WO2023015307A1 - Method for producing genetically modified cells - Google Patents

Method for producing genetically modified cells Download PDF

Info

Publication number
WO2023015307A1
WO2023015307A1 PCT/US2022/074625 US2022074625W WO2023015307A1 WO 2023015307 A1 WO2023015307 A1 WO 2023015307A1 US 2022074625 W US2022074625 W US 2022074625W WO 2023015307 A1 WO2023015307 A1 WO 2023015307A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
rna
cell
sequence
car
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/074625
Other languages
English (en)
French (fr)
Inventor
Shengkan Jin
Juan-Carlos COLLANTES
John LAMBOURNE
Immacolata PORRECA
Tommaso SELMI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Revvity Discovery Ltd
Rutgers State University of New Jersey
Original Assignee
Horizon Discovery Ltd
Rutgers State University of New Jersey
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Horizon Discovery Ltd, Rutgers State University of New Jersey filed Critical Horizon Discovery Ltd
Priority to JP2024506903A priority Critical patent/JP2024534720A/ja
Priority to KR1020247007517A priority patent/KR20240043783A/ko
Priority to CA3227964A priority patent/CA3227964A1/en
Priority to US18/681,775 priority patent/US20250109413A1/en
Priority to CN202280067317.XA priority patent/CN118159301A/zh
Priority to AU2022324118A priority patent/AU2022324118A1/en
Priority to EP22854129.8A priority patent/EP4380627A1/en
Publication of WO2023015307A1 publication Critical patent/WO2023015307A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70535Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0646Natural killers cells [NK], NKT cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0696Artificially induced pluripotent stem cells, e.g. iPS
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/10Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/50Cellular immunotherapy characterised by the use of allogeneic cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/85Fusion polypeptide containing an RNA binding domain
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/315Phosphorothioates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present disclosure relates to new methods, cells, systems, kits, and other aspects of producing genetically engineered cells using the Clustered Interspaced Regularly Short Palindromic Repeat (CRISPR) based gene editing systems for introducing multiple genetic modifications into cells.
  • CRISPR Clustered Interspaced Regularly Short Palindromic Repeat
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeat
  • the NHEJ repair pathway is the most active repair mechanism and frequently results in small nucleotide insertions or deletions (indels) at the DSB site, causing amino acid deletions, insertions or frameshift mutations leading to premature stop codons or nonsense mutations within the open reading frame (ORF) of the targeted gene.
  • inducing multiple DSBs during multiplexed gene editing procedures can cause undesirable genotoxicity and the formation of potentially oncogenic gross chromosomal translocations.
  • More precise gene editing can be achieved through the use of modified nucleases (e.g., Cas9 nickase) which retain only one active nuclease domain and generate a DNA nick rather than a blunt-ended DSB.
  • modified nucleases e.g., Cas9 nickase
  • the variant Cas9 D10A a mutant of SpCas9, retains only the HNH nuclease activity and, in the presence of two guide RNAs (gRNAs) targeting opposite DNA strands, creates a staggered DSB, thus increasing target specificity.
  • gRNAs guide RNAs
  • Chimeric antigen receptor -T (CAR-T) cell immunotherapy is a novel method that involves the genetic modification of a patient's own T cells to express a CAR specific for a tumor antigen.
  • the method is an individualized treatment involving expansion of the genetically modified cells ex vivo followed by re-infusion back to the patient.
  • This therapy has shown impressive results in hematological cancers, anti-CD19 CAR-T therapies have been approved for the treatment of CD19 positive leukemia or lymphoma (YescartaTM, KymriahTM, TecartusTM- and BreyanziTM) and anti-BCMA CAR-T therapies have also been approved for multiple myeloma (AbecmaTM).
  • the application of CAR-T causes a number of acute side effects, such as cytokine release syndrome and neurological toxicities, leading to the death of the patient in some cases.
  • CARs are typically transduced into the T cells of a patient using randomly integrating vectors, which may result in oncogenic transformation, variegated transgene expression, and transcriptional silencing. Recently, advances in genome editing enable efficient, targeted gene delivery. Directing a CD19-specific CAR to the T-cell receptor a constant (TRAC) locus allows the expression of CAR under control of the endogenous TRAC regulatory elements, which enhances T-cell potency and delays exhaustion.
  • TRAC constant
  • the disclosure provides methods for making multiple genetic modifications to a cell, the methods comprising introducing into the cell and/or expressing in the cell: a) a CRISPR system for integrating an exogenous sequence at a first target nucleic acid sequence, the CRISPR system comprising: i) a first gRNA and a second gRNA that are complementary to opposite strands of the first target nucleic acid sequence; and ii) a donor nucleic acid sequence comprising the exogenous sequence; b) a base editing system for introducing a genetic modification at a second target nucleic acid sequence, the base editing system comprising: i) an RNA scaffold comprising a guide RNA sequence that is complementary to the second target nucleic acid sequence and, a recruiting RNA motif; and ii) an effector fusion protein comprising an RNA binding domain capable of binding to the recruiting RNA motif and an effector domain comprising a base modifying enzyme; and c) an RNA guided nickase capable of
  • the method may be performed using only one RNA guided nickase (also referred to herein as a single RNA guided nickase or a common RNA guide nickase). This may be advantageous as it reduces the number of components that need to be provided and delivered to the cell.
  • the base modifying enzyme has cytosine deamination activity, adenosine deamination activity, DNA methyl transferase activity, or demethylase activity.
  • the RNA guided nickase may be a CRISPR Type II or Type V enzyme. In some embodiments, where the RNA guided nickase is a CRISPR Type II enzyme, the enzyme is a Cas9 nickase. In an embodiment, the RNA guided nickase is nCas9 with one or two Uracil Glycosylase Inhibitors (UGls).
  • UGls Uracil Glycosylase Inhibitors
  • the first and second gRNAs may be provided as sgRNAs.
  • the RNA scaffold used in the methods, cells, systems and kits herein may comprise a tracrRNA.
  • pre- crRNA maturation of a precursor crRNA (pre- crRNA) requires involvement of a trans-acting CRISPR (tracr) RNA.
  • tracr trans-acting CRISPR
  • no tracrRNA has been identified, and pre-crRNA processing is mediated by the Type V effector proteins themselves.
  • the RNA scaffold used in the methods, cells, systems and kits herein may be introduced into the cell as chemically synthesized RNA and may comprise one or more chemical modifications.
  • the methods, cells, systems, and kits provided herein may utilize one or more recruiting RNA motifs, in some embodiments, located at the 3' end of the RNA scaffold.
  • the recruiting RNA motif may be an MS2 aptamer, in some embodiments, an MS2 aptamer that has an extended stem, for example, an extended stem comprising 2-24 nucleotides.
  • the methods, cells, systems, and kits provided herein may use an effector domain having cytosine deamination activity or cytidine deamination activity (the terms are used interchangeably), for example, a wild type or genetically engineered version of AID, CDA, APOBEC1, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D, APOBEC3F, or other APOBEC family enzymes.
  • the methods, cells, systems, and kits provided herein may use an effector domain having adenine deamination activity or adenosine deamination activity (the terms are used interchangeably), for example, a wild type or genetically engineered version of ADA, ADAR family enzymes, or tRNA adenosine deaminases.
  • the methods, cells, systems, and kits provided herein may use an effector domain having a DNA methyl transferase activity, for example, a wild type or genetically engineered version of Dnmtl, Dnmt3a, or Dnmt3b.
  • the methods, cells, systems, and kits provided herein may use an effector domain having a demethylase activity, for example, a wild type or genetically engineered version of Tetl, Tet2, or TDG.
  • the methods, cells, systems, and kits provided herein may use a first gRNA and a second gRNA, that are complementary to opposite strands of a TRAC or B2M locus.
  • the methods, cells, systems, and kits may use a modular system comprising multiple base editing systems capable of binding to different target nucleic acid sequences to genetically modify multiple different genetic loci.
  • the CRISPR system used in the methods herein may introduce a donor nucleic acid sequence comprising a CAR orTCR encoding sequence flanked by homology arms specific to the first target nucleic acid sequence.
  • the CAR or TCR encoding sequence is integrated at the TRAC or B2M locus. Expression of the CAR or TCR encoding sequence may be driven by the endogenous TRAC or B2M promoter.
  • the nucleic acids encoding each of the CRISPR system, the base editing system, and the RNA guided nickase may be introduced into the cell in a single transfection step.
  • the donor nucleic acid sequence may be introduced into the cell using a viral vector, for example, AAV.
  • the donor nucleic acid sequence may be introduced into the cell in a single transfection step.
  • the methods, cells, systems, and kits provided herein involve the base editing system introducing one or more genetic modifications that correct a genetic mutation, inactivate the expression of a gene, change the expression levels of a gene, or change intronexon splicing.
