Registry No. 10118908); miocamycin (CAS Registry No. 55881077); neomycin (CAS Registry No. 119040); netilmicin (CAS Registry No. 56391561); oleandomycin (CAS Registry No. 3922905); oxazolidinones, such as eperezolid (CAS Registry No.
  • Histone Deacetylase Inhibitors abexinostat (CAS Registry No. 783355602); belinostat (NSC 726630; CAS Registry No. 414864009); chidamide (CAS Registry No. 743420022); entinostat (CAS Registry No. 209783802); givinostat (CAS Registry No. 732302997); mocetinostat (CAS Registry No. 726169739); panobinostat (CAS Registry No. 404950807); quisinostat (CAS Registry No. 875320299); resminostat (CAS Registry No. 864814880); romidepsin (CAS Registry No.
  • Mitochondria Inhibitors pancratistatin (NSC 349156; CAS Registry No. 96281311); rhodamine-123 (CAS Registry No. 63669709); edelfosine (NSC 324368; CAS Registry No. 70641519); d-alpha-tocopherol succinate (NSC 173849; CAS Registry No. 4345033); compound 11 p (CAS Registry No. 865070377); aspirin (NSC 406186; CAS Registry No. 50782); ellipticine (CAS Registry No. 519233); berberine (CAS Registry No. 633658); cerulenin (CAS Registry No.
  • GX015-070 Obatoclax®; 1H-lndole, 2-(2-((3,5-dimethyl-1 H- pyrrol-2-yl)methylene)-3-methoxy-2H-pyrrol-5-yl)-; NSC 729280; CAS Registry No. 803712676); celastrol (tripterine; CAS Registry No. 34157830); metformin (NSC 91485; CAS Registry No. 1115704); Brilliant green (NSC 5011 ; CAS Registry No. 633034); ME-344 (CAS Registry No. 1374524556).
  • Antimitotic Agents allocolchicine (NSC 406042); auristatins, such as MMAE (monomethyl auristatin E; CAS Registry No. 474645-27-7) and MMAF (monomethyl auristatin F; CAS Registry No. 745017-94-1 ; halichondrin B (NSC 609395); colchicine (NSC 757; CAS Registry No. 64868); cholchicine derivative (N-benzoyl-deacetyl benzamide; NSC 33410; CAS Registry No. 63989753); dolastatin 10 (NSC 376128; CAS Registry No 110417-88-4); maytansine (NSC 153858; CAS Registry No.
  • auristatins such as MMAE (monomethyl auristatin E; CAS Registry No. 474645-27-7) and MMAF (monomethyl auristatin F; CAS Registry No. 745017-94-1 ; halichondrin
  • rhozoxin NSC 332598; CAS Registry No. 90996546
  • taxol NSC 125973; CAS Registry No. 33069624
  • taxol derivative ((2'- N-[3-(dimethylamino)propyl]glutaramate taxol; NSC 608832); thiocolchicine (3- demethylthiocolchicine; NSC 361792); trityl cysteine (NSC 49842; CAS Registry No. 2799077); vinblastine sulfate (NSC 49842; CAS Registry No. 143679); vincristine sulfate (NSC 67574; CAS Registry No. 2068782).
  • any of these agents that include or that may be modified to include a site of attachment to an antibody may be included in the ADCs disclosed herein.
  • the cytotoxic and/or cytostatic agent is an antimitotic agent.
  • the cytotoxic and/or cytostatic agent is an auristatin, for example, monomethyl auristatin E (“MMAE”) or monomethyl auristatin F (“MMAF”).
  • MMAE monomethyl auristatin E
  • MMAF monomethyl auristatin F
  • the cytotoxic and/or cytostatic agents are linked to the antibody by way of linkers.
  • the linker linking a cytotoxic and/or cytostatic agent to the antibody of an ADC may be short, long, hydrophobic, hydrophilic, flexible or rigid, or may be composed of segments that each independently have one or more of the above-mentioned properties such that the linker may include segments having different properties.
  • the linkers may be polyvalent such that they covalently link more than one agent to a single site on the antibody, or monovalent such that covalently they link a single agent to a single site on the antibody.
  • the linkers link cytotoxic and/or cytostatic agents to the antibody by forming a covalent linkage to the cytotoxic and/or cytostatic agent at one location and a covalent linkage to antibody at another.
  • the covalent linkages are formed by reaction between functional groups on the linker and functional groups on the agents and antibody.
  • linker is intended to include (i) unconjugated forms of the linker that include a functional group capable of covalently linking the linker to a cytotoxic and/or cytostatic agent and a functional group capable of covalently linking the linker to an antibody; (ii) partially conjugated forms of the linker that includes a functional group capable of covalently linking the linker to an antibody and that is covalently linked to a cytotoxic and/or cytostatic agent, or vice versa; and (iii) fully conjugated forms of the linker that is covalently linked to both a cytotoxic and/or cytostatic agent and an antibody.
  • linkers and anti-glyco-LAMP1 ADCs of the disclosure as well as synthons used to conjugate linker-agents to antibodies, moieties comprising the functional groups on the linker and covalent linkages formed between the linker and antibody are specifically illustrated as R x and XY, respectively.
  • the linkers are preferably, but need not be, chemically stable to conditions outside the cell, and may be designed to cleave, immolate and/or otherwise specifically degrade inside the cell. Alternatively, linkers that are not designed to specifically cleave or degrade inside the cell may be used. Choice of stable versus unstable linker may depend upon the toxicity of the cytotoxic and/or cytostatic agent. For agents that are toxic to normal cells, stable linkers are preferred. Agents that are selective or targeted and have lower toxicity to normal cells may utilize, chemical stability of the linker to the extracellular milieu is less important.
  • a wide variety of linkers useful for linking drugs to antibodies in the context of ADCs are known in the art. Any of these linkers, as well as other linkers, may be used to link the cytotoxic and/or cytostatic agents to the antibody of the anti-glyco-LAMP1 ADCs of the disclosure.
  • Exemplary polyvalent linkers that may be used to link many cytotoxic and/or cytostatic agents to a single antibody molecule are described, for example, in WO 2009/073445; WO 2010/068795; WO 2010/138719; WO 2011/120053; WO 2011/171020; WO 2013/096901 ; WO 2014/008375; WO 2014/093379; WO 2014/093394; WO 2014/093640, the content of which are incorporated herein by reference in their entireties.
  • the Fleximer linker technology developed by Mersana et al. has the potential to enable high-DAR ADCs with good physicochemical properties.
  • the Mersana technology is based on incorporating drug molecules into a solubilizing poly-acetal backbone via a sequence of ester bonds.
  • the methodology renders highly-loaded ADCs (DAR up to 20) while maintaining good physicochemical properties.
  • the linker selected is cleavable in vivo.
  • Cleavable linkers may include chemically or enzymatically unstable or degradable linkages.
  • Cleavable linkers generally rely on processes inside the cell to liberate the drug, such as reduction in the cytoplasm, exposure to acidic conditions in the lysosome, or cleavage by specific proteases or other enzymes within the cell.
  • Cleavable linkers generally incorporate one or more chemical bonds that are either chemically or enzymatically cleavable while the remainder of the linker is noncleavable.
  • a linker comprises a chemically labile group such as hydrazone and/or disulfide groups.
  • Linkers comprising chemically labile groups exploit differential properties between the plasma and some cytoplasmic compartments.
  • the intracellular conditions to facilitate drug release for hydrazone containing linkers are the acidic environment of endosomes and lysosomes, while the disulfide containing linkers are reduced in the cytosol, which contains high thiol concentrations, e.g., glutathione.
  • the plasma stability of a linker comprising a chemically labile group may be increased by introducing steric hindrance using substituents near the chemically labile group.
  • Acid-labile groups such as hydrazone, remain intact during systemic circulation in the blood's neutral pH environment (pH 7.3-7.5) and undergo hydrolysis and release the drug once the ADC is internalized into mildly acidic endosomal (pH 5.0-6.5) and lysosomal (pH 4.5-5.0) compartments of the cell. This pH dependent release mechanism has been associated with nonspecific release of the drug.
  • the linker may be varied by chemical modification, e.g., substitution, allowing tuning to achieve more efficient release in the lysosome with a minimized loss in circulation.
  • Hydrazone-containing linkers may contain additional cleavage sites, such as additional acid-labile cleavage sites and/or enzymatically labile cleavage sites.
  • ADCs including exemplary hydrazone-containing linkers include the following structures:
  • D and Ab represent the cytotoxic and/or cytostatic agent (drug) and Ab, respectively, and n represents the number of drug-linkers linked to the antibody.
  • linker such as linker (Ig)
  • the linker comprises two cleavable groups--a disulfide and a hydrazone moiety.
  • linkers such as (Ih) and (li) have been shown to be effective with a single hydrazone cleavage site.
  • Additional linkers which remain intact during systemic circulation and undergo hydrolysis and release the drug when the ADC is internalized into acidic cellular compartments include carbonates. Such linkers can be useful in cases where the cytotoxic and/or cytostatic agent can be covalently attached through an oxygen.
  • linkers include cis-aconityl-containing linkers.
  • cis-Aconityl chemistry uses a carboxylic acid juxtaposed to an amide bond to accelerate amide hydrolysis under acidic conditions.
  • Cleavable linkers may also include a disulfide group.
  • Disulfides are thermodynamically stable at physiological pH and are designed to release the drug upon internalization inside cells, wherein the cytosol provides a significantly more reducing environment compared to the extracellular environment. Scission of disulfide bonds generally requires the presence of a cytoplasmic thiol cofactor, such as (reduced) glutathione (GSH), such that disulfide-containing linkers are reasonably stable in circulation, selectively releasing the drug in the cytosol.
  • GSH cytoplasmic thiol cofactor
  • the intracellular enzyme protein disulfide isomerase or similar enzymes capable of cleaving disulfide bonds, may also contribute to the preferential cleavage of disulfide bonds inside cells.
  • GSH is reported to be present in cells in the concentration range of 0.5-10 mM compared with a significantly lower concentration of GSH or cysteine, the most abundant low-molecular weight thiol, in circulation at approximately 5 Tumor cells, where irregular blood flow leads to a hypoxic state, result in enhanced activity of reductive enzymes and therefore even higher glutathione concentrations.
  • the in vivo stability of a disulfide-containing linker may be enhanced by chemical modification of the linker, e.g., use of steric hindrance adjacent to the disulfide bond.
  • ADCs including exemplary disulfide-containing linkers include the following structures:
  • n represents the number of drug-linkers linked to the antibody and R is independently selected at each occurrence from hydrogen or alkyl, for example.
  • R is independently selected at each occurrence from hydrogen or alkyl, for example.
  • increasing steric hindrance adjacent to the disulfide bond increases the stability of the linker.
  • Structures such as (Ij) and (II) show increased in vivo stability when one or more R groups is selected from a lower alkyl such as methyl.
  • cleavable linker Another type of cleavable linker that may be used is a linker that is specifically cleaved by an enzyme.
  • linkers are typically peptide-based or include peptidic regions that act as substrates for enzymes.
  • Peptide based linkers tend to be more stable in plasma and extracellular milieu than chemically labile linkers.
  • Peptide bonds generally have good serum stability, as lysosomal proteolytic enzymes have very low activity in blood due to endogenous inhibitors and the unfavorably high pH value of blood compared to lysosomes. Release of a drug from an antibody occurs specifically due to the action of lysosomal proteases, e.g., cathepsin and plasmin. These proteases may be present at elevated levels in certain tumor cells.
  • the cleavable peptide is selected from tetrapeptides such as Gly-Phe-Leu-Gly (SEQ ID NO:157), Ala-Leu-Ala-Leu (SEQ ID NO:158) or dipeptides such as Val-Cit, Val-Ala, Met-(D)Lys, Asn-(D)Lys, Val-(D)Asp, Phe-Lys, lle-Val, Asp-Val, His-Val, NorVal-(D)Asp, Ala-(D)Asp 5, Met-Lys, Asn-Lys, lle-Pro, Me3Lys-Pro, PhenylGly-(D)Lys, Met- (D)Lys, Asn-(D)Lys, Pro-(D)Lys, Met-(D)Lys, Asn-(D)Lys, AM Met-(D)Lys, As
  • dipeptide linkers that may be used include those found in ADCs such as Seattle Genetics' Brentuximab Vendotin SGN-35 (AdcetrisTM), Seattle Genetics SGN-75 (anti-CD-70, Val-Cit-monomethyl auristatin F(MMAF), Seattle Genetics SGN-CD33A (anti-CD-33, Val-Ala-(SGD-1882)), Celldex Therapeutics glembatumumab (CDX-011) (anti-NMB, Val-Cit-monomethyl auristatin E (MMAE), and Cytogen PSMA-ADC (PSMA-ADC-1301) (anti-PSMA, Val-Cit-MMAE).
  • ADCs such as Seattle Genetics' Brentuximab Vendotin SGN-35 (AdcetrisTM), Seattle Genetics SGN-75 (anti-CD-70, Val-Cit-monomethyl auristatin F(MMAF), Seattle Genetics SGN-CD33A (anti
  • Enzymatically cleavable linkers may include a self-immolative spacer to spatially separate the drug from the site of enzymatic cleavage.
  • the direct attachment of a drug to a peptide linker can result in proteolytic release of an amino acid adduct of the drug, thereby impairing its activity.
  • the use of a self-immolative spacer allows for the elimination of the fully active, chemically unmodified drug upon amide bond hydrolysis.
  • One self-immolative spacer is the bifunctional para-aminobenzyl alcohol group, which is linked to the peptide through the amino group, forming an amide bond, while amine containing drugs may be attached through carbamate functionalities to the benzylic hydroxyl group of the linker (PABC).
  • PABC benzylic hydroxyl group of the linker
  • the resulting prodrugs are activated upon protease-mediated cleavage, leading to a 1 ,6-elimination reaction releasing the unmodified drug, carbon dioxide, and remnants of the linker group.
  • the following scheme depicts the fragmentation of p-amidobenzyl ether and release of the drug:
  • the enzymatically cleavable linker is a p-glucuronic acid-based linker. Facile release of the drug may be realized through cleavage of the p-glucuronide glycosidic bond by the lysosomal enzyme p-glucuronidase. This enzyme is present abundantly within lysosomes and is overexpressed in some tumor types, while the enzyme activity outside cells is low.
  • p-Glucuronic acid-based linkers may be used to circumvent the tendency of an ADC to undergo aggregation due to the hydrophilic nature of p-glucuronides.
  • p-glucuronic acid-based linkers are preferred as linkers for ADCs linked to hydrophobic drugs. The following scheme depicts the release of the drug from and ADC containing a p-glucuronic acid-based linker:
  • cytotoxic and/or cytostatic agents containing a phenol group can be covalently bonded to a linker through the phenolic oxygen.
  • a linker described in WO 2007/089149, relies on a methodology in which a diamino-ethane "SpaceLink" is used in conjunction with traditional "PABO"-based self-immolative groups to deliver phenols. The cleavage of the linker is depicted schematically below, where D represents a cytotoxic and/or cytostatic agent having a phenolic hydroxyl group.
  • Cleavable linkers may include noncleavable portions or segments, and/or cleavable segments or portions may be included in an otherwise non-cleavable linker to render it cleavable.
  • polyethylene glycol (PEG) and related polymers may include cleavable groups in the polymer backbone.
  • a polyethylene glycol or polymer linker may include one or more cleavable groups such as a disulfide, a hydrazone or a dipeptide.
  • linkers include ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent.
  • Hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulting from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
  • the linker comprises an enzymatically cleavable peptide moiety, for example, a linker comprising structural formula (IVa) or (IVb): or a salt thereof, wherein: peptide represents a peptide (illustrated C ⁇ N and not showing the carboxy and amino “termini”) cleavable by a lysosomal enzyme; T represents a polymer comprising one or more ethylene glycol units or an alkylene chain, or combinations thereof; R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate; p is an integer ranging from 0 to 5; q is 0 or 1 ; x is 0 or 1 ; y is 0 or 1 ; f represents the point of attachment of the linker to a cytotoxic and/or cytostatic agent; and * represents the point of attachment to the remainder of the linker.
  • structural formula (IVa) or (IVb): or a salt thereof wherein: peptid
  • the peptide is selected from a tripeptide or a dipeptide.
  • the dipeptide is selected from: Val-Cit; Cit-Val; Ala-Ala; Ala-Cit; Cit-Ala; Asn-Cit; Cit-Asn; Cit-Cit; Val-Glu; Glu-Val; Ser-Cit; Cit-Ser; Lys-Cit; Cit-Lys; Asp-Cit; Cit-Asp; Ala- Vai; Val-Ala; Phe-Lys; Val-Lys; Ala-Lys; Phe-Cit; Leu-Cit; lle-Cit; Phe-Arg; and Trp-Cit.
  • the dipeptide is selected from: Cit-Val; and Ala-Vai.
  • linkers according to structural formula (IVa) that may be included in the anti-glyco-LAMP1 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody):
  • linkers according to structural formula (IVb) that may be included in the anti-glyco-LAMP1 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody):
  • the linker comprises an enzymatically cleavable peptide moiety, for example, a linker comprising structural formula (IVc) or (I d):
  • peptide represents a peptide (illustrated C ⁇ N and not showing the carboxy and amino “termini”) cleavable by a lysosomal enzyme
  • T represents a polymer comprising one or more ethylene glycol units or an alkylene chain, or combinations thereof
  • R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate
  • p is an integer ranging from 0 to 5
  • q is 0 or 1
  • x is 0 or 1
  • y is 0 or 1
  • .x ’ represents the point of attachment of the linker to a cytotoxic and/or cytostatic agent
  • * represents the point of attachment to the remainder of the linker.
  • linkers according to structural formula (IVc) that may be included in the anti-glyco-LAMP1 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody):
  • linkers according to structural formula (IVd) that may be included in the anti-glyco-LAMP1 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody):
  • the linker comprising structural formula (IVa), (IVb), (IVc), or (IVd) further comprises a carbonate moiety cleavable by exposure to an acidic medium.
  • the linker is attached through an oxygen to a cytotoxic and/or cytostatic agent.
  • cleavable linkers may provide certain advantages, the linkers comprising the anti-glyco-LAMP1 ADC of the disclosure need not be cleavable.
  • the release of drug does not depend on the differential properties between the plasma and some cytoplasmic compartments.
  • the release of the drug is postulated to occur after internalization of the ADC via antigen-mediated endocytosis and delivery to lysosomal compartment, where the antibody is degraded to the level of amino acids through intracellular proteolytic degradation. This process releases a drug derivative, which is formed by the drug, the linker, and the amino acid residue to which the linker was covalently attached.
  • Non-cleavable linkers may be alkylene chains, or maybe polymeric in natures, such as, for example, based upon polyalkylene glycol polymers, amide polymers, or may include segments of alkylene chains, polyalkylene glocols and/or amide polymers.
  • the linker is non-cleavable in vivo, for example a linker according to structural formula (Via), (Vlb), (Vic) or (Vid) (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody:
  • R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate
  • R x is a moiety including a functional group capable of covalently linking the linker to an antibody
  • linkers according to structural formula (Vla)-(Vld) that may be included in the anti-glyco-LAMP1 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody, and '' represents the point of attachment to a cytotoxic and/or cytostatic agent):
  • a variety of groups may be used to attach linker-drug synthons to antibodies to yield ADCs.
  • Attachment groups can be electrophilic in nature and include: maleimide groups, activated disulfides, active esters such as NHS esters and HOBt esters, haloformates, acid halides, alkyl and benzyl halides such as haloacetamides.
  • maleimide groups activated disulfides
  • active esters such as NHS esters and HOBt esters
  • haloformates acid halides
  • alkyl and benzyl halides such as haloacetamides
  • Polythenes has disclosed a method for bridging a pair of sulfhydryl groups derived from reduction of a native hinge disulfide bond. See, Badescu et al., 2014, Bioconjugate Chem.
  • the linker selected for a particular ADC may be influenced by a variety of factors, including but not limited to, the site of attachment to the antibody (e.g., lys, cys or other amino acid residues), structural constraints of the drug pharmacophore and the lipophilicity of the drug.
  • the specific linker selected for an ADC should seek to balance these different factors for the specific antibody/drug combination.
  • linkers in ADCs see Nolting, Chapter 5 “Linker Technology in Antibody-Drug Conjugates,” In: Antibody-Drug Conjugates: Methods in Molecular Biology, vol. 1045, pp. 71-100, Laurent Ducry (Ed.), Springer Science & Business Medica, LLC, 2013.
  • ADCs have been observed to effect killing of bystander antigen-negative cells present in the vicinity of the antigen-positive tumor cells.
  • the mechanism of bystander cell killing by ADCs has indicated that metabolic products formed during intracellular processing of the ADCs may play a role.
  • Neutral cytotoxic metabolites generated by metabolism of the ADCs in antigen-positive cells appear to play a role in bystander cell killing while charged metabolites may be prevented from diffusing across the membrane into the medium and therefore cannot affect bystander killing.
  • the linker is selected to attenuate the bystander killing effect caused by cellular metabolites of the ADC.
  • the linker is selected to increase the bystander killing effect.
  • the properties of the linker may also impact aggregation of the ADC under conditions of use and/or storage.
  • ADCs reported in the literature contain no more than 3-4 drug molecules per antibody molecule (see, e.g., Chari, 2008, Acc Chem Res 41 :98-107).
  • DAR drug-to-antibody ratios
  • Attempts to obtain higher drug-to-antibody ratios (“DAR”) often failed, particularly if both the drug and the linker were hydrophobic, due to aggregation of the ADC (King et al., 2002, J Med Chem 45:4336-4343; Hollander et al., 2008, Bioconjugate Chem 19:358-361 ; Burke et al., 2009 Bioconjugate Chem 20:1242-1250).