  • the genetic modification introduced by the base editing system may be a point mutation, optionally wherein the point mutation introduces a premature stop codon, disrupts a start codon, disrupts a splice site or corrects a genetic mutation.
  • the guide RNA sequence used in the methods provided herein may include a splice acceptor-splice donor site (SA-SD) sequence.
  • SA-SD splice acceptor-splice donor site
  • the methods, cells, systems, and kits provided herein may target different genes in the cells.
  • the base editing system may introduce genetic modifications that result in reduced expression of any one or more of TRAC, TRBC1, TRBC2, PDCD1, CD52, and B2M.
  • the methods, cells, systems, and kits provided herein may be used to provide multiple genetic modifications that occur simultaneously.
  • the methods provided herein may be used to modify any cell, in particular immune cells or human pluripotent stem cells (hPSC).
  • Immune cells may include T cells, Natural Killer (NK) cells, B cells, myeloblasts, lymphoblasts, and CD34+ hematopoietic stem and progenitor cells (HSPCs).
  • hPSC human pluripotent stem cells
  • the immune cell is a primary T cell.
  • the cell is an induced pluripotent stem cell (iPSC).
  • iPSC induced pluripotent stem cell
  • the present disclosure provides genetically modified cells obtained by the methods described herein.
  • the genetically modified cells comprise an exogenous CAR or TCR encoding sequence in the endogenous TRAC or B2M locus and at least one point mutation in 3 or more genes.
  • the genetically modified cells comprise an exogenous CAR orTCR encoding sequence in the endogenous TRAC or B2M locus and at least one point mutation in 3 or more genes selected from the group consisting of TRAC, TRBC1, TRBC2, PDCD1, CD52, and B2M, resulting in the functional knock-out of said genes.
  • the disclosure provides allogeneicT-cells obtained by the methods described herein.
  • the disclosure provides systems for genetically modifying a cell comprising i) the CRISPR system, ii) the base editing system, and iii) the RNA guided nickase, or one or more nucleic acids encoding i), ii), and iii), as described herein, or one or more expression vectors encoding i), ii), and iii), as described herein.
  • kits for genetically modifying a cell comprising i) the CRISPR system, ii) the base editing system, and iii) the RNA guided nickase , or one or more nucleic acids encoding i), ii), and iii), as described herein, or one or more expression vectors encoding i), ii), and iii), as described herein.
  • the kits may further comprise one or more components for introducing a nucleic acid or a polypeptide into a host cell.
  • the one or more components are selected from the group consisting of a viral vector, a non-integrating viral particle, an extracellular vesicle, a nanoparticle, a cell penetrating peptide, and a donor nucleic acid sequence.
  • Figures 1A and IB show an example of a schematic diagram describing the strategy of simultaneous knock-in of an exogenous gene in a desired locus (such as TRAC locus), while knocking-out that desired locus and knocking-out one or more genes by the base editing technology.
  • Figure 1A shows a schematic diagram describing the strategy of knock-out of a desired locus (such as TRAC) by double nicks introduced by nCas9-UGI-UGI with knock-in of an exogenous gene (such as CAR gene) in that locus.
  • the enzyme in the CRISPR system nCAS9- UGI-UGI
  • the donor template DNA forthe integration of the exogenous gene is delivered by a viral vector, such as an adeno- associated virus (e.g., AAV6) or delivered by other methods.
  • Figure IB shows a schematic diagram describing the strategy for base editing knockout of one or more genes (such as B2M or CD52).
  • the enzyme in the CRISPR system common RNA guided nickase
  • nCAS9-UGI-UGI is also directed to the specific gene or genes by the RNA scaffold (sgRNA-aptamer) comprising an RNA aptamer linked to the gRNA.
  • the enzyme complexed with sgRNA-aptamers recruits the deaminase component (MCP-Deaminase) of the base editing system to the site where the base conversion is required.
  • FIG. 2 shows an example of a linear schematic of the CAR construct used in certain embodiments.
  • the CAR construct comprises an anti-CD19 scFv derived from the FMC63 mouse hybridoma (FMC63 scFV), a portion of the human CD28 molecule (a hinge extracellular part, a transmembrane domain and the entire intracellular domain) (black box in the figure) and the entire domain of CD3-zeta chain.
  • FIG. 3 shows a schematic diagram of an example of a suitable CD19 CAR delivery strategy.
  • the enzyme in the CRISPR system of the present disclosure induced integration of CD19 CAR into the TRAC locus.
  • the donor construct (AAV6) contained the CAR gene flanked by homology sequences (LHA and RHA).
  • the CD19-CAR gene was integrated into the TRAC exon 1 locus. Once integrated, CAR expression was driven by the endogenous TCRa promoter while the TRAC locus was disrupted.
  • P2A the self-cleaving Porcine teschovirus 2A sequence.
  • pA bovine growth hormone PolyA sequence
  • Figures 4A, 4B, 4C, and 4D show the analysis of targeted integration of a GFP coding sequence into the TRAC locus.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus and a Cas9- UGI-UGI mRNA were co-delivered, via electroporation, into CD3 positive T-cells. This was followed by transduction with the viral vector AAV6-TRAC-GFP where the GFP coding sequence is flanked by HAs to the TRAC locus.
  • Levels of GFP integration and TCRa/p functional knock-out were determined 4-7 days post-delivery by flow cytometry and compared to the cells where no virus was transduced.
  • Control cells i.e., cells were no Cas9 and sgRNAs were electroporated
  • Figure 4A shows the level of GFP positive cells on the live population.
  • Figure 4B shows the level of TCRa/p positive cells on the live population.
  • Figure 4C shows the distribution of TCR-/GFP+, TCR+/GFP-, TCR+/GFP+ and TCR-/GFP+ cell populations on the live population.
  • Figure 4D shows viability of the cells in the above conditions.
  • Figures 5A, 5B, 5C, and 5D show the analysis of targeted integration of a CD19-CAR coding sequence into the TRAC locus.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus and a Cas9- UGI -UGI mRNA were co-delivered, via electroporation, into CD3 positive T-cells. This was followed by transduction with the viral vector AAV6-TRAC-CAR where the CD19-CAR coding sequence is flanked by HAs to the TRAC locus.
  • Levels of CAR integration and TCRa/p functional knock-out were determined 4-7 days post-delivery by flow cytometry and compared to the cells where no virus was transduced.
  • Control cells i.e., cells were no Cas9 and sgRNAs were electroporated
  • Figure 5A shows the level of CAR positive cells on live cells.
  • Figure 5B shows the level of TCRa/p positive cells on live cells.
  • Figure 5C shows the distribution of TCR-/CAR+, TCR+/CAR-, TCR+/CAR+ and TCR-/CAR+ cell populations on live cells.
  • Figure 5D shows viability of the cells in the above conditions.
  • Figures 6A, 6B, 6C, and 6D compare the base editing efficiency and functional KO generation of B2M and CD52 genes in untransduced cells and AAV6 transduced cells.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing targeting of B2M and CD52 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were co-delivered, via electroporation, into CD3 positive T-cells. This was followed by transduction with the viral vector AAV6-TRAC-CAR.
  • base editing efficiency and functional knockout generation for B2M and CD52 were evaluated by Sanger sequencing and flow cytometry, respectively.
  • Control cells i.e., cells were no Cas9 and sgRNAs were electroporated
  • Figures 6A and 6B show editing efficiency for B2M and CD52, respectively, determined by Sanger sequencing at Day 4 post-delivery.
  • Figures 6C and 6D show the percentage of B2M and CD52 positive cells, respectively, on live cells measured by flow cytometry at Day 4 post-delivery.
  • Figures 7A, 7B, and 7C show the simultaneous knock-in of the CAR gene in the TRAC locus and knock-out of TRAC, B2M, and CD52 achieved with the base editing technology of the present disclosure.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing targeting of B2M and CD52 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were co-delivered, via electroporation, into CD3 positive T-cells. This was followed by transduction with the viral vector AAV6-TRAC-CAR.
  • Figure 7A shows the level of TCRa/b positive cells on live cells measured by flow cytometry.
  • Figure 7B shows the level of CAR positive cells on live cells measured by flow cytometry.
  • Figure 1C shows flow cytometry data displaying the fraction of cells KO in one, two, three genes or unedited within the CAR positive population (Single KO (TRAC KO + B2M KO + CD52 KO), double KO (TRAC-B2M KO + TRAC-CD52 KO + B2M-CD52 KO), and triple KO (TRAC-B2M-CD52 KO)).