  • the linker incorporates chemical moieties that reduce aggregation of the ADCs during storage and/or use.
  • a linker may incorporate polar or hydrophilic groups such as charged groups or groups that become charged under physiological pH to reduce the aggregation of the ADCs.
  • a linker may incorporate charged groups such as salts or groups that deprotonate, e.g., carboxylates, or protonate, e.g., amines, at physiological pH.
  • the aggregation of the ADCs during storage or use is less than about 10% as determined by size-exclusion chromatography (SEC). In particular embodiments, the aggregation of the ADCs during storage or use is less than 10%, such as less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1%, less than about 0.5%, less than about 0.1%, or even lower, as determined by sizeexclusion chromatography (SEC).
  • SEC size-exclusion chromatography
  • the anti-glyco-LAMP1 ADCs of the disclosure may be synthesized using chemistries that are well-known. The chemistries selected will depend upon, among other things, the identity of the cytotoxic and/or cytostatic agent(s), the linker and the groups used to attach linker to the antibody. Generally, ADCs according to formula (I) may be prepared according to the following scheme:
  • R x and Ry represent complementary groups capable of forming a covalent linkages with one another, as discussed above.
  • R x and R y will depend upon the chemistry used to link synthon D-L- R x to the antibody. Generally, the chemistry used should not alter the integrity of the antibody, for example its ability to bind its target. Preferably, the binding properties of the conjugated antibody will closely resemble those of the unconjugated antibody.
  • a variety of chemistries and crosstechniques for conjugating molecules to biological molecules such as antibodies are known in the art and in particular to antibodies, are well-known. See, e.g., Amon et al., “Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy,” in: Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. Eds., Alan R.
  • R x and chemistries useful for linking synthons to accessible lysine residues include, by way of example and not limitation, NHS- esters and isothiocyanates.
  • a number of functional groups R x and chemistries useful for linking synthons to accessible free sulfhydryl groups of cysteine residues are known and include, by way of example and not limitationhaloacetyls and maleimides.
  • conjugation chemistries are not limited to available side chain groups.
  • Side chains such as amines may be converted to other useful groups, such as hydroxyls, by linking an appropriate small molecule to the amine.
  • This strategy can be used to increase the number of available linking sites on the antibody by conjugating multifunctional small molecules to side chains of accessible amino acid residues of the antibody.
  • Functional groups R x suitable for covalently linking the synthons to these "converted" functional groups are then included in the synthons.
  • the antibody may also be engineered to include amino acid residues for conjugation.
  • the synthons are linked to the side chains of amino acid residues of the antibody, including, for example, the primary amino group of accessible lysine residues or the sulfhydryl group of accessible cysteine residues. Free sulfhydryl groups may be obtained by reducing interchain disulfide bonds.
  • the antibody is generally first fully or partially reduced to disrupt interchain disulfide bridges between cysteine residues.
  • Cysteine residues that do not participate in disulfide bridges may engineered into an antibody by mutation of one or more codons. Reducing these unpaired cysteines yields a sulfhydryl group suitable for conjugation.
  • Preferred positions for incorporating engineered cysteines include, by way of example and not limitation, positions S112C, S113C, A114C, S115C, A176C, 5180C, S252C, V286C, V292C, S357C, A359C, S398C, S428C (Kabat numbering) on the human IgGi heavy chain and positions V110C, S114C, S121C, S127C, S168C, V205C (Kabat numbering) on the human Ig kappa light chain (see, e.g., U.S. Pat. No. 7,521 ,541 , U.S. Pat. No. 7,855,275 and U.S. Pat. No. 8,455,622).
  • the number of cytotoxic and/or cytostatic agents linked to an antibody molecule may vary, such that a collection of ADCs may be heterogeneous in nature, where some antibodies contain one linked agent, some two, some three, etc. (and some none).
  • the degree of heterogeneity will depend upon, among other things, the chemistries used for linking the cytotoxic and/or cytostatic agents. For example, where the antibodies are reduced to yield sulfhydryl groups for attachment, heterogeneous mixtures of antibodies having zero, 2, 4, 6 or 8 linked agents per molecule are often produced.
  • DAR4 can refer to an ADC preparation that has not been subjected to purification to isolate specific DAR peaks and can comprise a heterogeneous mixture of ADC molecules having different numbers of cytostatic and/or cytotoxic agents attached per antibody (e.g., 0, 2, 4, 6, 8 agents per antibody), but has an average drug-to-antibody ratio of 4.
  • DAR2 refers to a heterogeneous ADC preparation in which the average drug- to-antibody ratio is 2.
  • antibodies having defined numbers of linked cytotoxic and/or cytostatic agents may be obtained via purification of heterogeneous mixtures, for example, via column chromatography, e.g., hydrophobic interaction chromatography.
  • Purity may be assessed by a variety of methods, as is known in the art.
  • an ADC preparation may be analyzed via HPLC or other chromatography and the purity assessed by analyzing areas under the curves of the resultant peaks.
  • the present disclosure provides chimeric antigen receptors (CARs) comprising the anti- glyco-LAMP1 antibodies or antigen-binding fragments described herein.
  • the CAR comprises one or more scFvs (e.g., one or two) as described herein.
  • a CAR can comprise two scFvs covalently connected by a linker sequence (e.g., of 4-15 amino acids).
  • linkers include GGGGS (SEQ ID NO:159) and (GGGGS) 3 (SEQ ID NO:160).
  • the CARs of the disclosure typically comprise an extracellular domain operably linked to a transmembrane domain which is in turn operably linked to an intracellular domain for signaling.
  • the CARs can further comprise a signal peptide at the N-terminus of the extracellular domain (e.g., a human CD8 signal peptide).
  • a CAR of the disclosure comprises a human CD8 signal peptide comprising the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO: 161).
  • the extracellular domains of the CARs of the disclosure comprise the sequence of an anti-glyco-LAMP1 antibody or antigen-binding fragment (e.g., as described in Section 5.1 or numbered embodiments 558 to 591 .
  • transmembrane domain sequence and intracellular domain sequences are described in Section 5.3.1 and 5.3.2, respectively.
  • fusion proteins described herein are CARs, and the CAR-related disclosures apply to such fusion proteins.
  • Other fusion proteins described herein e.g., in numbered embodiments 602 to 695) are chimeric T cell receptors (TCRs), and the chimeric TCR-related disclosures apply to such fusion proteins.
  • the CAR can be designed to comprise a transmembrane domain that is operably linked (e.g., fused) to the extracellular domain of the CAR.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions of particular use in this disclosure may be derived from (/.e., comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
  • a variety of human hinges can be employed as well including the human Ig (immunoglobulin) hinge.
  • the transmembrane domain is synthetic (/.e., non-naturally occurring).
  • synthetic transmembrane domains are peptides comprising predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • a glycine-serine doublet provides a particularly suitable linker.
  • the transmembrane domain in the CAR of the disclosure is the CD8 transmembrane domain.
  • the CD8 transmembrane domain comprises the amino acid sequence YLHLGALGRDLWGPSPVTGYHPLL (SEQ ID NO:162).
  • the transmembrane domain in the CAR of the disclosure is the CD28 transmembrane domain.
  • the CD28 transmembrane domain comprises the amino acid sequence FWVLWVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:163).
  • the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a CD8a hinge domain.
  • the CD8a hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFAC (SEQ ID NO: 164).
  • the CD8a hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:165).
  • the CD8a hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:220).
  • the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a human lgG4-short hinge.
  • the human lgG4- short hinge comprises the amino acid sequence ESKYGPPCPSCP (SEQ ID NO:166).
  • the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a human lgG4-long hinge.
  • the human lgG4- long hinge comprises the amino acid sequence ESKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCWVDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFQSTYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPR EPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY
  • SRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO:167).
  • the intracellular signaling domain of the CAR of the disclosure is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
  • effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
  • intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
  • intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
  • Preferred examples of intracellular signaling domains for use in the CAR of the disclosure include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
  • TCR T cell receptor
  • T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or costimulatory signal (secondary cytoplasmic signaling sequences).
  • Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary cytoplasmic signaling sequences that are of particular use in the CARs of the disclosure include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that cytoplasmic signaling molecule in the CAR of the disclosure comprises a cytoplasmic signaling sequence from CD3-zeta.
  • the cytoplasmic domain of the CAR is designed to include an ITAM containing primary cytoplasmic signaling sequences domain (e.g., that of CD3-zeta) by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the disclosure.
  • the cytoplasmic domain of the CAR can include a CD3 zeta chain portion and a costimulatory signaling region.
  • the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
  • a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include CD27, CD28, 4-1 BB (CD137), 0X40, CD30, CD40, PD-1 , ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, DAP10, GITR, and the like.
  • the cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of the disclosure may be linked to each other in a random or specified order.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage.
  • a glycine-serine doublet provides a particularly suitable linker.
  • the cytoplasmic domain comprises the signaling domain of CD3- zeta and the signaling domain of CD28.
  • the signaling domain of CD3- zeta comprises the amino acid sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO:168).
  • the signaling domain of CD28 comrpises the amino acid acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO:169).
  • the cytoplasmic domain comprises the signaling domain of CD3-zeta and the signaling domain of 4-1 BB.
  • the cytoplasmic domain comprises the signaling domain of CD3-zeta and the signaling domain of CD2.
  • the signaling domain of CD2 comprises the amino acid sequence TKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHR PPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN (SEQ ID NQ:170).
  • the cytoplasmic domain comprises the signaling domain of CD3-zeta, the signaling domain of CD28, and the signaling domain of CD2.
  • the cytoplasmic domain comprises the signaling domain of CD3-zeta, the signaling domain of 4-1 BB, and the signaling domain of CD2.
  • Inclusion of the CD2 signaling domain in the cytoplasmic domain allows for the tuning of CAR T cell cytokine production (see US Pat. No. 9,783,591 , the contents of which are incorporated herein by reference in their entireties). As disclosed in US Pat. No.
  • inclusion of the CD2 signaling domain in the CAR cytoplasmic domain significantly alters CAR T cell cytokine production in both positive and negative directions, with the effect being dependent on the presence and identity of other costimulatory molecules in the costimulatory signaling region of the cytoplasmic domain.
  • inclusion of the CD2 signaling domain and the CD28 signaling domain in the costimulatory signaling region of the cytoplasmic domain results in the release of significantly less IL2 relative to T cells expressing a CAR with CD28 but not CD2.
  • a CAR T cell releasing less IL2 can result in reduced proliferation of immunosuppressive Treg cells.
  • inclusion of the CD2 signaling domain in the costimulatory signaling region of the cytoplasmic domain significantly reduces calcium influx in the CAR T cell. This has been shown to reduce activation-induced CAR T cell death.
  • the present disclosure provides chimeric T cell receptors (TCRs) comprising the anti- glyco-LAMP1 antibodies or antigen-binding fragments described herein.
  • TCRs T cell receptors
  • the chimeric TCRs provide an anti-glyco-LAMP1 specific antibody and TCR chimera that specifically binds to anti- glyco-LAMP1 , and are capable of recruiting at least one TCR-associated signaling molecule (e.g., CD3yE, CD36E, and ⁇ ).
  • the chimeric TCR comprises one or more antigen-binding fragments capable of binding glyco-LAMP1.
  • an antigen-binding fragment of a chimeric T cell receptor comprises at least one anti-glyco-LAMP1 variable heavy chain and at least one anti-glyco-LAMP1 variable light chain as described herein.
  • TCRs occur as either an a
  • the four chains (a, p, y, 6) each have a characteristic extracellular structure consisting of a highly polymorphic “immunoglobulin variable region”-like N-terminal domain and an “immunoglobulin constant region”-like second domain. Each of these domains has a characteristic intra-domain disulfide bridge.
  • the constant region is proximal to the cell membrane, followed by a connecting peptide, a transmembrane region and a short cytoplasmic tail.
  • the covalent linkage between the 2 chains of the heterodimeric TCR is formed by the cysteine residue located within the short connecting peptide sequence bridging the extracellular constant domain and the transmembrane region which forms a disulfide bond with the paired TCR chain cysteine residue at the corresponding position (Lefranc and Lefranc, “The T Cell Receptor FactsBook,” Academic Press, 2001).
  • cysteine residue located within the short connecting peptide sequence bridging the extracellular constant domain and the transmembrane region which forms a disulfide bond with the paired TCR chain cysteine residue at the corresponding position.
  • a chimeric TOR generally comprises a first polypeptide chain comprising a first TOR domain, a second polypeptide chain comprising a second TOR domain, and an anti-glyco- LAMP1 antigen binding fragment described herein.
  • the chimeric TOR comprises a single anti-glyco-LAMP1 antigen binding fragment.
  • the chimeric TOR comprises a two or more anti-glyco-LAMP1 antigen binding fragments.
  • the chimeric TCR comprises two anti-glyco-LAMP1 antigen binding fragments.
  • the anti-glyco-LAMP1 antigen binding fragment is an scFv described herein.
  • a single anti-glyco-LAMP1 scFv can be included in either the first polypeptide chain or the second polypeptide chain of the chimeric TCR.
  • two anti-glyco-LAMP1 scFVs can be included in either the first polypeptide chain or the second polypeptide chain of the chimeric TCR, or a first scFv can be included in the first polypeptide chain and a second scFv can be included in the second polypeptide chain.
  • the two scFvs can be linked via a peptide linker.
  • the chimeric TCR comprises two or more anti-glyco-LAMP1 scFvs having the same amino acid sequence. In other embodiments, the chimeric TCR comprises two or more anti-glyco-LAMP1 scFvs having different amino acid sequences.
  • the anti-glyco-LAMP1 antigen binding fragment is an Fv fragment.
  • an anti-glyco-LAMP1 variable heavy chain (VH) described herein is included in one of the two polypeptide chains that associate to form the chimeric TCR.
  • An anti-glyco-LAMP1 variable light chain (VL) described herein can be included in the polypeptide chain that does not include the anti-glyco-LAMP1 VH.
  • VH variable heavy chain
  • VL variable light chain
  • the anti-glyco-LAMP1 VH and VL are brought together to form an anti-glyco-LAMP1 Fv fragment.
  • the VH is included in the first polypeptide chain and the VL is included in the second polypeptide chain.
  • the VH is included in the second polypeptide chain and the VL is included in the first polypeptide chain.
  • the anti-glyco-LAMP1 antigen fragment is a Fab- domain, comprising VH, VL, CH1 , and CL domains.
  • an anti-glyco-LAMP1 variable heavy chain (VH) described herein and a CH1 domain is included in the first or second polypeptide chain.
  • an anti-glyco-LAMP1 variable light chain (VL) described herein and a CL domain are included in the first or second polypeptide chain that does not include the anti-glyco-LAMP1 VH and CH1 .
  • an anti-glyco- LAMP1 variable heavy chain (VH) and a CL domain is included in the first or second polypeptide chain.
  • an anti-glyco-LAMP1 variable light chain (VL) and a CH1 domain are included in the polypeptide chain that does not include the anti-glyco-LAMP1 VH and CL.
  • VL variable light chain
  • the anti-glyco-LAMP1 VH and VL, and the CH1 and CL are brought together to form an anti-glyco-LAMP1 Fab domain.
  • the VH and the CH1 or CL is included in the first polypeptide chain, and the VL and the CL or CH1 is included in the second polypeptide chain.
  • the VH and the CH1 or CL is included in the second polypeptide chain, and the VL and the CH1 or CL is included in the first polypeptide chain.
  • the anti-glyco-LAMP1 VH and CH1 or CL are included in the first polypeptide chain of the second polypeptide chain, and the chimeric TCR further comprises a third polypeptide comprising the VL and either a CL domain or a CH1 domain.
  • the third polypeptide is capable of associating with the VH and CH1 or CL of the first or second polypeptide chain, thus forming a Fab domain.
  • both the first and second polypeptide chains include a VH and a CH1 domain or a CL domain.
  • both the first and second polypeptide chains include a VH and a CH1 or CL
  • a third polypeptide comprising a VL and a CL or CH1 associates with the first polypeptide chain to form a first Fab domain
  • a fourth polypeptide comprising a VL and a CL or CH1 associates with the second polypeptide chain to form a second Fab domain.
  • First and second TCR domains are included in the first and second polypeptide chains, respectively, with the first TCR domain comprising a first TCR transmembrane domain from a first TCR subunit and the second TCR domain comprising a second TCR transmembrane domain from a second TCR subunit.
  • the first TCR subunit is a TCR a chain and the second TCR subunit is a TCR p chain.
  • the first TCR subunit is a TCR p chain and the second TCR subunit is a TCR a chain.
  • the first TCR subunit is a TCR y chain and the second TCR subunit is a TCR 5 chain.
  • the first TCR subunit is a TCR 5 chain and the second TCR subunit is a TCR y chain.
  • a TCR transmembrane domain from a TCR subunit can be a native TCR transmembrane domain, a natural or engineered variant thereof, or a fragment of the native or variant TCR transmembrane domain.
  • the first and/or second TCR transmembrane domains comprise, individually, an amino acid sequence of a TCR transmembrane domain contained in one of SEQ ID NOS:77-80 of WO 2017/070608, which is incorporated by reference in its entirety.
  • the first and/or second TCR transmembrane domains comprise, individually, an amino acid sequence of SEQ ID NOS:1-4 of WO 2017/070608.
  • the first and second TCR domains also include first and second connecting peptides, respectively.
  • the first and second connecting peptides are positioned at the N-terminus of the first and second TCR transmembrane domains, respectively.
  • the first connecting peptide comprises all or a portion of the connecting peptide of the first TCR subunit and/or the second connecting peptide comprises all or a portion of the connecting peptide of the second TCR subunit.
  • the first transmembrane domain and the first connecting peptide are derived from different TCR subunits and/or the second transmembrane domain and the second connecting peptide are derived from different TCR subunits.
  • a connecting peptide from a TCR subunit can be a native TCR connecting peptide, a natural or engineered variant thereof, or a fragment of the native or variant TCR connecting peptide.
  • the first and/or second connecting peptides comprise, individually, an amino acid sequence of a connecting peptide contained in one of SEQ ID NOS:77-80 of WO 2017/070608.
  • the first and/or second connecting peptides comprise, individually, an amino acid sequence of SEQ ID NOS:5-12 of WO 2017/070608.
  • the first and second TCR domains comprise a first and second TCR constant domain, respectively.
  • the first and second TCR constant domains are positioned at the C-terminus of the first and second TCR transmembrane domains, respectively. If the first and/or second TCR domains include a TCR connecting peptide, the TCR constant domain can be positioned at the C-terminus of the TCR connecting peptide.
  • the first TCR constant domain comprises all or a portion of the constant domain of the first TCR subunit and/or the second TCR constant domain comprises all or a portion of the constant domain of the second TCR subunit.
  • the first and/or second TCR constant domains are derived from TCR a and p subunit constant domains, or TCR y and 5 subunit constant domains.
  • a TCR constant domain from a TCR subunit can be a native TCR intra constant cellular domain, a natural or engineered variant thereof, or a fragment of the native or variant TCR constant domain.
  • the first and/or second TCR constant domain comprise, individually an amino acid sequence of SEQ ID NOS:172, 174, 176, 178, 180, or 182, or the wildtype equivalent thereof.
  • the first and second TCR domains comprise first and second TCR intracellular domains, respectively.
  • the first and second TCR intracellular domains are positioned at the C-terminus of the first and second TCR transmembrane domains, respectively.
  • the first TCR intracellular domain comprises all or a portion of the intracellular domain of the first TCR subunit and/or the second TCR intracellular domain comprises all or a portion of the intracellular domain of the second TCR subunit.
  • a TCR intracellular domain from a TCR subunit can be a native TCR intracellular domain, a natural or engineered variant thereof, or a fragment of the native or variant TCR intracellular domain.
  • the first and/or second TCR intracellular domains comprise, individually, an amino acid sequence of a TCR intracellular domain contained in one of SEQ ID NOS:77-80 of WO 2017/070608. In other embodiments, the first and/or second TCR intracellular domain comprise, individually, an amino acid sequence of SEQ ID NOS: 13-14 of WO 2017/070608.
  • the first polypeptide chain of the chimeric TCR further comprises a first accessory intracellular domain C-terminal to the first TCR transmembrane domain and/or the second polypeptide chain of the chimeric TCR further comprises a second accessory intracellular domain C-terminal to the second transmembrane domain.
  • the first and/or second accessory intracellular domains comprise a TCR costimulatory domain.
  • the TCR costimulatory domain comprises all or a portion of the amino acid sequence of SEQ ID NO: 70 or 71 of WO 2017/070608.
  • the first TCR domain is a fragment of the first TCR subunit and/or the second TCR subunit is a fragment of the second TCR subunit.
  • first and second polypeptide chains that form the chimeric TCR are linked.
  • the first and second polypeptide chains that form the chimeric TCR are linked by a disulfide bond.
  • first and second polypeptide chains that form the chimeric TCR are linked by a disulfide bond between a residue in the first connecting peptide and a residue in the second connecting peptide.
  • the first and second polypeptide chains are linked or otherwise associate.
  • the associated first and second polypeptide chains are capable of recruiting at least one TCR-associated signaling modules, such as, e.g., CD35E, CD3yE, and ⁇ .
  • the associated first and second polypeptide chains are capable of recruiting each of CD35E, forming a TCR-CD3 complex.
  • the first polypeptide chain comprises a first linker between the first TCR domain and an anti-glyco-LAMP1 VH or VL of the scFv, Fv, or Fab fragment included in the first polypeptide chain.
  • the second polypeptide chain comprises a second linker between the second TCR domain and an anti-glyco-LAMP1 VH or VL of the scFv, Fv, or Fab fragment included in the second polypeptide chain.
  • the first peptide linker and/or the second peptide linker comprises between about 5 to about 70 amino acids.
  • the first and/or second linker comprises a constant domain or fragment thereof from an immunoglobulin or T cell receptor subunit.
  • the first and/or second linker comprises an immunoglobulin constant domain or fragment thereof.
  • the CH1 or CL domain functions as a linker between the TCR domain and the anti-glyco-LAMP1 binding fragment, or a subpart (e.g., VH or VL) thereof.
  • the immunoglobulin constant domain can also be, in addition to CH1 or CL, a CH2, CH3, or CH4 domain or fragment thereof.
  • the immunoglobulin constant domains can be derived from an IgG (e.g., IgG 1 , lgG2, lgG3, or lgG4), IgA (e.g., lgA1 or lgA2), IgD, IgM, or IgE heavy chain.
  • IgG e.g., IgG 1 , lgG2, lgG3, or lgG4
  • IgA e.g., lgA1 or lgA2
  • IgD IgM
  • IgE heavy chain e.gE heavy chain.
  • a TCR constant domain or fragment thereof described above functions as a linker between the TCR domain and the anti- glyco-LAMP1 binding fragment, or a subpart (e.g., VH or VL) thereof.
  • the first and second linkers are capable of binding to one another.
  • the first and second polypeptide chains are connected, at least temporarily, by a cleavable peptide linker.
  • the cleavable peptide linker is a furin-p2A cleavable peptide.
  • the cleavable peptide linker can facilitate expression of the two polypeptide chains.
  • the cleavable peptide linker can be configured to temporarily associate the first polypeptide chain with the second polypeptide chain during and/or shortly after protein translation.
  • the chimeric TCR is a synthetic T cell receptor and antigen receptor (STAR), as described in Liu et al., 2021 , Sci Transl Med, and WO 2020/029774, the contents of each of which are incorporated herein by reference in their entireties.
  • STAR T cell receptor and antigen receptor
  • the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco- LAMP1 variable heavy chain and a TCRa chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco- LAMP1 variable light chain and a TCR
  • the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco- LAMP1 variable heavy chain and a TCR
  • the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco- LAMP1 variable light chain and a TCRa chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco- LAMP1 variable heavy chain and a TCR
  • the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco- LAMP1 variable light chain and a TCR
  • 3 chain constant region domain of any one of configurations STAR 1 through STAR 4 can be replaced by TCRy and TCRb constant region domains, respectively.
  • the chimeric TCRs of the present disclosure can form complexes with TCR-associated signaling molecules (e.g., CD3y£, CD36s, and ⁇ ) endogenously expressed in T cells. These complexes provide for TCR signaling controlled by binding of the anti-glyco- LAMP1 heavy and light variable chains by its target.
  • the chimeric TCR can be designed to comprise constant regions that are derived from, e.g., human peripheral blood T cells.
  • Nucleotide and corresponding amino acid sequences for TCR constant regions for use in chimeric TCRs according to the disclosure are provided in Table 5.
  • the TCR constant domain of the chimeric TCR can be modified to provide for additional bonds between two TCR constant domains of the chimeric TCR.
  • the residue corresponding to position 48 of the wildtype human TCRa constant domain is mutated to cysteine and the residue corresponding to position 57 of the wildtype human TCRp constant domain is mutated to cysteine, as shown in Table 5. This results in the formation of a disulfide linkage between TCRa and TCRp constant domains, resulting in a disulfide bond between the first and second polypeptide chains of the chimeric TCR.
  • the residue corresponding to position 85 of the wildtype human TCRa constant domain is mutated to alanine and the residue corresponding to position 88 of the wildtype human TCR
  • the two polypeptide chains of the chimeric TCRs of the disclosure are linked via a cleavable peptide linker.
  • the two polypeptide chains of the chimeric TCR are linked via a furin-P2A peptide linker, which provides a protease cleavage site between the two polypeptide chains.
  • the two polypeptide chains can thus be transcribed and translated into a fusion protein, which is subsequently cleaved by a protease into to distinct protein subunits.
  • the two resulting protein subunits are covalently bound through disulfide bonds, and subsequently form a complex with the endogenous CD3 subunits of T cells.
  • the furin-P2A peptide linker comprises the sequence RAKRSGSGATNFSLLKQAGDVEENPGP (SEQ ID NO:183).
  • the furin-P2A peptide linker comprises the sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO:184).
  • Sialic acids are terminal sugars of glycans on either glycoproteins or glycolipids on the cell surface, and have been shown to be aberrantly expressed during tumor transformation and malignant progression. Hypersialylation frequently occurs in tumor tissues due to aberrant expression of sialytransferases/sialidases. This can result in accelerated cancer progression. Sialylation facilitates immune escape, enhances tumor proliferation and metastasis, helps tumor angiogenesis, and assists in resisting apoptosis and cancer therapy.
  • Host cells e.g., T cells, NK cells
  • a CAR of the disclosure can be engineered to coexpress a cell surface or secreted neuraminidase (sialidase) along with the CAR.
  • the cell surface neuraminidase anchored to the cell surface via a heterologous transmembrane, gives the host cell glycoediting activity. This enhances cytotoxic effects and anti-tumor efficacy of the CAR-T cell and immune cells such as innate NK cells and monocytes.
  • Host cells coexpressing a CAR and an engineered neuraminidase are described in PCT Publication No WQ2020/236964, which is incorporated herein by reference in its entirety.
  • a neuraminidase can be coexpressed in a host cell along with a CAR described herein. Exemplary host cells coexpressing a neuraminidase and a CAR are described in the specific embodiments.
  • the neuraminidase can be included as a domain of a fusion protein described herein.
  • the neuraminidase is EC 3.2.1.18 or EC 3.2.1.129.
  • the neuraminidase is derived from Micromonospora viridifaciens.
  • the neuraminidase comprises an amino acid sequence having at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to:
  • the neuraminidase can be retained at a surface of a host cell engineered to express the neuraminidase, or can be secreted by a host cell engineered to express the neuraminidase.
  • the hose cell engineered to express the neuraminidase can include, for example, a vector encoding the neuraminidase.
  • mice comprising the anti-glyco-LAMP1 antibodies and antigen-binding fragments of the disclosure.
  • MicAbodies are fusion proteins comprising an antibody or antigen-binding fragment and an engineererd MHC-class l-chain- related (MIC) protein domain.
  • MIC proteins are the natural ligands of human NKG2D receptors expressed on the surface of NK cells, and the a1-a2 domain of MIC proteins provides the binding site for the NKG2D receptor.
  • an engineered MIC protein domain e.g.
  • an engineered a1-a2 domain) to a cancer-targeting antibody or antigen-binding fragment T-cells expressing an engineered NKG2D receptor capable of binding the engineered MIC protein domain can be targeted to cancer cells.
  • Engineered MIC protein domains that can be included in MicAbodies of the disclosure, and NKG2D receptors capable of binding the engineered MIC protein domains, CARs and CAR T cells comprising the NKG2D receptors are described in U.S. publication nos. US 2011/0183893, US2011/0311561 , US 2015/0165065, and US 2016/0304578 and PCT publication nos. WO 2016/090278, WO 2017/024131 , WO 2017/222556, and WO 2019/191243, the contents of which are incorporated herein by reference in their entireties.
  • the MicAbodies of the disclosure comprise a1-a2 domains which are at least 80% identical or homologous to the a1-a2 domain of an NKG2D ligand (e.g., MICA, MICB, ULBP1 , ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP).
  • NKG2D ligand e.g., MICA, MICB, ULBP1 , ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP.
  • Exemplary amino acid sequences of MICA, MICB, ULBP1 , ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and OMCP are set forth as SEQ ID NOS: 1-9 of WO 2019/191243, respectively, the sequences of which are incorporated herein by reference.
  • the a1-a2 domain is 85% identical to a native or natural a1-a2 domain of an NKG2D ligand. In yet other embodiments, the a1-a2 domain is 90% identical to a native or natural a1-a2 domain of a natural NKG2D ligand protein and binds non-natural NKG2D.
  • the MicAbodies of the disclosure comprise a1-a2 domains which are at least 80% identical or homologous to a native or natural a1-a2 domain of a human MICA or MICB protein and bind NKG2D.
  • the a1-a2 domain is 85% identical to a native or natural a1-a2 domain of a human MICA or MICB protein and binds NKG2D.
  • the a1-a2 domain is 90%, 95%, 96%, 97%, 98%, or 99% identical to a native or natural a1-a2 platform domain of a human MICA or MICB protein and binds NKG2D.
  • specific mutations in a1-a2 domains of NKG2D ligands can be made to create non-natural a1-a2 domains that bind non-natural NKG2D receptors, themselves engineered so as to have reduced affinity for natural NKG2D ligands. This can be done, for example, through genetic engineering.
  • a non-natural NKG2D receptor so modified can be used to create on the surface of NK- or T-cells of the immune system an NKG2D-based CAR that can preferentially bind to and be activated by molecules comprised of the non-natural a1-a2 domains.
  • Non-natural NKG2D receptors and their cognate non-natural NKG2D ligands can provide important safety, efficacy, and manufacturing advantages for treating cancer and viral infections as compared to traditional CAR-T cells and CAR-NK cells.
  • Activation of CAR-T cells and CAR-NK cells having a NKG2D-based CAR can be controlled by administration of a MicAbody.
  • the dosing regimen of the MicAbody can be modified rather than having to deploy an induced suicide mechanism to destroy the infused CAR cells.
  • MicAbodies can be generated by attaching an antibody or antigen-binding fragment to an engineered a1-a2 domain via a linker, e.g., APTSSSGGGGS (SEQ ID NO:185), GGGS (SEQ ID NO:186), or GGGGS (SEQ ID NO:159).
  • a linker e.g., APTSSSGGGGS (SEQ ID NO:185), GGGS (SEQ ID NO:186), or GGGGS (SEQ ID NO:159).
  • an a1-a2 domain can be fused to the C-terminus of an IgG heavy chain or light chain, for example, as described in WO 2019/191243.
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWD RETRDLTGWGTTLLMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLET LEWTMPQSSRAQTLAMNVRNFLKEDAMETDIGYRLMRADCLSELRRYLKSGWLRRTV (SEQ ID NO:187) (MICA25.17).
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWD RETRDLTGWGTFLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLET LEWTMPQSSRAQTLAMNVRNFLKEDAMETDRSGLLMRADCLSELRRYLKSGWLRRTV (SEQ ID NO:215) (MICA25.18).
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence AAEPHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAW
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence AAEPHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAW
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREWDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKWATILWQTSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:193) (ULBP2.C).
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREWDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKWATLLWGWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:194) (ULBP2.R).
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREWDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKWATMFWSWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO: 195) (ULBP2.AA).
  • the MicAbodies of the disclosure comprise an engineered a1-a2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREWDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKWATLMWQWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO: 196) (ULBP2.AB).
  • An exemplary engineered NKG2D receptor comprises the amino acid sequence NSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKE DQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCST PNTYICMQRTV (SEQ ID NO:197) in which the tyrosine at position 73 has been replaced with another amino acid, for example alanine.
  • Another exemplary engineered NKG2D receptor comprises the amino acid sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYS KEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENC STPNTYICMQRTV (SEQ ID NO:198) in which the tyrosines are positions 75 and 122 have been replaced with another amino acid, for example alanine at position 75 and phenylalanine at position 122.
  • the present disclosure encompasses nucleic acid molecules encoding immunoglobulin light and heavy chain genes for anti-glyco-LAMP1 antibodies, vectors comprising such nucleic acids, and host cells capable of producing the anti-glyco-LAMP1 antibodies of the disclosure.
  • the nucleic acid molecules encode, and the host cells are capable of expressing, the anti-glyco-LAMP1 antibodies and antibody-binding fragments of the disclosure (e.g., as described in Section 5.1 and numbered embodiments 1 to 526) as well as fusion proteins (e.g., as described in numbered embodiments 533 to 557), and chimeric antigen receptors (e.g., as described in Section 5.3 and numbered embodiments 558 to 591) and chimeric T cell receptors (e.g., as described in Section 5.4 and numbered embodiments 602 to 695) containing them.
  • Exemplary vectors of the disclosure are described in numbered embodiments 698 to 700 and exemplary host cells are described in numbered embodiments 701 to 707.
  • An anti-glyco-LAMP1 antibody of the disclosure can be prepared by recombinant expression of immunoglobulin light and heavy chain genes in a host cell.
  • a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the immunoglobulin light and heavy chains of the antibody such that the light and heavy chains are expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the antibodies can be recovered.
  • Standard recombinant DNA methodologies are used to obtain antibody heavy and light chain genes, incorporate these genes into recombinant expression vectors and introduce the vectors into host cells, such as those described in Molecular Cloning; A Laboratory Manual, Second Edition (Sambrook, Fritsch and Maniatis (eds), Cold Spring Harbor, N. Y., 1989), Current Protocols in Molecular Biology (Ausubel, F. M. et al., eds., Greene Publishing Associates, 1989) and in U.S. Pat. No. 4,816,397.
  • DNA fragments encoding the light and heavy chain variable regions are first obtained. These DNAs can be obtained by amplification and modification of germline DNA or cDNA encoding light and heavy chain variable sequences, for example using the polymerase chain reaction (PCR).
  • PCR polymerase chain reaction
  • Germline DNA sequences for human heavy and light chain variable region genes are known in the art (see, e.g., the “VBASE” human germline sequence database; see also Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson et al., 1992, J. Mol. Biol. 22T:116- 198; and Cox et al., 1994, Eur. J. Immunol. 24:827-836; the contents of each of which are incorporated herein by reference).
  • DNA fragments encoding anti-glyco-LAMP1 antibody-related V H and V segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene.
  • a V H - or V -encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker.
  • the term “operatively linked,” as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
  • the isolated DNA encoding the V H region can be converted to a full-length heavy chain gene by operatively linking the V H -encoding DNA to another DNA molecule encoding heavy chain constant regions (CHi, CH 2 , CH 3 and, optionally, CH 4 ).
  • heavy chain constant regions CHi, CH 2 , CH 3 and, optionally, CH 4 .
  • the sequences of human heavy chain constant region genes are known in the art (see, e.g., Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
  • the heavy chain constant region can be an IgGi, lgG 2 , lgG 3 , lgG 4 , IgA, IgE, IgM or IgD constant region, but in certain embodiments is an IgGi or lgG 4 constant region.
  • the V H -encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.
  • the isolated DNA encoding the V L region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the V -encoding DNA to another DNA molecule encoding the light chain constant region, CL.
  • the sequences of human light chain constant region genes are known in the art (see, e.g., Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
  • the light chain constant region can be a kappa or lambda constant region, but in certain embodiments is a kappa constant region.
  • the V H - and V -encoding DNA fragments can be operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly 4 ⁇ Ser) 3 , such that the V H and V sequences can be expressed as a contiguous singlechain protein, with the V H and V regions joined by the flexible linker (see, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552-554).
  • a flexible linker e.g., encoding the amino acid sequence (Gly 4 ⁇ Ser) 3
  • DNAs encoding partial or full-length light and heavy chains, obtained as described above, are inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences.
  • operatively linked is intended to mean that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody gene.
  • the expression vector and expression control sequences are chosen to be compatible with the expression host cell used.
  • the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vectors or, more typically, both genes are inserted into the same expression vector.
  • the antibody genes are inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
  • the expression vector Prior to insertion of the anti-glyco-LAMP1 antibody-related light or heavy chain sequences, the expression vector can already carry antibody constant region sequences.
  • one approach to converting the anti-glyco- LAMP1 monoclonal antibody-related V H and V sequences to full-length antibody genes is to insert them into expression vectors already encoding heavy chain constant and light chain constant regions, respectively, such that the V H segment is operatively linked to the CH segment(s) within the vector and the V segment is operatively linked to the CL segment within the vector.
  • the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
  • the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
  • the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (/.e., a signal peptide from a non-immunoglobulin protein).
  • the recombinant expression vectors of the disclosure carry regulatory sequences that control the expression of the antibody chain genes in a host cell.
  • the term “regulatory sequence” is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
  • Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif., 1990. It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • Suitable regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)) and polyoma.
  • CMV cytomegalovirus
  • SV40 Simian Virus 40
  • AdMLP adenovirus major late promoter
  • the recombinant expression vectors of the disclosure can carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017, all by Axel et al.).
  • the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • Suitable selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in DHFR- host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • neo gene for G418 selection.
  • the expression vector(s) encoding the heavy and light chains is transfected into a host cell by standard techniques.
  • the various forms of the term “transfection” are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, lipofection, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
  • eukaryotic cells e.g., mammalian host cells
  • expression of antibodies is performed in eukaryotic cells, e.g., mammalian host cells, of optimal secretion of a properly folded and immunologically active antibody.