  • Figures 8A, 8B, 8C, 8D, 8E, and 8F show base editing efficiency by the cytidine base editing technology ( Figures 8A, 8B, 8C) and efficiency of indels formation by wt Cas9 ( Figures 8D, 8E, 8F) at the B2M, CD52 and PDCD1 loci in untransduced and AAV6 transduced samples.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing targeting of B2M, CD52 and PDCD1 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were codelivered, via electroporation, into CD3 positive T-cells.
  • FIGS. 9A, 9B, and 9C show functional KO generation of B2M, CD52 and PDCD1 genes by cytidine base editing (nCas9-UGI-UGI/Apobec) and wt Cas9 in untransduced and AAV6 transduced samples.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA- aptamers for base editing targeting of B2M, CD52, and PDCD1 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were co-delivered, via electroporation, into CD3 positive T-cells.
  • Cas9 samples have been electroporated with wild type Cas9 mRNA and regular sgRNAs. This was followed by transduction with the viral vector AAV6-TRAC-CAR.
  • functional knock-out generation for B2M, CD52 and PDCD1 genes were evaluated by flow cytometry ( Figures 9A, 9B, and 9C respectively).
  • Control samples represent samples that were mock electroporated and left untransduced or transduced with the AAV6-TRAC-CAR.
  • Figures 10A and 10B show the knock-in of the CAR in the TRAC locus and knock-out of TRAC when simultaneously knocking out three more genes.
  • a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing targeting of B2M, CD52 and PDCD1 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were co-delivered, via electroporation, into CD3 positive T-cells.
  • Cas9 samples have been electroporated with wildtype Cas9 mRNA and regular sgRNAs. This was followed by transduction with the viral vector AAV6-TRAC-CAR. Levels of CAR integration and TCRa/b functional knock-out were determined 4-7 days postdelivery by flow cytometry.
  • Figure 10A shows the level of CAR positive cells on live cells.
  • Figure 10B shows the level of TCRa/b positive cells on live cells.
  • Figure 11 shows tumor killing potential of CAR-T cells generated with the base editing technology.
  • CAR-T cells For the generation of CAR-T cells, a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing of B2M, CD52, and PDCD1 genes and nCas9- UGI-UGI and Apobecl-MCP mRNAs were co-delivered, via electroporation, into CD3 positive T-cells.
  • Cas9 samples have been electroporated with wild type Cas9 mRNA and regular sgRNAs. This was followed by transduction with the viral vector AAV6-TRAC-CAR.
  • CD3 + cells were depleted from the culture and the resulting allogeneic CAR-T cells were incubated with CD19 positive Raji cells, previously loaded with Calcein AM, for 4 hours at 1:1 and 5:1 CAR-T:Raji cells ratio. After the incubation, culture medium was collected and analyzed for fluorescence emission as measure of Raji cell lysis. The percentage of target cell killing is calculated as [(average of test condition - average of negative control condition) / (average of positive control condition - average of negative control condition)]*100 where negative control condition is Raji cells without CAR-T cells and positive control condition is Raji cells exposed to 2% triton to achieve complete lysis.
  • Figure 12 shows an example of a linear schematic of the scHLA-E trimer used in certain embodiments.
  • the scHLA-E trimer construct comprises the leader peptide of human B2M (hB2M l.p.), a HLA-E-binding peptide antigen, a 15 amino acid linker ((G4S)3), the mature human B2M (hB2M), a 20 amino acid linker ((G4S)4) and the mature HLA-E heavy chain
  • FIG. 13 shows an example of the schematic for the circular double-stranded DNA used in certain embodiments.
  • the exogenous DNA template was flanked by homology arms from the B2M locus (right homology arm, RHA and left homology arm, LHA).
  • the exogenous DNA template with homology arms was flanked (A) or not (B) on both sides by the sequence of the gRNA pair that target the B2M genomic locus (CTS or CRISPR/Cas9 target sequences or sgRNAs B2M targeting sequences) so that once the circular double-stranded DNA is co-delivered in the cells together to the CRISPR components, the donor nucleic acid sequence was released as linear DNA from the circular dsDNA following the cut by CRISPR/Cas.
  • pA bovine growth hormone PolyA sequence
  • Figure 14 shows a schematic diagram of an example of a suitable scHLA-E trimer delivery strategy.
  • the enzyme in the CRISPR system of the present disclosure induced integration of scHLA-E trimer into the B2M locus.
  • the exogenous DNA template contained the scHLA-E trimer coding sequence flanked by homology sequences (LHA and RHA).
  • the scHLA-E trimer transgene was integrated into the B2M exon 1 locus. Once integrated, scHLA-E trimer expression was driven by the endogenous B2M promoter while the B2M locus was disrupted.
  • pA bovine growth hormone PolyA sequence
  • Figures 15A, 15B, 15C, and 15D shows the analysis of targeted integration of a tGFP coding sequence into the B2M locus and base editing at the CIITA locus when delivering the exogenous DNA template as circular double-stranded DNA.
  • a pair of synthetic sgRNAs targeting exon 1 of the B2M locus, sgRNA-aptamers for base editing targeting of CIITA, nCas9- UGI-UGI, and Apobecl-MCP mRNAs and circular double-stranded DNA containing the GFP coding sequence with homology arms to the B2M gene were co-delivered, via electroporation, into iPSCs.
  • the exogenous DNA template with homology arms was flanked or not on both sides by sgRNAs B2M targeting sequences (CTS_B2M_tGFP and B2M_tGFP respectively in the graphs) (CTS stands for CRISPR/Cas9 target sequences).
  • CTS stands for CRISPR/Cas9 target sequences.
  • Levels of GFP integration were determined after 48 hours of treatment with interferon-y 5-7 days post-delivery by flow cytometry and compared to the cells that did not receive the exogenous DNA template.
  • Base editing efficiency at the CIITA locus was evaluated by Sanger sequencing at 5-7 days post-delivery. Control cells (i.e., cells where no Cas9 and sgRNAs were electroporated) were also analyzed.
  • Figure 15A shows base editing efficiency for CIITA gene determined by Sanger sequencing.
  • Figure 15B shows the level of B2M positive cells on live cells.
  • Figure 15C shows the level of GFP positive cells on live cells.
  • Figure 15D shows the distribution of GFP-/B2M+, GFP-/B2M+, GFP+/B2M+, and GFP+/B2M- cell populations on live cells.
  • Figures 16A, 16B, 16C, and 16D show the analysis of targeted integration of a tGFP coding sequence into the B2M locus and base editing at the CIITA gene when delivering the exogenous DNA template as linear double-stranded DNA.
  • a pair of synthetic sgRNAs targeting exon l of the B2M locus, sgRNA-aptamers for base editing targeting of CIITA gene, nCas9-UGI- UGI and Apobecl-MCP mRNAs and linear double-stranded DNA containing the tGFP coding sequence with homology arms to the B2M gene were co-delivered, via electroporation, into iPSCs.
  • the exogenous DNA template with homology arms was flanked or not on both sides by sgRNAs B2M targeting sequences (linear CTS_B2M_tGFP and linear B2M_tGFP respectively in the graphs) (CTS stands for CRISPR/Cas9 target sequences).
  • CTS CRISPR/Cas9 target sequences.
  • Level of GFP integration was determined after 48 hours of treatment with interferon-y 5-7 days post-delivery by flow cytometry and compared to the cells that did not receive the exogenous DNA template.
  • Base editing efficiency at the CIITA gene was evaluated by Sanger sequencing at 5-7 days post-delivery. Control cells (i.e., cells where no Cas9 and sgRNAs were electroporated) were also analyzed.
  • Figure 16A shows base editing efficiency for CIITA determined by Sanger sequencing.
  • Figure 16B shows the level of B2M positive cells on live cells.
  • Figure 16C shows the level of GFP positive cells on live cells.
  • Figure 16D shows the distribution of GFP-/B2M+, GFP-/B2M+, GFP+/B2M+, and GFP+/B2M- cell populations on live cells.
  • Figures 17A, 17B, and 17C show the analysis of targeted integration of a scHLA-E trimer coding sequence into the B2M locus and base editing at the CIITA gene when delivering the exogenous DNA template as circular double-stranded DNA.
  • a pair of synthetic sgRNAs targeting exon 1 of the B2M locus, sgRNA-aptamers for base editing targeting of CIITA, nCas9- UGI-UGI and Apobecl-MCP mRNAs and circular double-stranded DNA containing the scHLA- E trimer coding sequence with homology arms to the B2M gene were co-delivered, via electroporation, into iPSCs.
  • the exogenous DNA template with homology arms was flanked or not on both sides by sgRNAs B2M targeting sequences (linear CTS_B2M_scHLA-E_trimer and linear B2M_scHLA-E_trimer respectively in the graphs) (CTS stands for CRISPR/Cas9 target sequences).