  • eukaryotic cells e.g., mammalian host cells
  • Exemplary mammalian host cells for expressing the recombinant antibodies of the disclosure include Chinese Hamster Ovary (CHO cells) (including DHFR' CHO cells, described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216- 4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol.
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods. Host cells can also be used to produce portions of intact antibodies, such as Fab fragments or scFv molecules. It is understood that variations on the above procedure are within the scope of the present disclosure. For example, it can be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of an anti-glyco-LAMP1 antibody of this disclosure.
  • the host cell is a T cell, preferably a human T cell.
  • the host cell exhibits an anti-tumor immunity when the cell is cross-linked with LAMP1 on a tumor cell.
  • Detailed methods for producing the T cells of the disclosure are described in Section 5.7.1.
  • the host cell is a T cell, preferably a human T cell.
  • the host cell exhibits an anti-tumor immunity when the cell is cross-linked with glyco-LAMP1 on a tumor cell.
  • Detailed methods for producing the T cells of the disclosure are described in Section 5.7.1.
  • Recombinant DNA technology can also be used to remove some or all of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to glyco- LAMP1.
  • the molecules expressed from such truncated DNA molecules are also encompassed by the antibodies of the disclosure.
  • the host cell can be co-transfected with two expression vectors of the disclosure, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
  • the two vectors can contain identical selectable markers, or they can each contain a separate selectable marker.
  • a single vector can be used which encodes both heavy and light chain polypeptides.
  • nucleic acid encoding one or more portions of an anti-glyco-LAMP1 antibody further alterations or mutations can be introduced into the coding sequence, for example to generate nucleic acids encoding antibodies with different CDR sequences, antibodies with reduced affinity to the Fc receptor, or antibodies of different subclasses.
  • the anti-glyco-LAMP1 antibodies of the disclosure can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984 The Pierce Chemical Co., Rockford, III.). Variant antibodies can also be generated using a cell-free platform (see, e.g., Chu et al., Biochemia No. 2, 2001 (Roche Molecular Biologicals) and Murray et al., 2013, Current Opinion in Chemical Biology, 17:420-426).
  • an anti-glyco-LAMP1 antibody of the disclosure can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • chromatography e.g., ion exchange, affinity, and sizing column chromatography
  • centrifugation e.g., centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the anti-glyco-LAMP1 antibodies of the present disclosure and/or binding fragments can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
  • the anti-glyco-LAMP1 antibody can, if desired, be further purified, e.g., by high performance liquid chromatography (see, e.g., Fisher, Laboratory Techniques In Biochemistry And Molecular Biology, Work and Burdon, eds., Elsevier, 1980), or by gel filtration chromatography on a SuperdexTM 75 column (Pharmacia Biotech AB, Uppsala, Sweden).
  • nucleic acids encoding the anti-glyco-LAMP1 CARs or chimeric TCRs of the disclosure are delivered into cells using a retroviral or lentiviral vector.
  • CAR- or chimeric TCR-expressing retroviral and lentiviral vectors can be delivered into different types of eukaryotic cells as well as into tissues and whole organisms using transduced cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked vectors.
  • the method used can be for any purpose where stable expression is required or sufficient.
  • the CAR or chimeric TCR sequences are delivered into cells using in vitro transcribed mRNA.
  • In vitro transcribed mRNA CAR or chimeric TCR can be delivered into different types of eukaryotic cells as well as into tissues and whole organisms using transfected cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked mRNA.
  • the method used can be for any purpose where transient expression is required or sufficient.
  • the desired CAR or chimeric TCR can be expressed in the cells by way of transponsons.
  • RNA transfection is essentially transient and a vector-free: an RNA transgene can be delivered to a lymphocyte and expressed therein following a brief in vitro cell activation, as a minimal expressing cassette without the need for any additional viral sequences. Under these conditions, integration of the transgene into the host cell genome is unlikely. Cloning of cells is not necessary because of the efficiency of transfection of the RNA and its ability to uniformly modify the entire lymphocyte population.
  • IVVT-RNA Genetic modification of T cells with in v/Yro-transcribed RNA makes use of two different strategies both of which have been successively tested in various animal models.
  • Cells are transfected with in v/Yro-transcribed RNA by means of lipofection or electroporation.
  • IVT vectors are known in the literature which are utilized in a standardized manner as template for in vitro transcription and which have been genetically modified in such a way that stabilized RNA transcripts are produced.
  • protocols used in the art are based on a plasmid vector with the following structure: a 5' RNA polymerase promoter enabling RNA transcription, followed by a gene of interest which is flanked either 3' and/or 5' by untranslated regions (UTR), and a 3' polyadenyl cassette containing 50-70 A nucleotides.
  • UTR untranslated regions
  • the circular plasmid Prior to in vitro transcription, the circular plasmid is linearized downstream of the polyadenyl cassette by type II restriction enzymes (recognition sequence corresponds to cleavage site).
  • RNA has several advantages over more traditional plasmid or viral approaches. Gene expression from an RNA source does not require transcription and the protein product is produced rapidly after the transfection. Further, since the RNA has to only gain access to the cytoplasm, rather than the nucleus, and therefore typical transfection methods result in an extremely high rate of transfection. In addition, plasmid-based approaches require that the promoter driving the expression of the gene of interest be active in the cells under study.
  • the RNA construct can be delivered into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004/0014645, US 2005/0052630A1 , US 2005/0070841 A1 , US 2004/0059285A1 , US 2004/0092907A1 .
  • the various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No. 6,678,556, U.S. Pat. No. 7,171 ,264, and U.S. Pat. No.
  • Apparatus for therapeutic application of electroporation are available commercially, e.g., the MedPulserTM DNA Electroporation Therapy System (Inovio/Genetronics, San Diego, Calif.), and are described in patents such as U.S. Pat. No. 6,567,694; U.S. Pat. No. 6,516,223, U.S. Pat. No. 5,993,434, U.S. Pat. No. 6,181 ,964, U.S. Pat. No. 6,241 ,701 , and U.S. Pat. No. 6,233,482; electroporation may also be used for transfection of cells in vitro as described e.g. in US20070128708A1.
  • Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly, electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art presents an exciting new means for delivering an RNA of interest to a target cell.
  • a source of T cells is obtained from a subject.
  • the term “subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. Preferably, subjects are human.
  • T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present disclosure, any number of T cell lines available in the art, may be used. In certain embodiments of the present disclosure, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis.
  • the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
  • the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Again, surprisingly, initial activation steps in the absence of calcium lead to magnified activation.
  • a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
  • a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
  • the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
  • the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
  • T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
  • a specific subpopulation of T cells such as CD3 + , CD28', CD4 + , CD8 + , CD45RA + and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
  • T cells are isolated by incubation with anti-CD3/anti-CD28 (/.e., 3 x 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
  • the time period is about 30 minutes.
  • the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
  • the time period is at least 1 , 2, 3, 4, 5, or 6 hours.
  • the time period is 10 to 24 hours.
  • the incubation time period is 24 hours.
  • TIL tumor infiltrating lymphocytes
  • subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
  • multiple rounds of selection can also be used in the context of this disclosure.
  • Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
  • One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11 b, CD16, HLA- DR, and CD8.
  • it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4 + , CD25 + , CD62L hi , GITR + , and FoxP3 + .
  • T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.
  • the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (/.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
  • concentrations can result in increased cell yield, cell activation, and cell expansion.
  • use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (/.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
  • the cells may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells are minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles. For example, CD4 + T cells express higher levels of CD28 and are more efficiently captured than CD8 + T cells in dilute concentrations.
  • the concentration of cells used is 5 x 10 6 /ml. In other embodiments, the concentration used can be from about 1 x 10 5 /ml to 1 x 10 6 /ml, and any integer value in between.
  • the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.
  • T cells for stimulation can also be frozen after a washing step.
  • the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
  • the cells may be suspended in a freezing solution.
  • one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCI, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80° C. at a rate of 1 ° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at -20° C. or in liquid nitrogen.
  • cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present disclosure.
  • a blood sample or an apheresis product is taken from a generally healthy subject.
  • a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
  • the T cells may be expanded, frozen, and used at a later time.
  • samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
  • the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
  • agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
  • the cells are isolated for a patient and frozen for later use in conjunction with (e.g., before, simultaneously or following) bone marrow or stem cell transplantation or T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide.
  • chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide.
  • T cells are obtained from a patient directly following treatment.
  • the quality of T cells obtained may be optimal or improved for their ability to expand ex vivo.
  • these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
  • mobilization for example, mobilization with GM-CSF
  • conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
  • Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
  • T cells are activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466;
  • the T cells of the disclosure are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
  • T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9): 13191328, 1999; Garland et al., J. Immunol Meth. 227(1- 2):53-63, 1999).
  • the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
  • the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (/.e., in "cis” formation) or to separate surfaces (/.e., in "trans” formation).
  • one agent may be coupled to a surface and the other agent in solution.
  • the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
  • the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
  • APCs artificial antigen presenting cells
  • the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.”
  • the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
  • a 1 :1 ratio of each antibody bound to the beads for CD4 + T cell expansion and T cell growth is used.
  • a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1 :1 . In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1 :1. In one embodiment, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1 :100 and all integer values there between. In one aspect of the present disclosure, more anti-CD28 antibody is bound to the particles than anti- CD3 antibody, i.e., the ratio of CD3:CD28 is less than one.
  • the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
  • a 1 :100 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1 :75 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1 :50 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1 :30 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1 :10 CD3:CD28 ratio of antibody bound to beads is used.
  • a 1 :3 CD3:CD28 ratio of antibody bound to the beads is used.
  • a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
  • Ratios of particles to cells from 1 :500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
  • the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
  • the ratio of cells to particles ranges from 1 :100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1 :9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
  • the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1 :100, 1 :50, 1 :40, 1 :30, 1 :20, 1 :10, 1 :9, 1 :8, 1 :7, 1 :6, 1 :5, 1 :4, 1 :3, 1 :2, 1 :1 , 2:1 , 3:1 , 4:1 , 5:1 , 6:1 , 7:1 , 8:1 , 9:1 , 10:1 , and 15:1 with one preferred ratio being at least 1 :1 particles per T cell. In one embodiment, a ratio of particles to cells of 1 :1 or less is used.
  • a preferred particle: cell ratio is 1 :5.
  • the ratio of particles to cells can be varied depending on the day of stimulation.
  • the ratio of particles to cells is from 1 :1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1 :1 to 1 :10 (based on cell counts on the day of addition).
  • the ratio of particles to cells is 1 :1 on the first day of stimulation and adjusted to 1 :5 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1 :1 on the first day, and 1 :5 on the third and fifth days of stimulation.
  • the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1 :10 on the third and fifth days of stimulation.
  • particles are added on a daily or every other day basis to a final ratio of 1 :1 on the first day, and 1 :10 on the third and fifth days of stimulation.
  • ratios will vary depending on particle size and on cell size and type.
  • the cells such as T cells
  • the beads and the cells are subsequently separated, and then the cells are cultured.
  • the agent-coated beads and cells prior to culture, are not separated but are cultured together.
  • the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
  • cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3 x 28 beads) to contact the T cells.
  • the cells for example, 10 4 to 10 9 T cells
  • beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1 :1
  • a buffer preferably PBS (without divalent cations such as, calcium and magnesium).
  • the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (/.e., 100%) may comprise the target cell of interest.
  • any cell number is within the context of the present disclosure.
  • it may be desirable to significantly decrease the volume in which particles and cells are mixed together (/.e., increase the concentration of cells), to ensure maximum contact of cells and particles.
  • a concentration of about 2 billion cells/ml is used.
  • greater than 100 million cells/ml is used.
  • a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
  • a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used.
  • concentrations of 125 or 150 million cells/ml can be used.
  • Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.
  • the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the mixture may be cultured for 21 days. In one embodiment of the disclosure the beads and the T cells are cultured together for about eight days. In another embodiment, the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-y, IL-4, IL- 7, GM-CSF, IL-10, IL-12, IL-15, TGFp, and TNF-a or any other additives for the growth of cells known to the skilled artisan.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2- mercaptoethanol.
  • Media can include RPMI 1640, AIM-V, DMEM, MEM, a-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine (s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics.
  • typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (T H , CD4 + ) that is greater than the cytotoxic or suppressor ? cell population (T c , CD8 + ).
  • T cells Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of T H cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of T c cells. Accordingly, depending on the purpose of treatment, infusing a subject with a T cell population comprising predominately of T H cells may be advantageous. Similarly, if an antigen-specific subset of T c cells has been isolated it may be beneficial to expand this subset to a greater degree.
  • the anti-glyco-LAMP1 antibodies, fusion proteins, and/or anti-glyco-LAMP1 ADCs of the disclosure may be in the form of compositions comprising the anti-glyco-LAMP1 antibody, fusion protein and/or ADC and one or more carriers, excipients and/or diluents.
  • the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
  • the form of the composition (e.g., dry powder, liquid formulation, etc.) and the excipients, diluents and/or carriers used will depend upon the intended uses of the antibody, fusion protein and/or ADC and, for therapeutic uses, the mode of administration.
  • the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier.
  • This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
  • the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
  • routes for administration in any given case will depend on the particular antibody and/or ADC, the subject, and the nature and severity of the disease and the physical condition of the subject.
  • the pharmaceutical composition will be administered intravenously or subcutaneously.
  • compositions can be conveniently presented in unit dosage forms containing a predetermined amount of an anti-glyco-LAMP1 antibody and/or anti-glyco-LAMP1 ADC of the disclosure per dose.
  • the quantity of antibody and/or ADC included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
  • Such unit dosages may be in the form of a lyophilized dry powder containing an amount of antibody and/or ADC suitable for a single administration, or in the form of a liquid.
  • Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
  • Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of antibody and/or ADC suitable for a single administration.
  • compositions may also be supplied in bulk from containing quantities of ADC suitable for multiple administrations.
  • compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing an antibody, fusion protein, and/or ADC having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as "carriers"), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
  • carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
  • carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
  • Buffering agents help to maintain the pH in the range which approximates physiological conditions. They may be present at a wide variety of concentrations, but will typically be present in concentrations ranging from about 2 mM to about 50 mM.
  • Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid- monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid- potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-monos
  • Preservatives may be added to retard microbial growth, and can be added in amounts ranging from about 0.2%-1% (w/v).
  • Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
  • Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
  • Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, a- monothioglycerol and sodium thio sulfate; low mo
  • Non-ionic surfactants or detergents may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
  • Suitable non-ionic surfactants include polysorbates (20, 80, etc.), polyoxamers (184, 188 etc.), and pluronic polyols.
  • Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1 .0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/mL.
  • Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
  • bulking agents e.g., starch
  • chelating agents e.g., EDTA
  • antioxidants e.g., ascorbic acid, methionine, vitamin E
  • cosolvents e.g., ascorbic acid, methionine, vitamin E
  • the anti-glyco-LAMP1 antibody or binding fragments described herein can be used in various diagnostic and therapeutic methods.
  • a patient can be diagnosed with a cancer using any method as described herein (e.g., as described in Section 5.9.1) and subsequently treated using any method as described herein (e.g., as described in Section 5.9.2).
  • the diagnostic methods described herein e.g., as described in Section 5.9.1 can be utilized to monitor the patient’s cancer status during or following cancer therapy (including but not limited to cancer therapy as described in Section 5.9.2). 5.9.1. Diagnostic Methods
  • the anti-glyco-LAMP1 antibody or binding fragments can be used in diagnostic assays.
  • the antibodies and binding fragments can be employed in immunoassays, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays, including immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), fluorescence-activated cell sorting (FACS), and Western blots.
  • immunoassays such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays, including immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), fluorescence-activated cell sorting (FACS), and Western blots.
  • ELISA enzyme-linked immunosorbent assay
  • FACS fluorescence-activated cell sorting
  • the anti-glyco-LAMP1 antibody or binding fragments described herein can be used in a detection assay and/or a diagnostic assay to detect a biomarker in a sample, such as, e.g., a patient-derived biological sample.
  • the biomarker may be a protein biomarker (e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosylated with GalNAc on the threonine residue shown in bold underlined text) present on the surface of or within, e.g., a cancer cell or a cancer-derived extracellular vesicle.