  • CTS CRISPR/Cas9 target sequences.
  • Level of scHLA-E_trimer integration was determined after 48 hours of treatment with interferon-y 5-7 days post-delivery by flow cytometry and compared to the cells that did not receive the exogenous DNA template. Base editing efficiency at the CIITA gene was evaluated by Sanger sequencing at 5-7 days postdelivery.
  • Control cells i.e., cells where no Cas9 and sgRNAs were electroporated
  • Figure 17A shows base editing efficiency for CIITA gene determined by Sanger sequencing.
  • Figure 17B shows the level of B2M positive cells on live cells.
  • Figure 17C shows the level of scHLA-E_trimer positive cells on live cells.
  • the present disclosure relates to a new modular approach for the generation of genetically modified cells, particularly immune cells and iPSCs, enabling the simultaneous precise editing of defined nucleic acid targets (knock-out) and the introduction of an exogenous sequence of choice at a desired locus (knock-in) using a common Cas9 element.
  • the present inventors have developed a new modular methodology for the generation of genetically modified cells, particularly immune cells and iPSCs which enables the simultaneous, precise editing of defined nucleic acid targets (knock-out) and the introduction of a chosen exogenous sequence at a desired locus (knock-in) using a common CRISPR/Cas9 targeting element.
  • the methods and systems according to the present disclosure can be used to simultaneously knock-in an exogenous gene, such as a CAR or TCR, and base edit multiple genes to produce functional knock-outs.
  • the methods provided herein may target different genes in cells, in particular immune cells.
  • the base editing components used in the method can be used to introduce genetic modifications that result in a desired base change resulting in the subsequent phenotypic loss of any of the following proteins encoded by the genes TRAC, TRBC1, TRBC2, PDCD1, CD52, CIITA, NKG2A and B2M.
  • the methods may be used to edit one or both alleles of a target gene in a cell for example, an immune or iPS cell.
  • the methods provided herein may be used to edit multiple different genes (multiplex base editing), and successfully edit one or both alleles of the target genes.
  • the method may use multiple RNA scaffolds comprising different guide RNA sequences to genetically modify (base edit) multiple different genetic loci, (e.g., 2 to 10).
  • base edit multiple different genetic loci
  • the methods and systems can also be used to simultaneously knock-in an exogenous gene, such as a CAR or TCR encoding sequence, and base edit multiple genes to produce functional knock-outs.
  • the methods according to the present disclosure can be configured to produce genetically engineered cells, particularly immune cells, and stem cells and progenitor cells that can be differentiated into immune cells.
  • Immune cells include T cells, Natural Killer (NK) cells, B cells, myeloblasts, lymphoid dendritic cells, myeloid dendritic cells, macrophages, eosinophils, neutrophils, basophils and CD34+ hematopoietic stem and progenitor cells (HSPCs).
  • HSPCs can give rise to common myeloid and common lymphoid progenitors which can differentiate into T cells, dendritic cells, Natural Killer (NK) cells, B cells, myeloblasts, and other immune cells, erythroblasts, megakaryoblasts and mast cells.
  • pluripotent stem cells derived from human sources hPSCs human pluripotent stem cells
  • hESCs human embryonic stem cells
  • iPSCs induced pluripotent stem cells
  • hPSCs and for instance, IPSCs can be genetically engineered prior to being differentiated into populations of desired cell types, or the iPSCs can be differentiated into populations of desired cell types and then subsequently genetically engineered.
  • immune cells are T cells, such as CAR-T/TCR-T cells.
  • Genetically engineered T cells may be derived from primary T cells or differentiated from stem cells that are suitable as "universally acceptable" cells for therapeutic application.
  • Suitable stem cells include, but are not limited to, mammalian stem cells such as human stem cells, including, but not limited to, hematopoietic stem cells (HSC), embryonic and induced pluripotent stem cells (iPSC), derived from neural, mesenchymal, mesodermal, liver, pancreatic, muscle, and retinal stem cells.
  • Other stem cells include, but are not limited to, mammalian stem cells such as mouse stem cells, e.g., mouse embryonic stem cells.
  • the CRISPR based platform of the present disclosure can be used to integrate an exogenous DNA sequence into one or more target nucleic acid sequences of a cell, in particular a T cell or a iPSC.
  • the exogenous DNA can comprise a CAR or TCR sequence, or may code for a therapeutic protein or correct a point mutation/indel in the genome.
  • the present disclosure is based on the application of the CRISPR based platform for the generation of CAR-T cells which have one or more site directed mutations resulting in functional ablation of target genes (Figure 1).
  • the system may be used in a multiplex manner to generate CAR-T cells with advantageous properties such as prevention of immunosuppressive side effects, graft vs. host and host vs. graft disease.
  • the present disclosure may be particularly relevant for the development of allogeneic, off-the-shelf therapies.
  • antisense refers to nucleotide sequences which are complementary to a specific DNA or RNA sequence.
  • antisense strand is used in reference to a nucleic acid strand that is complementary to the "sense" strand.
  • Antisense molecules may be produced by any method, including synthesis by ligating the gene(s) of interest in a reverse orientation to a viral promoter which permits the synthesis of a complementary strand. Once introduced into a cell, this transcribed strand combines with natural sequences produced by the cell to form duplexes. These duplexes then block either the further transcription or translation.
  • Cell comprises any type of cell, prokaryotic or a eukaryotic cell, isolated or not, cultured or not, differentiated or not, and comprising also higher level organizations of cells such as tissues, organs, organisms or parts thereof.
  • Exemplary cells include, but are not limited to vertebrate cells, mammalian cells, human cells, plant cells, animal cells, invertebrate cells, nematodal cells, insect cells, stem cells, and the like.
  • “Complement” or “complementary” as used herein means Watson-Crick (e.g., A-T/U and C- G) or Hoogsteen base pairing between nucleotides or nucleotide analogs of nucleic acid molecules.
  • a full complement or fully complementary may mean 100% complementary base pairing between nucleotides or nucleotide analogs of nucleic acid molecules. Partial complementary may mean less than 100% complementarity, for example 80% complementarity.
  • “Complementary”, as used herein, means that a first sequence is at least 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more nucleotides, or that the two sequences hybridize under stringent hybridization conditions.
  • Delivery vector or “ delivery vectors” is directed to any delivery vector which can be used in the present invention to put into cell contact or deliver inside cells or subcellular compartments agents/chemicals and molecules (proteins or nucleic acids) needed in the present invention. It includes, but is not limited to, transducing vectors, liposomal delivery vectors, plasmid delivery vectors, viral delivery vectors, bacterial delivery vectors, drug delivery vectors, chemical carriers, polymeric carriers, lipoplexes, polyplexes, dendrimers, microbubbles (ultrasound contrast agents), nanoparticles, emulsions or other appropriate transfer vectors. These delivery vectors allow delivery of molecules, chemicals, macromolecules (genes, nucleic acid(s), proteins), or other vectors such as plasmids and T- DNA. These delivery vectors are molecule carriers.
  • Donor nucleic acid is defined here as any nucleic acid supplied to an organism or receptacle to be inserted or recombined wholly or partially into the target sequence either by DNA repair mechanisms, homologous recombination (HR), or by non-homologous end- joining (NHEJ).
  • Gene as used herein may be a natural (e.g., genomic) or synthetic gene comprising transcriptional and/or translational regulatory sequences and/or a coding region and/or nontranslated sequences (e.g., introns, 5'- and 3 '-untranslated sequences).
  • the coding region of a gene may be a nucleotide sequence coding for an amino acid sequence or a functional RNA, such as tRNA, rRNA, catalytic RNA, siRNA, miRNA or antisense RNA.
  • a gene may also be an mRNA or cDNA corresponding to the coding regions (e.g., exons and miRNA) optionally comprising 5'- or 3 '-untranslated sequences linked thereto.
  • a gene may also be an amplified nucleic acid molecule produced in vitro comprising all or a part of the coding region and/or 5'- or 3 '-untranslated sequences linked thereto.
  • Gene targeting is used herein as any genetic technique that induces a permanent change to a target nucleic acid sequence including deletion, insertion, mutation, and replacement of nucleotides in a target sequence.
  • Target nucleic acid or “target sequence” as used herein is any desired predetermined nucleic acid sequence to be acted upon, including but not limited to coding or non-coding sequences, genes, exons or introns, regulatory sequences, intergenic sequences, synthetic sequences and intracellular parasite sequences.
  • the target nucleic acid resides within a target cell, tissue, organ or organism.
  • the target nucleic acid comprises a target site, which includes one or more nucleotides within the target sequence, which are modified to any extent by the methods and compositions disclosed herein.
  • the target site may comprise one nucleotide.
  • the target site may comprise 1-300 nucleotides.
  • the target site may comprise about 1-100 nucleotides.
  • the target site may comprise about 1-50 nucleotides.
  • the target site may comprise about 1-35 nucleotides.
  • a target nucleic acid may include more than one target site, that may be identical or different,
  • Genomic or genetic modification is used herein as any modification generated in a genome or a chromosome or extra-chromosomal DNA or organellar DNA of an organism as the result of gene targeting or gene-functional modification.
  • “Mutant” as used herein refers to a sequence in which at least a portion of the functionality of the sequence has been lost, for example, changes to the sequence in a promoter or enhancer region will affect at least partially the expression of a coding sequence in an organism.
  • the term “mutation,” refers to any change in a sequence in a nucleic acid sequence that may arise such as from a deletion, addition, substitution, or rearrangement. The mutation may also affect one or more steps that the sequence is involved in. For example, a change in a DNA sequence may lead to the synthesis of an altered mRNA and/or a protein that is active, partially active or inactive.
  • exogenous sequence refers to a sequence that is not normally present in the genome of a specific cell, but can be introduced into a cell by the method of the disclosure.
  • % indel refers to the percentage of insertions or deletions of several nucleotides in the target sequence of the genome.
  • variant refers to a polynucleotide or polypeptide having a sequence substantially similar to a reference polynucleotide or polypeptide.
  • a variant can have deletions, substitutions, additions of one or more nucleotides at the 5' end, 3' end, and/or one or more internal sites in comparison to the reference polynucleotide. Similarities and/or differences in sequences between a variant and the reference polynucleotide can be detected using conventional techniques known in the art, for example, polymerase chain reaction (PCR) and hybridization techniques.
  • PCR polymerase chain reaction
  • Variant polynucleotides also include synthetically derived polynucleotides, such as those generated, for example, by using site-directed mutagenesis.
  • a variant of a polynucleotide including, but not limited to, a DNA, can have at least about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 86%, about 87%, about 88% about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more sequence identity to the reference polynucleotide as determined by sequence alignment programs known by skilled artisans.
  • a variant in the case of a polypeptide, can have deletions, substitutions, additions of one or more amino acids in comparison to the reference polypeptide. Similarities and/or differences in sequences between a variant and the reference polypeptide can be detected using conventional techniques known in the art, for example, Western blot.
  • a variant of a polypeptide can have at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 86%, about 87%, about 88% about 89%, about 90%, about 91 %, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more sequence identity to the reference polypeptide as determined by sequence alignment programs known by skilled artisans.
  • Exogenous sequences to be integrated e.g., CAR or scHLA-E
  • the donor nucleic acid sequence comprising the exogenous sequence is a sequence encoding a protein of interest.
  • the donor nucleic acid sequence is selected from the group consisting of CAR nucleic acid construct, TCR nucleic acid, and scHLA-E.
  • the "chimeric antigen receptor” (CAR) is sometimes called a “chimeric receptor,” a “T-body,” or a “chimeric immune receptor” (CIR).
  • chimeric antigen receptor refers to an artificially constructed hybrid protein or polypeptide comprising extracellular antigen binding domains of an antibody (e.g., single chain variable fragment (scFv)) operably linked to a transmembrane domain and at least one intracellular domain.
  • an antibody e.g., single chain variable fragment (scFv)
  • the antigen binding domain of a CAR has specificity for a particular antigen expressed on the surface of a target cell of interest.
  • T cells can be engineered to express CAR specific for CD19 on B-cell lymphoma.
  • First generation CAR constructs comprise a binding domain (a scFv antibody), a hinge region, a transmembrane domain and an intracellular signalling domain (Liu et al., 2019, Frontiers in Immunology, the entire contents of which are incorporated herein by reference).
  • YescartaTM (Axicabtagene ciloleucel) was approved for use in 2017 for the treatment of large B-cell lymphoma that has failed conventional treatment and was one of the first therapies of this type. It employs a binding domain that targets CD19, a protein expressed by normal B cells, B cell leukemias, and lymphomas.
  • the second generation CAR (Kochenderfer et al.
  • J Immunotherapy used in this therapy consists of an anti-CD19 scFv derived from the FMC63 mouse hybridoma (Nicholson et al 1997, Mol Immunology, the entire contents of which are incorporated herein by reference), a portion of the human CD28 molecule (a hinge extracellular part, a transmembrane domain and the entire intracellular domain) and the entire domain of CD3- zeta chain.
  • the exogenous sequence integrated into the target nucleic acid sequence comprises a CAR encoding sequence.
  • the CAR construct comprises a binding domain, a hinge region, a transmembrane domain and an intracellular signaling domain.
  • the CAR construct used in some of the embodiments of the present disclosure is depicted in Figure 2.
  • the binding domain is a scFv antibody.
  • the scFv antibody comprises an anti-CD19 scFv derived from the FMC63 mouse hybridoma (FMC63 scFV).
  • the binding domain is an anti-CD19 scFv.
  • the binding domain is an anti-B-cell maturation antigen (BCMA) scFv.
  • the CAR construct comprises a portion of the human CD28 molecule (for example, a hinge extracellular part, a transmembrane domain, and the entire intracellular domain).
  • the CAR construct comprises the entire domain of CD3-zeta chain.
  • the exogenous sequence integrated into the target nucleic acid sequence comprises a CAR encoding sequence comprising a FMC63 scFV, a CD28 hinge extracellular part, a transmembrane domain and the entire intracellular domain and a CD3Z chain.
  • the intracellular signaling domain effects signaling inside the cell via phosphorylation of CD3- zeta following antigen binding.
  • CD3-zeta's cytoplasmic domain is routinely used as the main CAR endodomain component.
  • Other co-stimulatory molecules in addition to CD3 signaling are also required for T cell activation and so CAR receptors typically include co-stimulatory molecules including CD28, CD27, CD134 (0x40) and CD137 (4-1BB).
  • first, second, third, and fourth generation CAR are described in Subklewe M et al, Transfusion Medicine and Hemotherapy. 2019 Feb;46(l):15-24, the contents of which are incorporated herein by reference in their entireties.
  • the exogenous sequence is a CAR sequence of first, second, third or fourth generation CAR.
  • the intracellular signaling domain is the entire intracellular domain of CD3-zeta chain.
  • the intracellular signaling domain additionally comprises 41BB-CD3-zeta chain or CD28-CD3-zeta chain.
  • the hinge region is typically a small structural spacer that sits between the binding domain and the cells outer membrane. Ideally, it enhances the flexibility of the scFv to reduce spacial constraints between the CAR and its target antigen.
  • Design of the hinge region has been described in the art and typically is based on sequences which are membrane proximal regions from other immune molecules such as IgG, CD8 and CD28 (Chandran, SS et al. 2019, Immunological Reviews, 290 (1):127-147 and Qin L, et al. 2017, Journal of Hematological Oncology. 10 (1) 68, the contents of which are incorporated herein by reference in their entireties).
  • the transmembrane domain is a structural component consisting of a hydrophobic alpha helix that spans the cell membrane. It functions by anchoring the CAR to the plasma membrane thereby bridging the hinge region and binding domain with the intracellular signaling domain.
  • the CD28 transmembrane domain is typically used in CARs and is known to result in a stably expressed receptor.
  • the CAR nucleic acid construct comprises a binding domain that targets CD19 and an intracellular signaling domain which comprises the entire intracellular domain of CD3-zeta chain and a portion of a CD28 co-stimulatory molecule.
  • CAR T cell genetic modification may occur via viral-based gene transfer methods or by non- viral methods such as DNA-based transposons, CRISPR/Cas9 technology or direct transfer of in vitro transcribed mRNA by electroporation.
  • Gene transfer technologies either integrate at specific loci of interest or they are randomly, or pseudo-randomly, integrated into the genome.
  • the random or pseudo-random genome integration gene transfer methods include, but are not limited to, methods such as transposons, lentivirus, retrovirus, and adenovirus. Locus specific integration technology offers the advantage of being more predictable, with the possibility to replace regions of the genome and precisely insert exogenous genetic material.
  • the CAR nucleic acid is integrated into the genome or a chromosome or extra-chromosomal DNA or organellar DNA of an organism as the result of gene targeting.
  • the donor nucleic acid sequence is a TCR gene.
  • the donor nucleic acid sequence is a scHLA-E trimer.
  • the scHLA-E trimer is a chimeric protein that comprises the following elements: (a) the leader peptide of B2M, (b) VMAPRTLIL (a HLA-E-binding peptide SEQ ID NO: 1), (c) a 15 amino acid linker (G4S)3, (d) a mature human B2M, (e) a 20 amino acid linker (G4S)4 and (f) a mature HLA-E heavy chain.