  • a protein biomarker e.g., a tumor- associated glycoform of LAMP-1 , for example a glycoform of LAMP-1 comprising the amino acid sequence CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) and glycosy
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment of the disclosure can be used in a method of detecting a biomarker in a sample comprising one or more EVs (e.g., a liquid biopsy).
  • an EV surface biomarker is recognized by the anti-glyco- LAMP1 antibody or antigen-binding fragment of the disclosure.
  • Exemplary methods of detecting the biomarker include, but are not limited to, capture assays, immunoassays, such as immunoprecipitation; Western blot; ELISA; immunohistochemistry; immunocytochemistry; flow cytometry; and immuno-PCR.
  • an immunoassay can be a chemiluminescent immunoassay.
  • an immunoassay can be a high- throughput and/or automated immunoassay platform.
  • the anti-glyco-LAMP1 antibody or binding fragments described herein also are useful for radiographic in vivo imaging, wherein an antibody labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed.
  • a detectable moiety such as a radio-opaque agent or radioisotope
  • the anti-glyco-LAMP1 antibody or binding fragments, fusion proteins, ADCs and CARs, and chimeric TCRs described herein are useful for treatment of glyco-LAMP1 expressing cancers, including colorectal neoplasm, colon adenocarcinoma, pancreatic adenocarcinoma, breast adenocarcinoma, and Non-Small Cell Lung Cancer.
  • the disclosure provides anti-glyco-LAMP1 antibodies, binding fragments, fusion proteins, ADCs, CARs, and chimeric TCRs as described herein for use as a medicament, for example for use in the treatment of cancer, e.g., any of the cancers identified in the previous paragraph, for use in a diagnostic assay, and for use in radiographic in vivo imaging.
  • the disclosure further provides for the use of the anti-glyco-LAMP1 antibodies, binding fragments, fusion proteins, ADCs, CARs and chimeric TCRs as described herein in the manufacture of a medicament, for example for the treatment of cancer, e.g., any of the cancers identified in the previous paragraph.
  • the therapeutic methods of the disclosure comprise administering to a subject with a glyco-LAMP1 -expressing tumor an effective amount of a genetically modified cell engineered to express a CAR or chimeric TCR of the disclosure, for example a CAR as described in Section 5.3 or in numbered embodiments numbered embodiments 558 to 591 , a chimeric TCR as described in Section 5.4 or in numbered embodiments 602 to 695, or a MicAbody as described in Section 5.6 and numbered embodiments 539 to 542.
  • Methods of modifying cells, particularly T cells, to express a CAR or chimeric TCR are described in Section 5.7.1 .
  • the therapeutic methods of the disclosure comprise administering to a subject with a glyco-LAMP1-expressing tumor therapeutically effective amounts of a MicAbody of the disclosure, for example a MicAbody described in Section 5.6, and a genetically modified T-cell engineered to express a CAR comprising a NKG2D receptor capable of specifically binding the MicAbody.
  • LAMP1 glycopeptides or glyco-LAMP1 peptides, comprising the amino acid CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 155), or a fragment thereof.
  • the LAMP1 glycopeptide is glycosylated with O-linked GalNAc on (i) the threonine residue at amino acid position 9 of CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 155), (ii) the threonine residues at amino acid positions 9 and 10 of CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:155), (iii) the serine residue at amino acid position 7 and the threonine residue at amino acid 9 of CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:155), or (iv), the serine residue at amino acid position 7 and the threonine residues at amino acid positions 9 and 10 of CEQDRPSPTTAPPSPSP (SEQ ID NO: 155).
  • the LAMP1 glycopeptide comprises (i) the amino acid CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200), glycosylated with GalNAc on the threonine residue shown in bold and underlined text; (ii) the amino acid CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:216), glycosylated with GalNAc on the serine and threonine residues shown in bold and underlined text; (iii) the amino acid CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:217), glycosylated with GalNAc on the serine and threonine residues shown in bold and underlined text; (iv) the amino acid CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 154), glycosylated with GalNAc on the serine and threonine residues shown in bold and underlined text, or (v) a fragment of any one of (i)-(iv).
  • Exemplary isolated LAMP1 glycopeptides and uses thereof are described in numbered embodiments 739 to 771 .
  • the present disclosure encompasses synthetic synthesis of the isolated LAMP1 glycoproteins and recombinant methods for producing the isolated LAMP1 glycoproteins.
  • the isolated LAMP1 peptides are synthesized using a solidphase peptide synthesis (SPPS) strategy.
  • SPPS solidphase peptide synthesis
  • SPPS provides for the rapid assembly of a polypeptide through successive reactions of amino acid derivatives on a solid support. Through repeated cycles of alternating N-terminal deprotection and coupling reactions, successive amino acid derivatives are added to the polypeptide.
  • isolated LAMP1 peptides are synthesized using a solution-phase peptide synthesis strategy. Solution-phase peptide synthesis methods are known in the art.
  • pre-synthesized glycosylated amino acids can be used in the elongation reactions.
  • nucleic acid molecules encoding the isolated LAMP1 glycopeptides, vectors comprising such nucleic acids, and host cells capable of producing the isolated LAMP1 glycopeptides of the disclosure are provided.
  • the nucleic acid molecules encode, and the host cells are capable of expressing, the LAMP1 glycopeptide as well as fusion proteins that include the LAMP1 glycoproteins.
  • An isolated LAMP1 glycopeptide of the disclosure can be prepared by recombinant expression in a host cell.
  • a host cell is transfected with a recombinant expression vector carrying DNA encoding the glycopeptide such that the glycopeptide is expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the glycoproteins can be recovered (/.e., isolated).
  • Standard recombinant DNA methodologies are used to obtain a LAMP1 glycoprotein gene, incorporate the gene into recombinant expression vectors and introduce the vectors into host cells, such as those described in Molecular Cloning; A Laboratory Manual, Second Edition (Sambrook, Fritsch and Maniatis (eds), Cold Spring Harbor, N. Y., 1989), 122 Current Protocols in Molecular Biology (Ausubel, F. M. et al., eds., Greene Publishing Associates, 1989) and in U.S. Pat. No. 4,816,397.
  • LAMP1 glycoproteins of the disclosure it is possible to express the LAMP1 glycoproteins of the disclosure in either prokaryotic or eukaryotic host cells.
  • expression of LAMP1 glycoprotein is performed in eukaryotic cells, e.g., mammalian host cells.
  • a host cell is selected based on its ability to glycosylate, e.g., the serine at amino acid position 7 of SEQ ID NO: 154 and the threonines at amino acid positions 9 and 10 of SEQ ID NO: 154.
  • An exemplary host cell is the COSMC HEK293 cell. 5.10.1. LAMP1 Peptide Compositions
  • the LAMP1 glycopeptides of the disclosure may be in the form of compositions comprising the LAMP1 glycopeptide and one or more carriers, excipients, diluents and/or adjuvants.
  • the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
  • the form of the composition e.g., dry powder, liquid formulation, etc.
  • the excipients, diluents and/or carriers used will depend upon the intended uses of the LAMP1 glycopeptide and, for therapeutic uses, the mode of administration.
  • the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable adjuvant.
  • This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
  • the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
  • routes for administration in any given case will depend on the particular LAMP1 glycopeptide to be administered, the subject, and the nature and severity of the disease and the physical condition of the subject.
  • the pharmaceutical composition will be administered intravenously or subcutaneously.
  • compositions can be conveniently presented in unit dosage forms containing a predetermined amount of an LAMP1 glycopeptide of the disclosure per dose.
  • the quantity of LAMP1 glycopeptide included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
  • Such unit dosages may be in the form of a lyophilized dry powder containing an amount of LAMP1 glycopeptide suitable for a single administration, or in the form of a liquid.
  • Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
  • Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of LAMP1 glycopeptide suitable for a single administration.
  • compositions may also be supplied in bulk form containing quantities of LAMP1 glycopeptide suitable for multiple administrations.
  • compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing a LAMP1 glycopeptide having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients, adjuvants or stabilizers typically employed in the art (all of which are referred to herein as "carriers"), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives. See, Remington's Pharmaceutical Sciences, 16th edition (Osol, ed. 1980). Such additives should be nontoxic to the recipients at the dosages and concentrations employed.
  • the composition includes one or more pharmaceutically acceptable adjuvants.
  • Adjuvants include, for example, aluminum salts (e.g., amorphous aluminum hydroxyphosphate sulfate (AAHS), aluminum hydroxide, aluminum phosphate, potassium aluminum sulfate (Alum)), dsRNA analogues, lipid A analogues, flagellin, imidazoquinolines, CpG ODN, saponins (e.g., QS21), C-type lectin ligands (e.g., TDB), CD1d ligands (a-galactosylceramide), M F59, AS01 , AS02, AS03, ASO4, AS15, AF03, GLA-SE, IC31 , CAF01 , and virosomes.
  • Other adjuvants known in the art, including chemical adjuvants, genetic adjuvants, protein adjuvants, and lipid adjuvants, can also be included in the compositions.
  • Buffering agents help to maintain the pH in the range which approximates physiological conditions. They may be present at a wide variety of concentrations, but will typically be present in concentrations ranging from about 2 mM to about 50 mM.
  • Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid- monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid- potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-monos
  • Preservatives may be added to retard microbial growth, and can be added in amounts ranging from about 0.2%-1% (w/v).
  • Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
  • Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
  • Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
  • Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, a- monothioglycerol and sodium thio sulfate; low mo
  • Non-ionic surfactants or detergents may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
  • Suitable non-ionic surfactants include polysorbates (20, 80, etc.), poloxamers (184, 188 etc.), and pluronic polyols.
  • Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1 .0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/m L.
  • Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
  • bulking agents e.g., starch
  • chelating agents e.g., EDTA
  • antioxidants e.g., ascorbic acid, methionine, vitamin E
  • cosolvents e.g., ascorbic acid, methionine, vitamin E
  • Exemplary LAMP1 peptide compositions of the disclosure are described in numbered embodiments 766 and 767.
  • the LAMP1 peptides described herein can be used in the production of antibodies against a tumor-associated form of LAMP1 .
  • the LAMP1 peptide can be administered to an animal.
  • the amount of peptide administered can be effective to cause the animal to produce antibodies against the peptide.
  • "animal” refers to multicellular eukaryotic organism from the biological kingdom Animalia.
  • the animal is a mammal.
  • the animal is a mouse or a rabbit. Resulting antibodies can then be collected from the animal.
  • the LAMP1 peptide can be administered as purified peptide or as part of a composition provided herein.
  • the LAMP1 peptides described herein can be used to elicit an immune response against a tumor-associated form of LAMP1 .
  • the LAMP1 peptide can be administered to an animal in an amount effective to cause the animal to mount an immune response (e.g., produce antibodies) against the peptide.
  • an immune response e.g., produce antibodies
  • Exemplary methods for using the LAMP1 peptides of the disclosure are described in numbered embodiments 768 to 771 .
  • Glycans are essential membrane components and neoplastic transformation of human cells is virtually always associated with aberrant glycosylation of proteins and lipids.
  • protein glycosylation There are several types of protein glycosylation, including N-glycosylation and many types of O- glycosylation, but one of the most diverse types is the mucin type GalNAc type O-glycosylation (hereafter called O-glycosylation).
  • the inventors have identified LAMP1 glycopeptide epitopes in human cancer cells and used the defined glyco-peptides to develop cancer specific anti-glyco-LAMP1 monoclonal antibodies.
  • the LAMP1 glycopeptide, CEQDRPSPTTAPPAPPSPSP (SEQ ID NO: 154), with O- linked GalNAc on the serine and threonine residues shown with bold and underlined text was synthesized using a standard FMOC peptide synthesis strategy. Pre-synthesized glycosylated amino acids were coupled to the elongating peptide at specific locations using solid or solution phase peptide chemistry in a stepwise fashion. After completing the full sequence and removing all protecting groups, the resulting glycopeptide was purified by high-performance liquid chromatography (HPLC) and characterized by mass spectrometry (electrospray ionization in positive mode).
  • HPLC high-performance liquid chromatography
  • mice Female Balb/c mice were immunized subcutaneously with the Tn-glycosylated LAMP1 glycopeptide conjugated to KLH (keyhole limpet hemocyanin) through a maleimide linker. The mice were immunized on days 0, 14, and 35 with 50 pg, 45 pg, and 45 pg of KLH-glycopeptide, respectively. The first immunization used Freund’s complete adjuvant. All subsequent immunizations used Freund’s incomplete adjuvant. On Day 45, tail bleeds were evaluated for polyclonal response.
  • KLH keyhole limpet hemocyanin
  • mice to be fused were boosted with 15 ug of KLH- glycopeptide in Freund’s incomplete adjuvant 3 to 5 days before hybridoma fusion.
  • Splenocytes from mice were fused with SP2/0-Ag14 (ATCC, cat# CRL-1581) myeloma cells using the Electro Cell Manipulator (ECM2001) from BTX Harvard Apparatus.
  • ECM2001 Electro Cell Manipulator
  • 96-well Corning high bind microplates (Fisher) were coated overnight at 4 °C with various concentrations of protein, peptide, or glycopeptide in 0.2 M bicarbonate-carbonate buffer (pH 9.4). The plates were then blocked for 1 hour at room temperature with Phosphate- buffered saline (PBS) (pH 7.4) containing 2.5% BSA. Contents of the plate were discarded and purified antibody, or hybridoma supernatants, or blood serum for polyclonal responses, were added at various concentrations and incubated for two hours at room temperature.
  • PBS Phosphate- buffered saline
  • Plates were washed with tris-buffered saline with 0.05% Tween-20 and then incubated for 1 hour at room temperature with a 1 :3000 dilution of HRP conjugated goat anti-mouse IgG Fey (Sigma). The plates were washed again and developed with TMB chromogen substrate. After proper development (approximately 2-3 min), the reaction was stopped with 0.2 N H 2 SO 4 and the absorbance was read at 450 nm. Data was analysed in GraphPad Prism Software.
  • Adherent cells were dissociated with TrypLE select (Gibco) and washed from flask surface with cell culture media (RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS). Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1%BSA). Cells were resuspended between 5x10 5 cells/ml to 2x10 6 cell/ml and then distributed into a 96 well U-bottom plate.
  • TrypLE select Gibco
  • cell culture media RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS. Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1%BSA). Cells were resuspended between 5x10 5 cells/ml to 2
  • Diluted commercial antibody 0.25-2 ug/ml
  • hybridoma supernatants or blood serum for polyclonal responses
  • cells were incubated for 30 min on ice with a 1 :1600 dilution of AlexaFluor647 conjugated F(ab) 2 goat anti- mouse IgG Fey (JacksonlmmunoResearch).
  • Cells were washed again with PBS/1% BSA and then fixed in 1% formaldehyde in PBS/1% BSA.
  • Cells were analysed on either a 2 or 4 laser Attune NXT flow cytometer. Data was processed in FlowJo Software.
  • the slides were washed in PBS and stained with a 1 :800 dilution of AlexaFluor488 conjugated F(ab) 2 rabbit anti-mouse IgG (H+L) (Invitrogen) for 45 min at room temperature.
  • the slides were washed in PBS and mounted using Prolong Gold Antifade Mountant with DAPI (Thermofisher) and examined using an Olympus FV3000 confocal microscope.
  • 3C7.2C11.1C9 (hereinafter, “3C7”), 13C3.1C8.1C9 (hereinafter, “13C3”), and 13G2.1A10.2G5 (hereinafter “13G2”) were characterized by Biacore to test the reactivity of anti- LAMP1 mAbs to titrated LAMP1 peptides.
  • 3C7, 13C3, and 13G2 were also characterized by Octet to test the reactivity of anti-LAMP1 mAbs to peptides with different glycosylated sites (including a non-glycosylated peptide) as shown in Table 6.
  • Antibody affinity assays can be carried out using surface plasmon resonance (e.g., using a Biacore system (Cytiva)).
  • a surface plasmon resonance assay one or more antibodies can be immobilized onto a biosensor and presented with an analyte (e.g., the LAMP1-Tn peptide Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154; bold and underlined residues indicate GalNAc glycosylation sites) or a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin- CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 155)).
  • analyte e.g., the LAMP1-Tn peptide Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154; bold and underlined residues indicate GalNAc glyco
  • the antibodies are contacted with different concentrations of the analyte, for example concentrations of 2.5 nM, 7.4 nM, 22 nM, 66 nM and 200 nM.
  • Affininty is measured using multicycle kinetics in triplicate for each analyte concentration, with 1 min association and 5 min dissociation.
  • concentration of both antibodies was used (e.g., measured using a 1 pM concentration of each antibody).
  • the affinity is determined by fitting the binding curve to a specific model: kinetic fit (1 :1 model) or if applicable heterogenous ligand binding model.
  • Antibody affinity and epitope binning of monoclonal antibodies can be assessed against specific antigens using BLI.
  • the antigen can be immobilized onto a biosensor (e.g., the LAMP1-Tn peptide Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154) or a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 155)) and presented to one antibody for affinity measurements or two competing antibodies in tandem (or consecutive steps) for epitope binning.
  • a biosensor e.g., the LAMP1-Tn peptide Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154) or a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin-CEQ
  • the binding to non-overlapping epitopes occurs if saturation with the first antibody does not block the binding of the second antibody.
  • the affinity is determined by fitting the binding curve to a specific model: a 1 :1 monovalent model or a 2:1 bivalent model.
  • the error is calculated by how close the generated curve matches the model.
  • Adherent cells were dissociated with TrypLE select (Gibco) and washed from the flask surface with cell culture media (RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS). Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1% BSA). Cells were resuspended between 5x10 5 cells/ml to 2x10 6 cell/ml and then distributed into a 96 well U-bottom plate.
  • TrypLE select Gibco
  • cell culture media RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS. Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1% BSA). Cells were resuspended between 5x10 5 cells/ml to
  • Diluted commercial antibody 0.25-2 pg/ml
  • hybridoma supernatants or blood serum for polyclonal responses
  • cells were incubated for 30 min on ice with a 1 :1600 dilution of AlexaFluor647 conjugated F(ab) 2 goat antimouse IgG Fey (JacksonlmmunoResearch).
  • Cells were washed again with PBS/1% BSA and then fixed in 1% formaldehyde in PBS/1% BSA.
  • Cells were analysed on either a 2 or 4 laser Attune NXT flow cytometer. Data was processed in FlowJo Software.
  • Glycopeptide specific antibodies to Tn-LAMP1 [0420] Glycopeptide reactive antibodies were generated using the Tn-glycosylated LAMP1 glycopeptide. Antibodies generated using LAMP1 glycopeptide, including 3C7, 13C3, and 13G2, proved superior in selectivity.
  • mAb237 is a recombinant mouse antibody (Creative Biolabs; Brooks et al., 2010, Proc Natl Acad Sci USA.
  • Antibody affinity and epitope binning of monoclonal antibodies can be assessed against specific antigens using BLI.
  • the antigen can be immobilized onto a biosensor (e.g., the LAMP1-Tn peptide Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154; glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text), a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin-CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 155), or the podoplanin glycopeptide ERGTKPPLEELSGK (SEQ ID NO:211) (with O-linked GalNAc on the threonine residue shown with bold and underlined text)) and presented to one antibody for affinity measurements or two competing antibodies in tandem (or consecutive steps) for epi
  • a biosensor e.
  • the binding to non-overlapping epitopes occurs if saturation with the first antibody does not block the binding of the second antibody.
  • the affinity is determined by fitting the binding curve to a specific model: a 1 :1 monovalent model or a 2:1 bivalent model.
  • the error is calculated by how close the generated curve matches the model.
  • 3C7, 13C3, and 13G2 were characterized by immunohistochemistry on various normal and cancer tissues.
  • TMAs Paraffin embedded tissue micro arrays
  • tissue sections were de-paraffinized with xylene and ethanol, following antigen retrieval with citrate buffer (pH 6.0) and heated in microwave for 18 min.