  • scHLA-E trimer nucleic acid sequence comprises the sequence set forth in accession number AY289236.1 (SEQ ID NO: 2):
  • the AY289236.1 sequence is modified in specific nucleotides to avoid recognition by the sgRNA pair used to target the endogenous locus.
  • the transgene is also flanked by homology arms from the locus where it is integrated (e.g., B2M homology arms), surrounding the CRISPR/Cas9 cleavage site.
  • B2M homology arms e.g., B2M homology arms
  • the resulting sequence aimed to integrate in the B2M locus is referred to as scHLA-E_trimer B2M-900HAs (SEQ ID NO: 3):
  • the scHLA-E trimer transgene flanked by homology arms is flanked by sgRNA targeting sequences for the desired locus, so that once co-delivered in the cells together to the CRISPR components, the donor nucleic acid sequence is released as linear DNA from the plasmid following cut by CRISPR/Cas.
  • the scHLA-E trimer transgene flanked by homology arms is flanked by the sequence of the gRNA pair that target the B2M locus. The resulting sequence is referred to as scHLA-E_trimer_B2M-900HAs_CTS (SEQ ID NO: 4 ):
  • HLA proteins are antigen-presenting receptors present on the cell membrane that interact with the T-cell receptor (TCR) to mediate immunosurveillance by the adaptive immune system.
  • HLA proteins encoded at the major histocompatibility 1 (MHC-1) locus form heterodimeric receptors with beta2-microglobulin (B2M) and present intracellular antigens at the surface of most cells.
  • MHC-1 locus MHC-1 locus
  • B2M beta2-microglobulin
  • the antigens presented by HLA class 1 proteins are recognized as foreign by the host CD8+ cytotoxic T cell via the TCR complex leading to the direct cytolytic attack and loss of the infused cells.
  • TCRs also directly engage and recognize HLA receptors themselves, identifying them as either "self” or "non-self”.
  • Class 2 HLAs encoded at the MHC-2 locus form heterodimers composed of alpha and beta chains that present extracellular antigens and are constitutively expressed by specialized antigen-presenting cells such as macrophages and dendritic cells, and by other cell types including microglia, endothelial, and epithelial cells in response to inflammatory cytokines.
  • specialized antigen-presenting cells such as macrophages and dendritic cells
  • Other cell types including microglia, endothelial, and epithelial cells in response to inflammatory cytokines.
  • Foreign extracellular antigens presented by class 2 HLAs activate the CD4/ TCR- mediated response of CD4+ helper T cells that recruit cytotoxic T cells and NK cells through secreted chemokines.
  • Recognition of allogeneic grafts as nonself, either through mismatched HLA proteins or through foreign antigen presentation leads to host T cell alloreactivity and consequent rejection of the graft through inflammation and cytolytic attack.
  • HLA matching is, therefore, essential for successful cell and tissue grafting.
  • the genes encoding HLA-A, HLA-B, HLA-C, and HLA-DQ are some of the most highly polymorphic coding loci in the human population, therefore HLA matching of allografts is a major challenge to overcome for both conventional cell and tissue donation and for the application of iPSC- derived cellular therapeutics.
  • a single-chain HLA-E trimer comprising HLA-E, B2M and an antigen peptide can be knocked-in in the B2M locus.
  • this approach depletion of B2M and forced expression of HLA-E will confer resistance to NK-mediated killing, while the cells will not be recognized as foreign by the host CD8+ T cells.
  • the present disclosure generates base editing knock-out of CIITA gene and simultaneous knock-in of the scHLA-E trimer sequence in the B2M locus with B2M gene knock-out.
  • a common method for locus specific integration is using CRISPR-Cas technologies to target and cleave the site of interest in the presence of an exogenous DNA sequence that has complementary regions to the genome and the region that is desired to be altered.
  • the DNA sequence for insertion by CRISPR-Cas technology can be supplied by multiple methods, including that of transduction with non-integrating adeno-associated virus (AAV) or supplying a DNA template.
  • AAV adeno-associated virus
  • the exogenous template for insertion into the genome by CRISPR-Cas requires the insert sequence to be flanked by specific regions being cleaved by the CRISPR- Cas technology, which are commonly known as "homology-arms".
  • exogenous DNA templates or exogenous sequences are supplied as single-stranded and double-stranded DNAs.
  • the DNA can then be either in an open linear structure where the 5' and 3' ends of the DNA are exposed or can be a closed where there are no exposed ends of the DNA.
  • the closed DNA molecules includes, but are not limited to, a circular dsDNA, a linear dsDNA, plasmids, minicircles, circularised ssDNA, and doggybone DNA (dbDNA).
  • the exogenous sequence is delivered as a linear dsDNA.
  • the exogenous sequence is delivered in a circular dsDNA.
  • the exogenous DNA is flanked by homology arms from the locus to be inserted. In some embodiments, if a circular dsDNA is used for the delivery of the exogenous sequence, the exogenous DNA flanked by homology arms from the locus to be inserted is flanked on both sides by sgRNAs targeting sequences that target the locus to be inserted.
  • the exogenous sequence is introduced into the cell using a viral vector.
  • the viral vector is selected from the group consisting of lentivirus, retrovirus, adeno-associated virus (AAV) and adenovirus.
  • AAVs have different serotypes, which have different preferences for tissue types. Examples of AAV that can be used in the present disclosure include, but are not limited to, AAV1, AAV2, AAV5, AAV6, AAV8, AAV9, AAV-DJ, AAV-DJ9.
  • the viral vector is AAV serotype 6 (AAV6).
  • AAV6 vectors have been shown to result in improved transduction efficiency in the field of CAR-T 1 cell generation (Wang et al, Nucleic Acid Research 2016, the contents of which are incorporated herein by reference).
  • AAV is a small icosahedral non-enveloped virus of 25nm in diameter containing a single stranded DNA genome and in recent years has become an essential therapeutic gene delivery tool. It is used frequently to deliver genetic material into target cells in vivo to treat disease and has been used extensively in clinical application in academia and industry (Hamieh, M et al, Nature 2019. 568 (7750) 112-116, the contents of which are incorporated herein by reference).
  • the method of exogenous gene delivery of the exogenous sequence (e.g., CAR, TCR or scHLA-E) sequence into the cell is by AAV6.
  • the method of exogenous gene delivery of a CAR or TCR or scHLA-E sequence into the cell is by using a plasmid or linear DNA.
  • the site of integration in a specific locus will disrupt the endogenous gene (e.g., TRAC, B2M or CISH), whilst inserting an exogenous DNA fragment that comprises a transgene (e.g., CAR, TCR or scHLA-E genes).
  • the exogenous sequence is inserted under the control of the endogenous promoter. In other embodiments, the exogenous sequence is controlled by its own promoter.
  • the method or system of the disclosure comprises the integration of more than one exogenous sequence.
  • multiple CARs exogenous sequences are integrated, these multiple CARs recognize different antigens to generate, for example, dual targeting CAR-T cells to limit antigen escape during treatment.
  • a Cas protein, a CRISPR-associated protein, or a CRISPR protein refers to a protein of or derived from a CRISPR-Cas type I, type II, or type III system, which has an RNA-guided DNA-binding domain.
  • Non-limiting examples of suitable CRISPR/Cas proteins include, but are not limited to, Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8al, Cas8a2, Cas8b, Cas8c, Cas9, CaslO, CaslOd, CasF, CasG, CasH, Csyl, Csy2, Csy3, Csel (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlO, Csxl6, Csa
  • Non-limiting examples of RNA guided nickases capable of interacting with the first and second sgRNAs of the CRISPR system and with the RNA scaffold of the base editing system include, but are not limited to, Cas3, Cas4, Cas5, Cas5e (or CasD), Cas6, Cas6e, Cas6f, Cas7, Cas8al, Cas8a2, Cas8b, Cas8c, Cas9, CaslO, CaslOd, CasF, CasG, CasH, Csyl, Csy2, Csy3, Csel (or CasA), Cse2 (or CasB), Cse3 (or CasE), Cse4 (or CasC), Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2,
  • the sequence-targeting component of the methods and systems provided herein typically utilizes a Cas protein of CRISPR/Cas systems from bacterial species as the RNA guided nickase.
  • the Cas protein is from a type II CRISPR system. See, e.g., Makarova, K.S., Wolf, Y.L, Iranzo, J. et al. Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants. Nat Rev Microbiol 18, 67-83 (2020), the entire content of which is incorporated herein by reference.
  • the Cas protein is derived from a type II CRISPR-Cas system.
  • the Cas protein is or is derived from a Cas9 protein.