  • TMAs obtained from USBIOMAX and were stained with Ultra Vison Quanto Detection System HRP DAB. Briefly, TMAs were washed in TBS, incubated with mAb supernatant for 2 hours. After wash in TBS x 2, the TMAs was incubated with Primary Antibody Amplifier Quanto for 10 min. After wash in TBS, TMAs were incubated with HRP polymer quanto (10 min) followed by DAB chromogen. Slides were counterstained with hematoxylin, were dehydrated, and mounted.
  • CARs Chimeric antigen receptors having VH and VL domains of 3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5 were designed. CARs were then evaluated in targetspecific a cytotoxicity assay.
  • scFvs having VH and VL domains of 3C7, 13C3, and 13G2 were designed (FIGS 8A-8C).
  • the VH and VL are attached together with one long linker (GGGGS)s (SEQ ID NO: 160) to the CD8a hinge followed by a second generation CAR-T (CD28 intracellular signal domain, and a CD3-zeta intracellular chain).
  • the N-terminus of the scFvs was attached to a CD8a signal sequence.
  • the LAMP1 CAR-Ts were subcloned into the Virapower lentivirus vector pLENTI6.3-V5-DEST (Invitrogen). Nucleotide sequences encoding the CARs are shown in Table 15. Amino acid sequences of the CARs are shown in Table 16.
  • CAR constructs were expressed in human T cells. Surface expression of CART constructs was confirmed by flow cytometry using Alexa488-Proteinl_. 13C3-CART and 13G2- CART specifically killed Tn+ COSMC-KO HaCaTs, but not Tn- HaCaTs at 10 to 1 ratio of T cells to HaCaTs (FIG 6). Referring to Table 17, the time to kill 50% COSMC-KO HaCaTs was 7.3 hrs for 13C3-CART and 8.75 for 13G2-CART. The data suggests 13C3-CART and 13G2- CART selectively target LAMP1-Tn.
  • N/A 50% of cells were not killed.
  • Rapid Amplification of cDNA Ends was performed to determine the heavy chain and light chain nucleotide sequences for 3C7, 13C3, and 13G2.
  • the nucleotide sequences encoding the heavy and light chain variable regions of 3C7 are set forth in SEQ ID NO:21 and SEQ ID NO:22, respectively.
  • the heavy and light chain variable regions encoded by SEQ ID NO:21 and SEQ ID NO:22 are set forth in SEQ ID NO:1 and SEQ ID NO:2, respectively.
  • the predicted heavy chain CDR sequences are set forth in SEQ ID NOS:3-5, respectively, and the predicted light chain CDR sequences (IMGT definition) are set forth in SEQ ID NOS:6-8, respectively.
  • the predicted heavy chain CDR sequences are set forth in SEQ ID NO:9-11 , respectively, and the predicted light chain CDR sequences (Kabat definition) are set forth in SEQ ID NO: 12-14, respectively.
  • the predicted heavy chain CDR sequences (Chothia definition) are set forth in SEQ ID NO: 15-17, respectively, and the predicted light chain CDR sequences (Chothia definition) are set forth in SEQ ID NO: 18-20, respectively.
  • the nucleotide sequences encoding the heavy and light chain variable regions of 13C3 are set forth in SEQ ID NO:43 and SEQ ID NO:44, respectively.
  • the heavy and light chain variable regions encoded by SEQ ID NO:43 and SEQ ID NO:44 are set forth in SEQ ID NO:23 and SEQ ID NO:24, respectively.
  • the predicted heavy chain CDR sequences (IMGT definition) are set forth in SEQ ID NOS:25-27, respectively, and the predicted light chain CDR sequences (IMGT definition) are set forth in SEQ ID NQS:28-30, respectively.
  • the predicted heavy chain CDR sequences (Kabat definition) are set forth in SEQ ID NOS:31-33, respectively, and the predicted light chain CDR sequences (Kabat definition) are set forth in SEQ ID NOS:34-36, respectively.
  • the predicted heavy chain CDR sequences (Chothia definition) are set forth in SEQ ID NOS:37-39, respectively, and the predicted light chain CDR sequences (Chothia definition) are set forth in SEQ ID NQS:40-42, respectively.
  • the nucleotide sequences encoding the heavy and light chain variable regions of 13G2 are set forth in SEQ ID NO:65 and SEQ ID NO: 66, respectively.
  • the heavy and light chain variable regions encoded by SEQ ID NO:65 and SEQ ID NO: 66 are set forth in SEQ ID NO:45 and SEQ ID NO: 46, respectively.
  • the predicted heavy chain CDR sequences (IMGT definition) are set forth in SEQ ID NOS:47-49, respectively, and the predicted light chain CDR sequences (IMGT definition) are set forth in SEQ ID NOS:50-52, respectively.
  • the predicted heavy chain CDR sequences are set forth in SEQ ID NOS:53-55, respectively, and the predicted light chain CDR sequences (Kabat definition) are set forth in SEQ ID NOS:56-58, respectively.
  • the predicted heavy chain CDR sequences (Chothia definition) are set forth in SEQ ID NOS:59-61 , respectively, and the predicted light chain CDR sequences (Chothia definition) are set forth in SEQ ID NOS:62-64, respectively.
  • ADCs Antibody drug conjugates covalently attached to 3C7.2C11 .1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5 were produced. LAMPI-ADCs were then evaluated in target-specific a cytotoxicity assay.
  • ADCs were created by covalently attaching MC-GGFG-DX8951 to 3C7.2C11.1C9, 13C3.1C8.1C9, and 13G2.1A10.2G5.
  • Drug antibody ratios were calculated by mass spectrometry. The DARS for 13c3 was 3.1 and 13G2 was 5.6. The DAR could not be calculated for 3C7-ADC (Table 15).
  • 3C7-ADC (GGFG-DX8951), 13C3-ADC (GGFG-DX8951) and 13G2-ADC (GGFG- DX8951) specifically killed Tn+ COSMC-KO T47Ds, but not Tn- T47D or Tn- HaCaTs (FIG. 5A- 1 to 5A-3).
  • the IC50 for cell death was 4.5 nM for 3C7-ADC, 5.6 nM for 13C3-ADC, and 5.6 nM for 13G2-ADC.
  • the murine antibody 13C3 was humanized using standard CDR-grafting technology.
  • four templates, IGHV3-72*01 , IGHV3-23*05, IGHV7-4-1*02, and IGHV3 were employed in order to generate CDR-grafted versions containing successively aggressive levels of humanization, i.e., identity to the human acceptor germline.
  • three templates, IGKV2-30*02, IGKV4-1*01 , and IGKV7-3*01 were employed to generate CDR-grafted versions containing successively aggressive levels of humanization.
  • Expression constructs were designed for expression in Expi-293 cells. IL2 secretion signals were added to both heavy and light chain constructs. Antibodies were purified with ProteinA beads using conventional methods. Humanized candidates were evaluated for their ability to binding to the non-glycosylated and Tn-glycosylated LAMP1 peptides using ELISA. The humanized candidates were also compared to the parental antibody by size exclusion chromatography and Octet to determine binding affinity to the peptide antigen.
  • 96-well Corning high bind ELISA microplates plates were coated with LAMP1 peptides titrated in 0.2 M bicarbonate buffer, pH 9.4 overnight at 4 °C in concentrations ranging from 0.08 pg/ml to 10 pg/ml. BSA was used as a control/measure of background. The plates were then blocked with SuperBlockTM (Thermo Fisher) for 1 hr at room temperature. After plate washing, the humanized variants of 13C3 were incubated on the ELISA plate for 1 hour. All tested variants were expressed and purified using conventional methods.
  • Expi-293 cells were transiently transfected with heavy and light chain constructs, antibodies were secreted into supernatant and purified using Protein A agarose beads. The plates were then washed, and then incubated with secondary antibody (1/3000 Goat Anti-mouse IgG (H+L) HRP (Abeam 62-6520)) for 1 hour. The plate was then washed and color was developed with 1-StepTM Ultra TMB (Thermo Fisher) for 2 minutes. Color development was then stopped with 2 N Sulfuric Acid. Absorbance at 450 nm was then measured.
  • secondary antibody (1/3000 Goat Anti-mouse IgG (H+L) HRP (Abeam 62-6520)
  • HRP Abeam 62-6520
  • Antibody affinity of the humanized candidates of 13C3 can be assessed against specific antigens using BLI.
  • the antigen can be immobilized onto a biosensor (e.g., the LAMP1-Tn peptide -CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154) or a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin- CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 155)) and presented to one antibody candidate for affinity measurements or two competing antibodies in tandem (or consecutive steps) for epitope binning.
  • a biosensor e.g., the LAMP1-Tn peptide -CEQDRPSPTTAPPAPPSPSP (the amino acid portion of which is SEQ ID NO: 154) or a negative control analyte such as an unglycosylated LAMP1 peptide (Biotin- CEQDRPSPTTAPPSPSP
  • the binding to non-overlapping epitopes occurs if saturation with the first antibody does not block the binding of the second antibody.
  • the affinity is determined by fitting the binding curve to a specific model: a 1 :1 monovalent model or a 2:1 bivalent model.
  • the error is calculated by how close the generated curve matches the model.
  • the humanized candidates for 13C3 were tested for the presence of soluble protein aggregates using size exclusion chromatography (SEC). Briefly, purified antibodies were loaded on an HPLC silica TSK-GEL G3000SW column (TOSOH Biosciences, Montgomeryville, PA) and associated UV detector (166 Detector). The mobile phase composition was PBS and flow rate was 1 .0 mL/min. Concentrations of protein species were determined by monitoring the absorbance of column eluate at 280 nm. 6.8.3. Results
  • ADCs Antibody drug conjugates covalently attached to humanized 13C3 were produced.
  • the drug conjugate was covalently linked to cleavable MMAE with maleimide (vc- PAB-MMAE).
  • ADCs were created by covalently attaching cleavable MMAE with maleimide (vc- PAB-MMAE to 13C3.
  • Drug antibody ratios (DARs) were calculated by mass spectrometry. Measurements were taken by Octet and ELISA for affinity to synthetic antigen (LAMP1-GP). Aggregation of the purified antibodies was quantified by Size Exclusion Chromatography (SEC).
  • LAMP1 peptide comprising CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:200) or a fragment thereof that has been glycosylated with GalNAc on the threonine residue shown with bold and underlined text (“the first LAMP1 glycopeptide”);
  • LAMP1 glycopeptide comprising CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:216) or a fragment thereof that has been glycosylated with GalNAc on the threonine residues shown with bold and underlined text (“the second LAMP1 glycopeptide”);
  • LAMP1 peptide comprising CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:217) or a fragment thereof that has been glycosylated with GalNAc on the serine and threonine residues shown with bold and underlined text (“the third LAMP1 glycopeptide”); or
  • LAMP1 peptide comprising CEQDRPSPTTAPPAPPSPSP (SEQ ID NO:154) or a fragment thereof that has been glycosylated with GalNAc on the serine and threonine residues shown with bold and underlined text (“the fourth LAMP1 glycopeptide”).
  • the anti-glyco-LAMP1 antibody or antigen binding fragment of embodiment 1 which specifically binds to, or specifically competes for binding to, the third LAMP1 glycopeptide. 5. The anti-glyco-LAMP1 antibody or antigen binding fragment of embodiment 1 which specifically binds to, or specifically competes for binding to, the fourth LAMP1 glycopeptide.
  • any one of embodiments 1 to 5, wherein the fragment of the first LAMP1 glycopeptide, the second LAMP1 glycopeptide, the third LAMP1 glycopeptide, or the fourth LAMP1 glycopeptide comprises amino acids 3-11 , 3-12, 3-13, 3-14, 3-15, 3-16, 3-17, 3-18, 3-19, or 3-20 of SEQ ID NQ:200, 216, 217, or 154, respectively.
  • the anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 5, wherein the first LAMP1 glycopeptide, the second LAMP1 glycopeptide, the third LAMP1 glycopeptide, or the fourth LAMP1 glycopeptide comprises SEQ ID NQ:200, 216, 217, or 154, respectively.
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 10, wherein the anti-glyco-LAMP1 antibody or antigen binding fragment competes with an antibody or antigen binding fragment comprising a heavy chain variable (VH) sequence of EVQLLESGGGLVQPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVSEIRSSAFNHATY YAESVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCTPNWDEGFAYWGQGTLVTVSS (SEQ ID NO: 135) and a light chain variable (VL) sequence of DWMTQSPLSLPVTLGQPASISCRSSQSLVHSNGNTYLHWYQQRPGQSPRLLINKVSNRFSG VPDRFSGSGSGTDFTLKISRVEAEDVGVYFCSQSTHVPRTFGGGTKVEIK (SEQ ID NO: 145) for binding to any one of the LAMP1 glycopeptides.
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 10, wherein the anti-glyco-LAMP1 antibody or antigen binding fragment competes with an antibody or antigen binding fragment comprising a heavy chain variable (VH) sequence of EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVGELRSKAFNHAT YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTPNWDEGFAYWGQGTLVTVSS (SEQ ID NO: 137) and a light chain variable (VL) sequence of DWMTQSPDSLAVSLGERATINCRSSQSLVHSNGNTYLHWYQQKPGQPPKLLINKVSNRFSG VPDRFSGSGSGTDFTLTISSLQAEDVAVYFCSQSTHVPRTFGGGTKVEIK (SEQ ID NO:148) for binding to any one of the LAMP1 glycopeptides.
  • VH heavy chain variable
  • anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 10, wherein the anti-glyco-LAMP1 antibody or antigen binding fragment competes with an antibody or antigen binding fragment comprising a heavy chain variable (VH) sequence of EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVGELRSKAFNHAT YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTPNWDEGFAYWGQGTLVTVSS (SEQ ID NO: 137) and a light chain variable (VL) sequence of DWMTQSPDSLAVSLGERATINCKSSQSLLHSNGNTYLHWYQQKPGQPPKLLINKVSTRFSGV PDRFSGSGSGTDFTLTISSLQAEDVAVYYCSQSTHVPRTFGGGTKVEIK (SEQ ID NO: 149) for binding to any one of the LAMP1 glycopeptides.
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 10, wherein the anti-glyco-LAMP1 antibody or antigen binding fragment competes with an antibody or antigen binding fragment comprising a heavy chain variable (VH) sequence of EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVGELRSKAFNHAT YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTPNWDEGFAYWGQGTLVTVSS (SEQ ID NO: 137) and a light chain variable (VL) sequence of DWMTQSPASLAVSPGQRATITCRSSQSLVHSNGNTYLHWYQQKPGQPPKLLINKVSNRFSG VPARFSGSGSGTDFTLTINPVEANDTANYFCSQSTHVPRTFGGGTKVEIK (SEQ ID NO:151) for binding to any one of the LAMP1 glycopeptides.
  • VH heavy chain variable
  • anti-glyco-LAMP1 antibody or antigen binding fragment of any one of embodiments 1 to 10, wherein the anti-glyco-LAMP1 antibody or antigen binding fragment competes with an antibody or antigen binding fragment comprising a heavy chain variable (VH) sequence of EVQLVESGGGLVKPGGSLRLSCAASGFTFSDAWMDWVRQAPGKGLEWVGELRSKAFNHAT YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTPNWDEGFAYWGQGTLVTVSS (SEQ ID NO: 137) and a light chain variable (VL) sequence of DWLTQSPASLAVSPGQRATITCRSSESLSHSNGNTYLHWYQQKPGQPPKLLINKVSNKFTGV PARFSGSGSGTDFTLTINPVEANDTANYYCSQSTHVPRTFGGGTKVEIK (SEQ ID NO: 152) for binding to any one of the LAMP1 glycopeptides.
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH
  • VH heavy chain variable
  • VH heavy
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable sequence of EV
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable sequence of
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable sequence of
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of QV
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of QV
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable sequence of QV
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable sequence of Q
  • VH heavy chain variable
  • VH heavy chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • VH heavy chain variable
  • VL light chain variable
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an a nt i- glyco- LAM P1 antibody or antigen-binding fragment according to any one of embodiments 1 to 235, comprising:
  • CDR H1 a complementarity determining region (CDR) H1 comprising the amino acid sequence of a CDR-H1 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:67, SEQ ID NO:73, SEQ ID NO:79, SEQ ID NO:103, or SEQ ID NO:127);
  • a CDR-H2 comprising the amino acid sequence of a CDR-H2 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:68, SEQ ID NO:74, SEQ ID NQ:80, SEQ ID NQ:104, or SEQ ID NO:128);
  • a CDR-H3 comprising the amino acid sequence of a CDR-H3 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:69, SEQ ID NO: 75, SEQ ID NO: 81 , SEQ ID NO:105, or SEQ ID NO:129);
  • a CDR-L1 comprising the amino acid sequence of a CDR-L1 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:70, SEQ ID NO:76, SEQ ID NO:82, SEQ ID NO:106, or SEQ ID NQ:130);
  • a CDR-L2 comprising the amino acid sequence of a CDR-L2 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:71 , SEQ ID NO:77, SEQ ID NO:83, SEQ ID NQ:107, or SEQ ID NO:131); and
  • a CDR-L3 comprising the amino acid sequence of a CDR-L3 of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:72, SEQ ID NO:78, SEQ ID NO:84, SEQ ID NQ:108, or SEQ ID NO:132).
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of embodiment 236, wherein the amino acid designated Xi in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74, and/or SEQ ID NQ:104
  • Xi amino acid designated in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:68, SEQ ID NO:74, and/or SEQ ID NQ:104) is L.
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of embodiment 236, wherein the amino acid designated Xi in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74, and/or SEQ ID NQ:104
  • Xi amino acid designated in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D (e.g., SEQ ID NO:68, SEQ ID NO:74, and/or SEQ ID NQ:104) is M.
  • anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 238, wherein the amino acid designated X 2 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74, SEQ ID NQ:80, SEQ ID NQ:104, and/or SEQ ID NO:128, is A.
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 240, wherein the amino acid designated X 3 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74 and/or SEQ ID NQ:104
  • X 3 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74 and/or SEQ ID NQ:104
  • anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 240, wherein the amino acid designated X 3 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74 and/or SEQ ID NQ:104
  • amino acid designated X 3 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:68, SEQ ID NO:74 and/or SEQ ID NQ:104
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 244, wherein the amino acid designated X 5 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:69 and/or SEQ ID NO:105
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 244, wherein the amino acid designated X 5 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:69 and/or SEQ ID NQ:105
  • SEQ ID NO:69 and/or SEQ ID NQ:105 is S.
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 244, wherein the amino acid designated X 6 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NQ:70, SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO:106, and/or SEQ ID NO:130
  • SEQ ID NQ:70, SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO:106, and/or SEQ ID NO:130 is S.
  • the anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 244, wherein the amino acid designated X 6 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:70, SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO:106, and/or SEQ ID NO:130
  • SEQ ID NO:70, SEQ ID NO: 76, SEQ ID NO: 82, SEQ ID NO:106, and/or SEQ ID NO:130 is N.
  • anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 248, wherein the amino acid designated X 7 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:77, SEQ ID NO:83, and/or SEQ ID NQ:107
  • K amino acid designated X 7 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D
  • anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 236 to 250, wherein the amino acid designated X 8 in a CDR sequence of any one of Tables 1 D, 1 E, 1 F, 2D, and 3D e.g., SEQ ID NO:77, SEQ ID NO:83, and/or SEQ ID NQ:107 is F.
  • CDR-H1 comprises the amino acid sequence of GFTFSDAW (SEQ ID NO:67).
  • CDR-H2 comprises the amino acid sequence of EX1RSKX2FNHAX3YYAESVX4G (SEQ ID NQ:104).
  • CDR-H3 comprises the amino acid sequence of X5PNWDEGFAY (SEQ ID NO:69).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 3C7 as defined by IMGT (e.g., SEQ ID NOS:3- 5) and a VL comprising CDRs of 3C7 as defined by IMGT (e.g., SEQ ID NOS:6-8).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 3C7 as defined by Kabat (e.g., SEQ ID NOS:9-11) and a VL comprising CDRs of 3C7 as defined by Kabat (e.g., SEQ ID NOS:12-14).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 3C7 as defined by Chothia (e.g., SEQ ID NOS: 15-17) and a VL comprising CDRs of 3C7 as defined by Chothia (e.g., SEQ ID NOS: 18- 20).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13C3 as defined by IMGT (e.g., SEQ ID NOS:25-27) and a VL comprising CDRs of 13C3as defined by IMGT (e.g., SEQ ID NOS:28-30).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13C3 as defined by Kabat (e.g., SEQ ID NOS:31-33) and a VL comprising CDRs of 13C3 as defined by Kabat (e.g., SEQ ID NOS:34- 36).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13C3 as defined by Chothia (e.g., SEQ ID NOS:37-39) and a VL comprising CDRs of 13C3 as defined by Chothia (e.g., SEQ ID NOS:40- 42).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13G2 as defined by IMGT (e.g., SEQ ID NOS:47-49) and a VL comprising CDRs of 13G2 as defined by IMGT (e.g., SEQ ID NQS:50- 52).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13G2 as defined by Kabat (e.g., SEQ ID NOS:53-55) and a VL comprising CDRs of 13G2 as defined by Kabat (e.g., SEQ ID NOS:56- 58).
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of 13G2 as defined by Chothia (e.g., SEQ ID NOS:59-61) and a VL comprising CDRs of 13G2 as defined by Chothia (e.g., SEQ ID NOS:62- 64.
  • An anti-glyco-LAMP1 antibody or antigen-binding fragment which is optionally an anti-glyco-LAMP1 antibody or antigen-binding fragment of any one of embodiments 1 to 235, which comprises a VH comprising CDRs of GFTFSDAWMD (SEQ ID NO:85), EMRSKAFNHAIYYAESVKG (SEQ ID NO:86), and TPNWDEGFAY (SEQ ID NO:87); and a VL comprising CDRs of RSSQSLVHSNGNTYLH (SEQ ID NO:88), KVSNRFF (SEQ ID NO:89), and SQSTHVPRT (SEQ ID NQ:90).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2022/042457 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses Ceased WO2023034571A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP22783104.7A EP4396232A1 (en) 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses
AU2022339819A AU2022339819A1 (en) 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses
US18/688,464 US20250066498A1 (en) 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses
CN202280073228.6A CN118355031A (zh) 2021-09-03 2022-09-02 抗糖-lamp1抗体及其用途
KR1020247010868A KR20240101546A9 (ko) 2021-09-03 2022-09-02 항-글리코-lamp1 항체 및 그의 용도
JP2024514125A JP2024534910A (ja) 2021-09-03 2022-09-02 抗グリコlamp1抗体およびその使用
CA3230933A CA3230933A1 (en) 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163240773P 2021-09-03 2021-09-03
US63/240,773 2021-09-03

Publications (1)

Publication Number Publication Date
WO2023034571A1 true WO2023034571A1 (en) 2023-03-09

Family

ID=83508864

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/042457 Ceased WO2023034571A1 (en) 2021-09-03 2022-09-02 Anti-glyco-lamp1 antibodies and their uses

Country Status (9)

Country Link
US (1) US20250066498A1 (cg-RX-API-DMAC7.html)
EP (1) EP4396232A1 (cg-RX-API-DMAC7.html)
JP (1) JP2024534910A (cg-RX-API-DMAC7.html)
KR (1) KR20240101546A9 (cg-RX-API-DMAC7.html)
CN (1) CN118355031A (cg-RX-API-DMAC7.html)
AU (1) AU2022339819A1 (cg-RX-API-DMAC7.html)
CA (1) CA3230933A1 (cg-RX-API-DMAC7.html)
TW (1) TW202325733A (cg-RX-API-DMAC7.html)
WO (1) WO2023034571A1 (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025111553A3 (en) * 2023-11-22 2025-06-26 The General Hospital Corporation Antibody-based human lamp-1 composition and its uses

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120535634A (zh) * 2025-06-10 2025-08-26 扬州大学 一种抗lamp1的小鼠单克隆抗体及其应用
CN120795136B (zh) * 2025-09-11 2025-12-09 华中农业大学 猪德尔塔冠状病毒单克隆抗体及其在制备抗原检测试纸条中的应用

Citations (138)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR104E (cg-RX-API-DMAC7.html)
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4444887A (en) 1979-12-10 1984-04-24 Sloan-Kettering Institute Process for making human antibody producing B-lymphocytes
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
WO1987005912A1 (en) 1986-03-31 1987-10-08 T Cell Sciences, Inc. Therapeutic and diagnostic methods using soluble t cell surface molecules
US4716111A (en) 1982-08-11 1987-12-29 Trustees Of Boston University Process for producing human antibodies
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1989012624A2 (en) 1988-06-14 1989-12-28 Cetus Corporation Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5658570A (en) 1991-07-25 1997-08-19 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
WO1998016654A1 (en) 1996-10-11 1998-04-23 Japan Tobacco, Inc. Production of a multimeric protein by cell fusion method
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
WO1998046645A2 (en) 1997-04-14 1998-10-22 Micromet Gesellschaft Für Biomedizinische Forschung Mbh Method for the production of antihuman antigen receptors and uses thereof
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
WO1998050433A2 (en) 1997-05-05 1998-11-12 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
WO1999054342A1 (en) 1998-04-20 1999-10-28 Pablo Umana Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US6181964B1 (en) 1997-08-01 2001-01-30 Genetronics, Inc. Minimally invasive apparatus and method to electroporate drugs and genes into tissue
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6678556B1 (en) 1998-07-13 2004-01-13 Genetronics, Inc. Electrical field therapy with reduced histopathological change in muscle
US20040014645A1 (en) 2002-05-28 2004-01-22 Advisys, Inc. Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US20040059285A1 (en) 2002-07-04 2004-03-25 Inovio As Electroporation device and injection apparatus
US20040092907A1 (en) 1997-04-03 2004-05-13 Inovio As Method for muscle delivery of drugs, nucleic acids and other compounds
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
WO2004045512A2 (en) 2002-11-15 2004-06-03 Genmab A/S Human monoclonal antibodies against cd25
WO2004065540A2 (en) 2003-01-22 2004-08-05 Glycart Biotechnology Ag Fusion constructs and use of same to produce antibodies with increased fc receptor binding affinity and effector function
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
WO2005012912A2 (en) * 2003-07-25 2005-02-10 Chiron Corporation Lamp-1 membrane expression by cancer cells
US20050037434A1 (en) * 2003-08-14 2005-02-17 National Centre For Cell Science Monoclonal antibody against costimulatory molecule M150 and a process for preparation thereof
US20050052630A1 (en) 2002-03-07 2005-03-10 Advisys, Inc. Constant current electroporation device and methods of use
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20050070841A1 (en) 2002-07-04 2005-03-31 Inovio As Electroporation device and injection apparatus
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
WO2005061547A2 (en) 2003-12-22 2005-07-07 Micromet Ag Bispecific antibodies
US20050271615A1 (en) 2002-08-30 2005-12-08 Doron Shabat Self-immolative dendrimers releasing many active moieties upon a single activating event
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
US20060116422A1 (en) 2002-11-14 2006-06-01 De Groot Franciscus Marinus H Prodrugs built as multiple self-elimination-release spacers
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US20060134709A1 (en) 2004-11-10 2006-06-22 Jeffery Stavenhagen Engineering Fc antibody regions to confer effector function
WO2006064136A1 (fr) 2004-12-16 2006-06-22 Centre National De La Recherche Scientifique (Cnrs) Production de formats d'anticorps et applications immunologiques de ces formats
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
WO2006113665A2 (en) 2005-04-15 2006-10-26 Macrogenics, Inc. Covalent diabodies and uses thereof
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
US7173116B2 (en) 2000-03-03 2007-02-06 Genetronics Biomedical Corporation Nucleic acid formulations for gene delivery and methods of use
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US7217797B2 (en) 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US7223837B2 (en) 2001-03-23 2007-05-29 Syntarga B.V. Elongated and multiple spacers in activatible prodrugs
US20070128708A1 (en) 2005-12-07 2007-06-07 Genetronics, Inc. Variable volume electroporation chamber and methods therefore
WO2007089149A2 (en) 2006-02-02 2007-08-09 Syntarga B.V. Water-soluble cc-1065 analogs and their conjugates
US20070280931A1 (en) 1998-11-18 2007-12-06 Chen Yvonne M Antibody variants
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2008157379A2 (en) 2007-06-21 2008-12-24 Macrogenics, Inc. Covalent diabodies and uses thereof
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2009073445A2 (en) 2007-11-28 2009-06-11 Mersana Therapeutics, Inc. Biocompatible biodegradable fumagillin analog conjugates
WO2009077483A1 (en) 2007-12-14 2009-06-25 Novo Nordisk A/S Antibodies against human nkg2d and uses thereof
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080254A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080251A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2010017103A2 (en) 2008-08-04 2010-02-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Fully human anti-human nkg2d monoclonal antibodies
WO2010068795A2 (en) 2008-12-12 2010-06-17 Pearson Robert M Method and system for tissue treatment utilizing irreversible electroporation and thermal track coagulation
US7741465B1 (en) 1992-03-18 2010-06-22 Zelig Eshhar Chimeric receptor genes and cells transformed therewith
WO2010080538A1 (en) 2008-12-19 2010-07-15 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2010138719A1 (en) 2009-05-28 2010-12-02 Mersana Therapeutics, Inc. Polyal drug conjugates comprising variable rate-releasing linkers
US20110183893A1 (en) 2009-12-31 2011-07-28 Avidbiotics Corporation Non-natural mic proteins
US7989434B2 (en) 2004-02-23 2011-08-02 Seattle Genetics, Inc. Heterocyclic self-immolative linkers and conjugates
WO2011101791A1 (en) 2010-02-18 2011-08-25 Tcl Pharma Anti-cd28 humanized antibodies
WO2011120053A1 (en) 2010-03-26 2011-09-29 Mersana Therapeutics, Inc. Modified polymers for delivery of polynucleotides, method of manufacture, and methods of use thereof
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
US20110311561A1 (en) 2009-12-31 2011-12-22 Avidbiotics Corp. Non-natural mic proteins
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2013026833A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
US8455622B2 (en) 2006-12-01 2013-06-04 Seattle Genetics, Inc. Variant target binding agents and uses thereof
WO2013085925A1 (en) 2011-12-05 2013-06-13 Igenica, Inc. Antibody-drug conjugates and related compounds, compositions, and methods
WO2013096901A1 (en) 2011-12-23 2013-06-27 Mersana Therapeutics, Inc. Pharmaceutical formulations for fumagillin derivative-phf conjugates
US8535678B2 (en) 2003-02-20 2013-09-17 Seattle Genetics, Inc. Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders
US8568728B2 (en) 2005-07-18 2013-10-29 Seattle Genetics, Inc. Beta-glucuronide-linker drug conjugates
US20130309256A1 (en) 2012-05-15 2013-11-21 Seattle Genetics, Inc. Self-stabilizing linker conjugates
WO2014008375A1 (en) 2012-07-05 2014-01-09 Mersana Therapeutics, Inc. Terminally modified polymers and conjugates thereof
WO2014093379A1 (en) 2012-12-10 2014-06-19 Mersana Therapeutics, Inc. Auristatin compounds and conjugates thereof
WO2014093640A1 (en) 2012-12-12 2014-06-19 Mersana Therapeutics,Inc. Hydroxy-polmer-drug-protein conjugates
WO2014093394A1 (en) 2012-12-10 2014-06-19 Mersana Therapeutics, Inc. Protein-polymer-drug conjugates
WO2014102299A2 (en) * 2012-12-27 2014-07-03 Sanofi Anti-lamp1 antibodies and antibody drug conjugates, and uses thereof
WO2014145000A2 (en) 2013-03-15 2014-09-18 Abbvie Biotherapeutics Inc. Anti-cd25 antibodies and their uses
US20150165065A1 (en) 2009-12-31 2015-06-18 Avidbiotics Corp. Non-natural mic proteins
US20150191543A1 (en) 2012-08-06 2015-07-09 The Regents Of The University Of California Engineered antibody fragments for targeting and imaging cd8 expression in vivo
WO2016020309A1 (en) 2014-08-04 2016-02-11 F. Hoffmann-La Roche Ag Bispecific t cell activating antigen binding molecules
WO2016090278A2 (en) 2014-12-05 2016-06-09 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
US20160304578A1 (en) 2014-12-05 2016-10-20 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
WO2016182751A1 (en) 2015-05-08 2016-11-17 Xencor, Inc. Heterodimeric antibodies that bind cd3 and tumor antigens
WO2016187349A1 (en) 2015-05-18 2016-11-24 Tcr2, Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2017024131A1 (en) 2015-08-04 2017-02-09 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands, and non-natural nkg2d ligands that bind non-natural nkg2d receptors
WO2017070608A1 (en) 2015-10-23 2017-04-27 Eureka Therapeutics, Inc. Antibody/t-cell receptor chimeric constructs and uses thereof
WO2017103003A1 (en) 2015-12-15 2017-06-22 Ose Immunotherapeutics Anti-cd28 humanized antibodies formulated for administration to humans
US9783591B2 (en) 2012-02-22 2017-10-10 The Trustees Of The University Of Pennsylvania Use of the CD2 signaling domain in second-generation chimeric antigen receptors
WO2017222556A2 (en) 2016-06-24 2017-12-28 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
WO2019191243A1 (en) 2018-03-27 2019-10-03 Xyphos Biosciences Inc. Modified a1-a2 domains of non-natural nkg2d ligands that bind non-natural nkg2d receptors
WO2020029774A1 (zh) 2018-08-08 2020-02-13 华夏英泰(北京)生物技术有限公司 一种嵌合t细胞受体star及其应用
US10730944B2 (en) 2017-07-24 2020-08-04 Regeneron Pharmaceuticals, Inc. Anti-CD8 antibodies and uses thereof
WO2020234399A1 (en) 2019-05-20 2020-11-26 INSERM (Institut National de la Santé et de la Recherche Médicale) Novel anti-cd25 antibodies
WO2020236964A1 (en) 2019-05-20 2020-11-26 The Trustees Of The University Of Pennsylvania Engineered expression of cell surface and secreted sialidase by car t cells for increased efficacy in solid tumors
WO2021009146A1 (en) 2019-07-15 2021-01-21 F. Hoffmann-La Roche Ag Antibodies binding to nkg2d
US20210214806A1 (en) 2019-03-01 2021-07-15 Mercy Bioanalytics, Inc. Systems, compositions, and methods for target entity detection

Patent Citations (157)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR104E (cg-RX-API-DMAC7.html)
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
US4444887A (en) 1979-12-10 1984-04-24 Sloan-Kettering Institute Process for making human antibody producing B-lymphocytes
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4716111A (en) 1982-08-11 1987-12-29 Trustees Of Boston University Process for producing human antibodies
US4510245A (en) 1982-11-18 1985-04-09 Chiron Corporation Adenovirus promoter system
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5168062A (en) 1985-01-30 1992-12-01 University Of Iowa Research Foundation Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence
US4968615A (en) 1985-12-18 1990-11-06 Ciba-Geigy Corporation Deoxyribonucleic acid segment from a virus
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1987005912A1 (en) 1986-03-31 1987-10-08 T Cell Sciences, Inc. Therapeutic and diagnostic methods using soluble t cell surface molecules
WO1989012624A2 (en) 1988-06-14 1989-12-28 Cetus Corporation Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6887466B2 (en) 1988-11-23 2005-05-03 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7144575B2 (en) 1988-11-23 2006-12-05 The Regents Of The University Of Michigan Methods for selectively stimulating proliferation of T cells
US5883223A (en) 1988-11-23 1999-03-16 Gray; Gary S. CD9 antigen peptides and antibodies thereto
US7232566B2 (en) 1988-11-23 2007-06-19 The United States As Represented By The Secretary Of The Navy Methods for treating HIV infected subjects
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693761A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Polynucleotides encoding improved humanized immunoglobulins
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
WO1991009967A1 (en) 1989-12-21 1991-07-11 Celltech Limited Humanised antibodies
WO1991010741A1 (en) 1990-01-12 1991-07-25 Cell Genesys, Inc. Generation of xenogeneic antibodies
US5939598A (en) 1990-01-12 1999-08-17 Abgenix, Inc. Method of making transgenic mice lacking endogenous heavy chains
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
EP0519596A1 (en) 1991-05-17 1992-12-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
US6054297A (en) 1991-06-14 2000-04-25 Genentech, Inc. Humanized antibodies and methods for making them
US5681722A (en) 1991-07-25 1997-10-28 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5693780A (en) 1991-07-25 1997-12-02 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5658570A (en) 1991-07-25 1997-08-19 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5885793A (en) 1991-12-02 1999-03-23 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US7741465B1 (en) 1992-03-18 2010-06-22 Zelig Eshhar Chimeric receptor genes and cells transformed therewith
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
EP0592106A1 (en) 1992-09-09 1994-04-13 Immunogen Inc Resurfacing of rodent antibodies
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US6567694B2 (en) 1993-04-01 2003-05-20 Genetronics, Inc. Needle electrodes for mediated delivery of drugs and genes
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6905681B1 (en) 1994-06-03 2005-06-14 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US7695936B2 (en) 1995-03-01 2010-04-13 Genentech, Inc. Knobs and holes heteromeric polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US7172869B2 (en) 1995-05-04 2007-02-06 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US5834597A (en) 1996-05-20 1998-11-10 Protein Design Labs, Inc. Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same
WO1998016654A1 (en) 1996-10-11 1998-04-23 Japan Tobacco, Inc. Production of a multimeric protein by cell fusion method
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US20040092907A1 (en) 1997-04-03 2004-05-13 Inovio As Method for muscle delivery of drugs, nucleic acids and other compounds
WO1998046645A2 (en) 1997-04-14 1998-10-22 Micromet Gesellschaft Für Biomedizinische Forschung Mbh Method for the production of antihuman antigen receptors and uses thereof
WO1998050433A2 (en) 1997-05-05 1998-11-12 Abgenix, Inc. Human monoclonal antibodies to epidermal growth factor receptor
US6181964B1 (en) 1997-08-01 2001-01-30 Genetronics, Inc. Minimally invasive apparatus and method to electroporate drugs and genes into tissue
US6516223B2 (en) 1997-08-01 2003-02-04 Genetronics, Inc. Apparatus for electroporation mediated delivery for drugs and genes
US6233482B1 (en) 1997-08-01 2001-05-15 Genetronics, Inc. Method of electroporation mediated delivery of drugs and genes
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
WO1999054342A1 (en) 1998-04-20 1999-10-28 Pablo Umana Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6678556B1 (en) 1998-07-13 2004-01-13 Genetronics, Inc. Electrical field therapy with reduced histopathological change in muscle
US20070280931A1 (en) 1998-11-18 2007-12-06 Chen Yvonne M Antibody variants
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US20060121005A1 (en) 2000-02-24 2006-06-08 Xcyte Therapies, Inc. Activation and expansion of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US6905874B2 (en) 2000-02-24 2005-06-14 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US7173116B2 (en) 2000-03-03 2007-02-06 Genetronics Biomedical Corporation Nucleic acid formulations for gene delivery and methods of use
US7223837B2 (en) 2001-03-23 2007-05-29 Syntarga B.V. Elongated and multiple spacers in activatible prodrugs
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20040101519A1 (en) 2002-01-03 2004-05-27 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
US20050052630A1 (en) 2002-03-07 2005-03-10 Advisys, Inc. Constant current electroporation device and methods of use
US20040014645A1 (en) 2002-05-28 2004-01-22 Advisys, Inc. Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system
US20050070841A1 (en) 2002-07-04 2005-03-31 Inovio As Electroporation device and injection apparatus
US20040059285A1 (en) 2002-07-04 2004-03-25 Inovio As Electroporation device and injection apparatus
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
US20050271615A1 (en) 2002-08-30 2005-12-08 Doron Shabat Self-immolative dendrimers releasing many active moieties upon a single activating event
US7217797B2 (en) 2002-10-15 2007-05-15 Pdl Biopharma, Inc. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US20060116422A1 (en) 2002-11-14 2006-06-01 De Groot Franciscus Marinus H Prodrugs built as multiple self-elimination-release spacers
WO2004045512A2 (en) 2002-11-15 2004-06-03 Genmab A/S Human monoclonal antibodies against cd25
WO2004065540A2 (en) 2003-01-22 2004-08-05 Glycart Biotechnology Ag Fusion constructs and use of same to produce antibodies with increased fc receptor binding affinity and effector function
US8535678B2 (en) 2003-02-20 2013-09-17 Seattle Genetics, Inc. Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders
WO2005012912A2 (en) * 2003-07-25 2005-02-10 Chiron Corporation Lamp-1 membrane expression by cancer cells
US20050037434A1 (en) * 2003-08-14 2005-02-17 National Centre For Cell Science Monoclonal antibody against costimulatory molecule M150 and a process for preparation thereof
WO2005061547A2 (en) 2003-12-22 2005-07-07 Micromet Ag Bispecific antibodies
US7989434B2 (en) 2004-02-23 2011-08-02 Seattle Genetics, Inc. Heterocyclic self-immolative linkers and conjugates
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
US20060034810A1 (en) 2004-05-27 2006-02-16 The Trustees Of The University Of Pennsylvania Novel artificial antigen presenting cells and uses therefor
US7855275B2 (en) 2004-09-23 2010-12-21 Genentech, Inc. Cysteine engineered antibodies and conjugates
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US20060134709A1 (en) 2004-11-10 2006-06-22 Jeffery Stavenhagen Engineering Fc antibody regions to confer effector function
WO2006064136A1 (fr) 2004-12-16 2006-06-22 Centre National De La Recherche Scientifique (Cnrs) Production de formats d'anticorps et applications immunologiques de ces formats
WO2006113665A2 (en) 2005-04-15 2006-10-26 Macrogenics, Inc. Covalent diabodies and uses thereof
US8568728B2 (en) 2005-07-18 2013-10-29 Seattle Genetics, Inc. Beta-glucuronide-linker drug conjugates
US20070128708A1 (en) 2005-12-07 2007-06-07 Genetronics, Inc. Variable volume electroporation chamber and methods therefore
WO2007089149A2 (en) 2006-02-02 2007-08-09 Syntarga B.V. Water-soluble cc-1065 analogs and their conjugates
US8455622B2 (en) 2006-12-01 2013-06-04 Seattle Genetics, Inc. Variant target binding agents and uses thereof
WO2008119567A2 (en) 2007-04-03 2008-10-09 Micromet Ag Cross-species-specific cd3-epsilon binding domain
WO2008157379A2 (en) 2007-06-21 2008-12-24 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2009073445A2 (en) 2007-11-28 2009-06-11 Mersana Therapeutics, Inc. Biocompatible biodegradable fumagillin analog conjugates
WO2009077483A1 (en) 2007-12-14 2009-06-25 Novo Nordisk A/S Antibodies against human nkg2d and uses thereof
WO2009080254A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080251A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080253A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2009080252A1 (en) 2007-12-21 2009-07-02 F. Hoffmann-La Roche Ag Bivalent, bispecific antibodies
WO2010017103A2 (en) 2008-08-04 2010-02-11 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Fully human anti-human nkg2d monoclonal antibodies
WO2010068795A2 (en) 2008-12-12 2010-06-17 Pearson Robert M Method and system for tissue treatment utilizing irreversible electroporation and thermal track coagulation
WO2010080538A1 (en) 2008-12-19 2010-07-15 Macrogenics, Inc. Covalent diabodies and uses thereof
WO2010138719A1 (en) 2009-05-28 2010-12-02 Mersana Therapeutics, Inc. Polyal drug conjugates comprising variable rate-releasing linkers
US20110183893A1 (en) 2009-12-31 2011-07-28 Avidbiotics Corporation Non-natural mic proteins
US20150165065A1 (en) 2009-12-31 2015-06-18 Avidbiotics Corp. Non-natural mic proteins
US20110311561A1 (en) 2009-12-31 2011-12-22 Avidbiotics Corp. Non-natural mic proteins
WO2011101791A1 (en) 2010-02-18 2011-08-25 Tcl Pharma Anti-cd28 humanized antibodies
WO2011120053A1 (en) 2010-03-26 2011-09-29 Mersana Therapeutics, Inc. Modified polymers for delivery of polynucleotides, method of manufacture, and methods of use thereof
WO2011131746A2 (en) 2010-04-20 2011-10-27 Genmab A/S Heterodimeric antibody fc-containing proteins and methods for production thereof
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2013026833A1 (en) 2011-08-23 2013-02-28 Roche Glycart Ag Bispecific t cell activating antigen binding molecules
WO2013085925A1 (en) 2011-12-05 2013-06-13 Igenica, Inc. Antibody-drug conjugates and related compounds, compositions, and methods
WO2013096901A1 (en) 2011-12-23 2013-06-27 Mersana Therapeutics, Inc. Pharmaceutical formulations for fumagillin derivative-phf conjugates
US9783591B2 (en) 2012-02-22 2017-10-10 The Trustees Of The University Of Pennsylvania Use of the CD2 signaling domain in second-generation chimeric antigen receptors
US20130309256A1 (en) 2012-05-15 2013-11-21 Seattle Genetics, Inc. Self-stabilizing linker conjugates
WO2014008375A1 (en) 2012-07-05 2014-01-09 Mersana Therapeutics, Inc. Terminally modified polymers and conjugates thereof
US20150191543A1 (en) 2012-08-06 2015-07-09 The Regents Of The University Of California Engineered antibody fragments for targeting and imaging cd8 expression in vivo
WO2014093394A1 (en) 2012-12-10 2014-06-19 Mersana Therapeutics, Inc. Protein-polymer-drug conjugates
WO2014093379A1 (en) 2012-12-10 2014-06-19 Mersana Therapeutics, Inc. Auristatin compounds and conjugates thereof
WO2014093640A1 (en) 2012-12-12 2014-06-19 Mersana Therapeutics,Inc. Hydroxy-polmer-drug-protein conjugates
WO2014102299A2 (en) * 2012-12-27 2014-07-03 Sanofi Anti-lamp1 antibodies and antibody drug conjugates, and uses thereof
WO2014145000A2 (en) 2013-03-15 2014-09-18 Abbvie Biotherapeutics Inc. Anti-cd25 antibodies and their uses
WO2016020309A1 (en) 2014-08-04 2016-02-11 F. Hoffmann-La Roche Ag Bispecific t cell activating antigen binding molecules
WO2016090278A2 (en) 2014-12-05 2016-06-09 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
US20160304578A1 (en) 2014-12-05 2016-10-20 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
WO2016182751A1 (en) 2015-05-08 2016-11-17 Xencor, Inc. Heterodimeric antibodies that bind cd3 and tumor antigens
WO2016187349A1 (en) 2015-05-18 2016-11-24 Tcr2, Inc. Compositions and methods for tcr reprogramming using fusion proteins
WO2017024131A1 (en) 2015-08-04 2017-02-09 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands, and non-natural nkg2d ligands that bind non-natural nkg2d receptors
WO2017070608A1 (en) 2015-10-23 2017-04-27 Eureka Therapeutics, Inc. Antibody/t-cell receptor chimeric constructs and uses thereof
WO2017103003A1 (en) 2015-12-15 2017-06-22 Ose Immunotherapeutics Anti-cd28 humanized antibodies formulated for administration to humans
WO2017222556A2 (en) 2016-06-24 2017-12-28 Avidbiotics Corp. Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands
US10730944B2 (en) 2017-07-24 2020-08-04 Regeneron Pharmaceuticals, Inc. Anti-CD8 antibodies and uses thereof
WO2019191243A1 (en) 2018-03-27 2019-10-03 Xyphos Biosciences Inc. Modified a1-a2 domains of non-natural nkg2d ligands that bind non-natural nkg2d receptors
WO2020029774A1 (zh) 2018-08-08 2020-02-13 华夏英泰(北京)生物技术有限公司 一种嵌合t细胞受体star及其应用
US20210214806A1 (en) 2019-03-01 2021-07-15 Mercy Bioanalytics, Inc. Systems, compositions, and methods for target entity detection
WO2020234399A1 (en) 2019-05-20 2020-11-26 INSERM (Institut National de la Santé et de la Recherche Médicale) Novel anti-cd25 antibodies
WO2020236964A1 (en) 2019-05-20 2020-11-26 The Trustees Of The University Of Pennsylvania Engineered expression of cell surface and secreted sialidase by car t cells for increased efficacy in solid tumors
WO2021009146A1 (en) 2019-07-15 2021-01-21 F. Hoffmann-La Roche Ag Antibodies binding to nkg2d