  • the RNA guided nickase is a Cas9 protein, is derived from a Cas9 protein or comprises a mutation compared to the WT Cas9 protein.
  • the Cas9 protein can be from Streptococcus pyogenes, Streptococcus thermophilus, Streptococcus sp., Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacillus pseudomycoides, Bacillus selenitireducens, Exiguobacterium sibiricum, Lactobacillus delbrueckii, Lactobacillus salivarius, Microscilla marina, Burkholderiales bacterium, Polaromonas naphthalenivorans, Polaromonas sp., Crocosphaera watsonii, Cyanothece sp., Microcystis aeruginosa, Synechococcus s
  • the Cas protein or the RNA guided nickase may be obtained as a recombinant fusion polypeptide by methods known in the art, e.g., as a fusion protein with glutathione-s- transferase (GST), 6x-His epitope tag, or M13 Gene 3 protein and expressed in a suitable host cell.
  • GST glutathione-s- transferase
  • M13 Gene 3 protein M13 Gene 3 protein
  • the Cas protein or the RNA guided nickase can be chemically synthesized (see, e.g., Creighton, "Proteins: Structures and Molecular Principles," W.H. Freeman & Co., NY, 1983), or produced by recombinant DNA technology as described herein.
  • skilled artisans may consult Frederick M.
  • the RNA guided nickase is the nuclease defective nickase nCas9 from 5. pyogenes D10A mutant (Cas9(D10A)). In another embodiment, the RNA guided nickase is the nuclease defective nickase nCas9 H840A mutant. In another embodiment, the RNA guided nickase is a nuclease protein that only breaks one DNA strand. In some embodiments, the RNA guided nickase comprises the sequence set forth in SEQ ID NO: 19. In some embodiments, the RNA guided nickase consists of the sequence set forth in SEQ ID NO: 19.
  • RNA guided nickase is a functional variant or fragment of the Cas protein or synthetic Cas substitutes described herein.
  • the functional variant or fragment shares at least about 70% (e.g., at least about 80%, 90%, 95%, 96%, 97%, 98%, 99%) homology with the Cas protein or synthetic Cas substitute.
  • the above-described sequence-targeting component comprises a fusion between (a) a RNA guided nickase, and (b) a uracil DNA glycosylase (UNG) inhibitor peptide (UGI).
  • the RNA guided nickase comprises a Cas protein, e.g., Cas9 protein, fused to one or more UGI.
  • Such fusion proteins may exhibit an increased nucleic acid editing efficiency as compared to fusion proteins not comprising an UGI domain.
  • the UGI comprises a wild type UGI sequence or one having the following amino acid sequence: Protein accession number: sp
  • the UGI peptide comprises the following amino acid sequence: MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVI QDSNGENKIKML (SEQ ID NO: 5).
  • the UGI peptide consists of the sequence set forth in SEQ ID NO: 5.
  • the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment.
  • a UGI comprises a fragment of the amino acid sequence set forth above.
  • a UGI comprises an amino acid sequence homologous to the amino acid sequence set forth above or an amino acid sequence homologous to a fragment of the amino acid sequence set forth in the UGI sequence above.
  • proteins comprising UGI or fragments of UGI or homologs of UGI or UGI fragments are referred to as "UGI variants.”
  • a UGI variant shares homology to UGI, or a fragment thereof.
  • a UGI variant comprises at least about 70% sequence identity (e.g., at least about 80%, 90%, 95%, 96%, 97%, 98%, 99%) compared to a wild type UGI, which may be the UGI sequence as set forth above (SEQ ID NO: 5).
  • UGI protein and nucleotide sequences are provided herein and additional suitable UGI sequences are known to those in the art, and include, for example, those published in Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol. Chem. 264:1163-1171(1989); Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol. Chem. 272:21408-21419(1997); Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor.
  • EcUDG Escherichia coli uracil
  • the RNA guided nickase is the nuclease defective nickase nCas9 from 5. pyogenes (D10A mutant) fused to a UGI. In another embodiment, the RNA guided nickase is the nuclease defective nickase nCas9 from 5. pyogenes (D10A mutant) fused to two UGI peptides (referred herein to as nCas9-UGI-UGI). nCas9-UGI-UGI - SEQ ID NO 195:
  • the RNA guided nickase capable of interacting with the first and second gRNAs of the CRISPR system and with the RNA scaffold of the base editing system is a single molecule, i.e., the same nickase molecule is interacting with the first and second gRNAs of the CRISPR system and interacting with the RNA scaffold of the base editing system. Therefore, the RNA guided nickase is simultaneously cleaving one strand of a first target nucleic acid sequence and base editing a second/third/fourth target nucleic acid sequence.
  • the CRISPR-Cas system has been used to perform genome-editing in cells of various organisms.
  • the specificity of this system is dictated by base pairing between a target DNA and a custom-designed guide RNA (gRNA).
  • gRNA guide RNA
  • the CRISPR system of the present disclosure can be used to integrate a donor nucleic acid sequence comprising an exogenous DNA sequence into a target nucleic acid sequence of a cell, in particular into an immune cell, a T cell or an iPSC.
  • the exogenous DNA comprises a CAR, a TCR or a scHLA-E trimer encoding sequence, or may code for a therapeutic protein or correct a point mutation/indel in the genome.
  • the first target nucleic acid sequence represents the CAR integration site into the host cell, in particular, into a T cell or iPSC.
  • the CAR gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using a viral vector.
  • CAR gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using an AAV.
  • the AAV is AAV6.
  • the first target nucleic acid sequence represents the TCR integration site into the host cell, in particular, into a T cell or iPSC.
  • the CAR gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using a viral vector.
  • TCR gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using an AAV.
  • the AAV is AAV6.
  • the first target nucleic acid sequence represents the scHLA-E trimer integration site into the host cell, in particular, into a T cell or iPSC.
  • the scHLA-E trimer gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using a viral vector.
  • scHLA-E trimer gene to be integrated into the target nucleic acid sequence of the cell may be delivered into the host cell using an AAV.
  • the AAV is AAV6.
  • crRNA provides targeting specificity and includes a region that is complementary and capable of hybridization to a pre-selected target site of interest (the guide RNA sequence).
  • tracrRNA is the region of the gRNA that interacts with the Cas protein.
  • the crRNA comprises from about 10 nucleotides to more than about 25 nucleotides.
  • the region of base pairing between the guide sequence and the corresponding target site sequence is about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more than 25 nucleotides in length.
  • the crRNA is about 17-20 nucleotides in length, such as 20 nucleotides.
  • the tracrRNA component of the gRNA specifically binds to the Cas protein and guides the Cas protein to the target DNA or RNA sequence.
  • the tracrRNA is from Strep pyogenes.
  • the tracrRNA comprises from about 10 nucleotides to about 50 nucleotides. In some embodiments, tracrRNA is about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, 30, 35, 40, 45 or more than 50 nucleotides in length.
  • a suitable target nucleic acid has a 3' protospacer adjacent motif (PAM) site/sequence.
  • PAM 3' protospacer adjacent motif
  • Each target sequence and its corresponding PAM site/sequence are referred to herein as a Cas-targeted site.
  • the Type II CRISPR system one of the most well characterized systems, needs only Cas9 protein and a crRNA complementary to a target sequence to affect target cleavage.
  • the type II CRISPR system of 5.
  • pyogenes uses target sites having N12-20NGG, where NGG represents the PAM site from 5.
  • pyogenes, and N12-20 represents the 12-20 nucleotides directly 5' to the PAM site.
  • PAM site sequences from other species of bacteria include, but are not limited, NGGNG, NNNNGATT, NNAGAA, NNAGAAW, and NAAAAC. See, e.g., US 20140273233, WO 2013176772, Cong et al., (2012), Science 339 (6121): 819-823, Jinek et al., (2012), Science 337 (6096): 816-821, Mali et al., (2013), Science 339 (6121): 823-826, Gasiunas et al., (2012), Proc Natl Acad Sci U S A.
  • the PAM sites when two or more nickase cleavage sites are required, are designed such that they are 20 to 200bp apart. In other embodiments, when two or more nickase cleavage sites are required, the PAM sites are designed such that they are 40 and 70 bp apart. In some embodiments, when two or more nickase cleavage sites are required, the PAM sites are outwards (known as a "PAM-out" configuration).
  • the target nucleic acid is ssDNA, dsDNA, ssRNA or dsRNA. In some embodiments, the target nucleic acid is either of the two strands on a double stranded nucleic acid in a host cell. In some embodiments, the target nucleic acid is a single stranded nucleic acid. Examples of target nucleic acids include, but are not necessarily limited to, genomic DNA, a host cell chromosome, mitochondrial DNA or a stably maintained plasmid.