Non-Patent Citations (136)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1989, GREENE PUBLISHING ASSOCIATES
"GenBank", Database accession no. BAB71849.1
"Monoclonal Antibodies For Cancer Detection And Therapy", vol. Analysis, Results, and Future Prospective of the T, 1985, ACADEMIC PRESS
"NCBI", Database accession no. NP_000724.1
"Solid Phase Peptide Synthesis", 1984, THE PIERCE CHEMICAL CO.
"UniProt", Database accession no. P07766
ADREJEWSKI ET AL., J BIOL CHEM., vol. 274, 1999, pages 12692 - 12701
AI-LAZIKANI ET AL., J. MOL. BIOL, vol. 273, 1997, pages 927 - 948
AMON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy"
AXUP ET AL., PROC NATL ACAD SCI USA., vol. 109, no. 40, 2012, pages 16101 - 16106
BADESCU ET AL., BIOCONJUGATE CHEM, vol. 25, 2014, pages 1124 - 1136
BAEUERLE ET AL., DRUGS OF THE FUTURE, vol. 33, 2008, pages 137 - 147
BARGOU ET AL., SCIENCE, vol. 321, 2008, pages 974 - 977
BAUDAT ET AL., CANCER RES, vol. 76, 2016, pages 1198
BERG ET AL., TRANSPLANT PROC, vol. 30, no. 8, 1998, pages 3975 - 3977
BIERER ET AL., CURR. OPIN. IMMUN., vol. 5, 1993, pages 763 - 773
BIN HOU ET AL., DIS MARKERS, 2019
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BRENTJENS ET AL., SCI TRANSL MED, vol. 5, no. 177, 2013, pages 177 - 38
BROOKS ET AL., PROC NATL ACAD SCI USA., vol. 107, no. 22, 2010, pages 10056 - 10061
BURKE ET AL., BIOCONJUGATE CHEM, vol. 20, 2009, pages 1242 - 1250
CANFIELDMORRISON, J. EXP. MED., vol. 173, 1991, pages 1483 - 1491
CARTER, J, IMMUNOL METH, vol. 248, 2001, pages 7 - 15
CAS , no. 110417-88-4
CAS REGISTRY , no. 1198357797
CAS REGISTRY, no. 126602899
CAS, no. 474645-27-7
CELL SIGNALLING TECHNOLOGIES: "LAMP1 (C54H11) Rabbit mAb #3243", INTERNET CITATION, 21 March 2014 (2014-03-21), pages 1, XP002727023, Retrieved from the Internet <URL:http://media.cellsignal.com/pdf/3243.pdf> [retrieved on 20140708] *
CHARI, ACC CHEM RES, vol. 41, 2008, pages 98 - 107
CHU ET AL.: "Roche Molecular Biologicals", BIOCHEMIA, no. 2, 2001
COX ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836
DAVIS ET AL., PROTEIN ENG DES SEL, vol. 23, 2010, pages 195 - 202
DE GROOT ET AL., ANGEW. CHEM. INT. ED., vol. 42, 2003, pages 4494 - 4499
DUBOWCHIK ET AL., BIOORG. MED. CHEM. LETT., vol. 8, no. 21, 1998, pages 3341 - 3346
DUBOWCHIK ET AL., J. ORG. CHEM., vol. 67, 1998, pages 1866 - 1872
DUCRY ET AL., BIOCONJUGATE CHEM, vol. 21, 2010, pages 5 - 13
FERRARA ET AL., BIOTECHN BIOENG, vol. 93, 2006, pages 851 - 861
FISCHER ET AL., NATURE COMMUN, vol. 6, 2015, pages 6113
FISHER: "Laboratory Techniques In Biochemistry And Molecular Biology", 1980, ELSEVIER
FRANCISCO ET AL., BLOOD, vol. 102, 2003, pages 1458 - 1465
FURUTA ET AL., AM J PATHOL, vol. 159, 2001, pages 449 - 455
GARLAND ET AL., J. IMMUNOL METH., vol. 227, no. 1-2, 1999, pages 53 - 63
GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1985, pages 191 - 202
GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS, pages: 185
GROSS ET AL., PROC NATL ACAD SCI USA., vol. 86, 1989, pages 10024 - 10028
GROSSESHHAR, FASEB J, vol. 6, no. 15, 1992, pages 3370 - 3378
GRUPP ET AL., N ENGL J MED, vol. 368, no. 16, 2013, pages 1509 - 1518
GU ET AL., PLOS ONE, vol. 10, no. 5, 2015, pages e0124135
GUNASEKARAN ET AL., J BIOL CHEM, vol. 285, no. 25, 2010, pages 19637 - 46
HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 13191328
HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery"
HENDERSON ET AL., IMMUN, vol. 73, 1991, pages 316 - 321
HOLLANDER ET AL., BIOCONJUGATE CHEM, vol. 19, 2008, pages 358 - 361
HOLLIGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 8
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JEFFREY ET AL., BIOCONJUG. CHEM., vol. 17, 2006, pages 831 - 840
JEFFREY ET AL., BIOORG. MED. CHEM. LETT., vol. 17, 2007, pages 2278 - 2280
JENSEN ET AL., INT J CLIN EXP PATHOL, vol. 6, no. 7, 2013, pages 1294 - 1305
JESPERS ET AL., BIOTECHNOLOGY, vol. 12, 1988, pages 899 - 903
JIANG ET AL., J. AM. CHEM. SOC., vol. 127, 2005, pages 11254 - 11255
JOHNSON ET AL., MOL BIOL, vol. 399, 2010, pages 436 - 49
JUNGPLUCKTHUN, PROTEIN ENGINEERING, vol. 10, no. 9, 1997, pages 959 - 966
KALOS ET AL., SCI TRANSL MED, vol. 3, no. 95, 2011, pages 95 - 73
KANNAN ET AL., CELL IMMUNOL, vol. 171, 1996, pages 10 - 19
KAUFMANSHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621
KING ET AL., J MED CHEM, vol. 45, 2002, pages 4336 - 4343
KING ET AL., TETRAHEDRON LETTERS, vol. 43, 2002, pages 1987 - 1990
KIPRIYANOV ET AL., MOL BIOL, vol. 293, 1999, pages 41 - 56
KITSON ET AL., CROS/CMOS--CHEMICA OGGI--CHEMISTRY TODAY, vol. 31, no. 4, 2013, pages 30 - 38
KLEIN ET AL., MABS, vol. 8, no. 6, 2016, pages 1010 - 1020
KOCHENDERFER ET AL., BLOOD, vol. 116, no. 20, 2010, pages 4099 - 4102
KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497
KUNZLI ET AL., CANCER, vol. 94, no. 1, 2002, pages 228 - 239
KUWANA ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 149, no. 3, pages 960 - 968
LABRIJN ET AL., NAT PROTOC, vol. 9, no. 10, 2014, pages 2450 - 63
LABRIJN ET AL., PROC NATL ACAD SCI USA, vol. 110, 2013, pages 5145 - 50
LEFRANC ET AL., DEV COMPARAT IMMUNOL, vol. 27, 2003, pages 55 - 77
LI ET AL., CELL RES, vol. 25, 2015, pages 981 - 984
LIU ET AL., CELL, vol. 66, 1991, pages 807 - 815
LIU ET AL., FRONT. IMMUNOL., vol. 8, 2017, pages 38
LIU ET AL., SCI TRANSL MED, vol. 13, 2021, pages eabb5191
LOFFLER ET AL., BLOOD, vol. 95, 2000, pages 2098 - 103
LUND ET AL., J. IMMUNOL., vol. 147, 1991, pages 2657 - 2662
LYON ET AL., NATURE BIOTECH
MAZOR ET AL., MABS, vol. 7, 2015, pages 377 - 89
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
METZ ET AL., PROTEIN ENG DES SEL, vol. 25, 2012, pages 571 - 80
MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 40
MORRISON, SCIENCE, vol. 229, no. 4719, 1985, pages 1202 - 7
MURRAY ET AL., CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 17, 2013, pages 420 - 426
NOLTING: "Antibody-Drug Conjugates", METHODS IN MOLECULAR BIOLOGY, vol. 1045, 2013, pages 71 - 100
NOLTING: "Antibody-Drug Conjugates: Methods in Molecular Biology", vol. 1045, 2013, SPRINGER SCIENCE & BUSINESS MEDICA, LLC, article "Linker Technology in Antibody-Drug Conjugates", pages: 71 - 100
NOOIJ ET AL., EUR J IMMUNOL, vol. 19, 1986, pages 981 - 984
OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 - 221
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PARKINSON-LAWRENCE E J ET AL: "Immunochemical analysis of CD107a (LAMP-1)", CELLULAR IMMUNOLOGY, ACADEMIC PRESS, SAN DIEGO, CA, US, vol. 236, no. 1-2, 1 July 2005 (2005-07-01), pages 161 - 166, XP027189896, ISSN: 0008-8749, [retrieved on 20051212] *
PARKINSON-LAWRENCE ET AL., CELL IMMUNOL, vol. 236, 2005, pages 161 - 166
PERUSSIA ET AL., J. IMMUNOL., vol. 130, no. 5, 1983, pages 2142 - 2148
PESSANO ET AL., EMBO J, vol. 4, 1985, pages 337 - 340
PORTER ET AL., N ENGL J MED, vol. 365, no. 8, 2011, pages 725 - 733
RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621
RIDGWAY ET AL., PROTEIN ENG, vol. 9, 1996, pages 617 - 621
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 7
RIECHMANN, JOURNAL OF IMMUNOLOGICAL METHODS, vol. 231, 1999, pages 25 - 38
RODRIGUES ET AL., INT J CANCER SUPPL, vol. 7, 1992, pages 45 - 50
ROGUSKA ET AL., PROC. NATL. ACAD. SCI., vol. 91, 1994, pages 969 - 973
SAFTIGKLUMPERMAN, NAT REV MOL CELL BIO, vol. 10, 2009, pages 623 - 635
SARAFIAN ET AL., INT J CANCER, vol. 75, 1998, pages 105 - 111
SCHAEFER ET AL., PROC NATL ACAD SCI USA, vol. 108, 2011, pages 11187 - 92
SCHANZER ET AL., J BIOL CHEM, vol. 289, 2014, pages 18693 - 706
SHAMIS ET AL., J. AM. CHEM. SOC., vol. 126, 2004, pages 1726 - 1731
SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740
SHINKAWA ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 3466 - 73
STEINMETZ ET AL., MABS, vol. 8, no. 6, 2016, pages 1010 - 1020
STUBENRAUCH ET AL., DRUG METABOLISM AND DISPOSITION, vol. 38, 2010, pages 84 - 91
STUDNICKA ET AL., PROT. ENG., vol. 7, 1994, pages 805 - 814
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 12, 2002, pages 2213 - 2215
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 11, 2003, pages 1761 - 1768
SUTHERLAND ET AL., BLOOD, vol. 122, 2013, pages 1455 - 1463
THORPE ET AL., IMMUNOL. REV., vol. 62, 1982, pages 119 - 58
THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review"
TOMLINSON ET AL., J. MOL. BIOL., vol. 22T, 1992, pages 116 - 198
UMANA ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 176 - 180
URLAUBCHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220
WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316
WALKER ET AL., BIOORG. MED. CHEM. LETT., vol. 12, 2002, pages 217 - 219
WALKER ET AL., BIOORG. MED. CHEM. LETT., vol. 14, 2004, pages 4323 - 4327
WIERNIK ET AL., CLIN CANCER RES, vol. 19, 2013, pages 3844 - 55
WOLFSON, CHEM. BIOL., vol. 13, no. 10, 2006, pages 1011 - 2
WRANIK ET AL., J BIOL CHEM, vol. 287, 2012, pages 43331 - 9
YANEZ-MO ET AL., J EXTRACELL VESICLES, vol. 4, 2015, pages 27066
YANG ET AL., INT. J. MOL. SCI., vol. 18, 2017, pages 48
YAZAKI ET AL., PROTEIN ENG. DES SEL., vol. 17, no. 5, 17 August 2004 (2004-08-17), pages 481 - 9
ZHAO ET AL., J. MED. CHEM., vol. 54, 2011, pages 3606 - 3623
ZHOU ET AL., MOLECULES, vol. 23, no. 6, 2018, pages 1326
ZIEGLER-HEITBROCK ET AL., CLIN.EXP. IMMUNOL., vol. 58, 1984, pages 470 - 477

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025111553A3 (en) * 2023-11-22 2025-06-26 The General Hospital Corporation Antibody-based human lamp-1 composition and its uses

Also Published As

Publication number Publication date
CA3230933A1 (en) 2023-03-09
CN118355031A (zh) 2024-07-16
AU2022339819A1 (en) 2024-04-11
EP4396232A1 (en) 2024-07-10
TW202325733A (zh) 2023-07-01
KR20240101546A (ko) 2024-07-02
US20250066498A1 (en) 2025-02-27
JP2024534910A (ja) 2024-09-26
KR20240101546A9 (ko) 2025-12-10

Similar Documents

Publication Publication Date Title
US20230126689A1 (en) Anti-glyco-cd44 antibodies and their uses
US20250304716A1 (en) Anti-glyco-muc1 antibodies and their uses
US20250066498A1 (en) Anti-glyco-lamp1 antibodies and their uses
CA3078812A1 (en) Anti-glyco-muc1 antibodies and their uses
US20250136701A1 (en) Anti-glyco-cmet antibodies and their uses
US20250101126A1 (en) Anti-glyco-muc4 antibodies and their uses
US20250326855A1 (en) Anti-glyco-cd44 antibodies and their uses
HK40114974A (zh) 抗糖-muc4抗体及其用途
CN118354788A (zh) 抗糖-muc4抗体及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22783104

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2024514125

Country of ref document: JP

Ref document number: 3230933

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2022339819

Country of ref document: AU

Ref document number: AU2022339819

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2022783104

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022339819

Country of ref document: AU

Date of ref document: 20220902

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022783104

Country of ref document: EP

Effective date: 20240403

WWE Wipo information: entry into national phase

Ref document number: 202280073228.6

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 18688464

Country of ref document: US