  • the present method can be practiced on other target nucleic acids present in a host cell, such as non-stable plasmid DNA, viral DNA, and phagemid DNA, as long as there is a Cas-targeted site, regardless of the nature of the host cell dsDNA.
  • the present method can be practiced on RNAs too.
  • the gRNA is a hybrid RNA molecule where the above-described crRNA is fused to a tracrRNA to mimic the natural crRNA:tracrRNA duplex .
  • an active portion of a tracrRNA retains the ability to form a complex with a Cas protein, such as Cas9 or dCas9 or nCas9. See, e.g., WO2014144592.
  • Methods for generating crRNA-tracrRNA hybrid RNAs also known as single guide RNAs or sgRNAs are known in the art.
  • the crRNA and tracrRNA are provided as a single gRNA (sgRNA)
  • the two components are typically linked together via a tetra loop (also called repeat: anti-repeat).
  • a tetra loop also called repeat: anti-repeat.
  • the gRNA used in the methods herein may be introduced into the cell as a chemically synthesised RNA molecule.
  • the gRNA may comprise one or more modifications as described herein below.
  • the guide RNA sequence may be chemically modified to include a 2'-(9-methyl phosphorthioate) modification on at least one 5' nucleotide and/or at least one 3' nucleotide of the guide RNA sequence.
  • the gRNA may be synthesized as a single molecule (sgRNA), or synthesized or expressed as two separate components, optionally, wherein the first component comprises (a) the crRNA and the second component comprises (b) the tracrRNA. The two components may then be allowed to hybridize prior to introduction into the cell.
  • the method employs a first gRNA and a second gRNA. These function simultaneously to guide the RNA guided nickase to opposite strands of the target DNA site to effect a (staggered) DSB. Therefore, design of the first and second gRNA dictates the precise location for the DSB. The location of the DSB and the design of the homology arms of the donor nucleic acid influence the precise location of the integration of the donor sequence.
  • the disclosure also provides a method for making multiple genetic modifications to a cell, the method comprising introducing into the cell and/or expressing in the cell: a) a CRISPR system for integrating an exogenous sequence at a first target nucleic acid sequence, the CRISPR system comprising a first sgRNA and a second sgRNA that are complementary to opposite strands of the first target nucleic acid sequence; and a donor nucleic acid sequence comprising the exogenous sequence; and a base editing system for introducing a genetic modification at a second target nucleic acid sequence, the base editing system comprising: an RNA scaffold comprising a guide RNA sequence that is complementary to the second target nucleic acid sequence and, a recruiting RNA motif; and an effector fusion protein comprising an RNA binding domain capable of binding to the recruiting RNA motif and an effector domain comprising a base modifying enzyme; and a single RNA guided nickase capable of interacting with the first and second sgRNAs of the CRISPR system and
  • the first gRNA and second gRNA bind opposite strands of the first target nucleic acid sequence.
  • the exogenous sequence is integrated at the TRAC locus. In another embodiment, the CAR encoding sequence is integrated at the TRAC locus. In an embodiment, the exogenous sequence is integrated at the B2M locus. In another embodiment, the CAR encoding sequence is integrated at the B2M locus. In an embodiment, the exogenous sequence is integrated at the PDCD1 locus. In another embodiment, the CAR encoding sequence is integrated at the PDCD1 locus. In an embodiment, the exogenous sequence is integrated at the TRBC2 locus. In another embodiment, the CAR encoding sequence is integrated at the TRBC2 locus. In an embodiment, the exogenous sequence is integrated at the TRBC1 locus.
  • the CAR encoding sequence is integrated at the TRBC1 locus. In an embodiment, the exogenous sequence is integrated at the TRBC1/2 locus. In another embodiment, the CAR encoding sequence is integrated at the TRBC1/2 locus. In an embodiment, the exogenous sequence is integrated at the CD52 locus. In another embodiment, the CAR encoding sequence is integrated at the CD52 locus. In an embodiment, the exogenous sequence is integrated at the CISH locus. In another embodiment, the CAR encoding sequence is integrated at the CISH locus.
  • the exogenous sequence expression is driven by the endogenous promoter of the locus where it is integrated. In another embodiment, the exogenous sequence expression is driven by its own promoter. In another embodiment, CAR expression is driven by the TRAC endogenous promoter. In another embodiment, CAR expression is driven by its own promoter.
  • FIG 3 shows a schematic diagram of an example of a suitable CD19 CAR delivery strategy.
  • the CAR encoding sequence was inserted in exon 1 of the TRAC locus in frame with the upstream TRAC locus and before the transmembrane domain of the T cell receptor alpha chain variable region.
  • the CAR encoding sequence in the AAV6 vector was flanked by left homology arm (LHA) and right homology arm (RHA) to the sequence left and right to the double nicks in the TRAC exon 1.
  • LHA left homology arm
  • RHA right homology arm
  • a 2A peptide derived from porcine teschovirus-1 (P2A) was introduced to avoid interference from the T cell receptor alpha chain variable region.
  • 2A peptides typically, 2A peptides have approximately 20 amino acids and "self cleavage" occurs between the last two amino acids, glycine (G) and proline (P).
  • the present disclosure may further comprise additional modular components comprising multiple base editing systems. If more than one module is used, then each guide RNA sequence is complementary to a unique sequence allowing editing of more than one nucleic acid site.
  • the modular system provides the tools for the targeting of multiple loci (e.g., 2 to 10) such that more than one gene can be knocked out simultaneously or sequentially.
  • each module comprises a base editing system for introducing a genetic modification at a second or further target nucleic acid sequence, i.e., multiple base editing systems capable of binding to different target nucleic acid sequences to genetically modify multiple different genetic loci.
  • Each module present in the modular system comprises: a) an RNA scaffold comprising i) a guide RNA sequence complementary to the second or further target nucleic acid sequence, ii) a recruiting RNA motif, and b) an effector fusion protein comprising i) an RNA binding domain capable of binding to the recruiting RNA motif,
  • the second or further target nucleic acid sequences are distinct from the first target nucleic acid sequence.
  • the RNA scaffold may additionally comprise a tracrRNA that is capable of binding to the RNA guided nickase.
  • the data provided herein compares the system of the present disclosure with another base editing system (referred to herein as the alternative fusion Cytidine Base Editing (CBE) system), which employs direct fusion of a Cas protein to an effector protein (e.g., a deaminase).
  • CBE Cytidine Base Editing
  • the modular design of the system of the present disclosure allows for flexible system engineering. Modules are interchangeable and many combinations of different modules can be achieved by simply swapping the nucleotide sequence of the RNA scaffold. Recruitment of an effector by direct fusion or direct interaction with the protein component of the sequence-targeting unit, on the other hand, always requires a re-engineering of a new fusion protein, which is technically more difficult with a less predictable outcome.
  • the system described herein is based on the base editing (BE) method which was developed to exploit the DNA targeting ability of Cas9 devoid of double strand cleavage activity, combined with the DNA editing capabilities of a deaminase, such as APOBEC-1, an enzyme member of the APOBEC family of DNA/RNA cytidine deaminases.
  • a deaminase such as APOBEC-1
  • APOBEC-1 an enzyme member of the APOBEC family of DNA/RNA cytidine deaminases.
  • the BE system utilizes a CRISPR/Cas9 complex devoid of double strand cleavage activity as a DNA targeting machinery, in which the mutant Cas9 serves as an anchor to recruit cytidine or adenine deaminase through a direct protein-protein fusion.
  • the RNA component (scaffold) of the CRISPR/Cas9 complex serves as an anchor for effector recruitment by including an RNA motif (aptamer) into the RNA molecule.
  • the RNA aptamer recruits an effector, e.g., a base editing enzyme, fused to the RNA aptamer ligand.
  • the methods provided herein may target different genes in the immune cells to, for example, introduce a genetic modification that results in the desired base change and/or subsequent phenotypic loss of a protein.
  • genes that can be targeted include, but are not limited to, any of the following genes TRAC, TRBC1, TRBC2, PDCD1, CD52, CISH, CIITA, and B2M.
  • the methods may be used to edit one or both alleles of a target gene in a cell.
  • the methods provided herein may be used to edit multiple different genes (multiplex base editing), and successfully edit one or both alleles of the target genes.
  • the method may use multiple RNA scaffolds comprising different guide RNA sequences to genetically modify (base edit) multiple different genetic loci, (e.g., 2 to 10).
  • base edit multiple different genetic loci
  • the system can be used to base edit multiple genes to produce functional knock-outs, for example, by the introduction of point mutations to one or both alleles of the target genes, and at the same time, introducing an exogenous sequence in the cell.
  • the RNA scaffold can be either a single RNA molecule or be part of a complex of multiple RNA molecules.
  • the crRNA, the optional tracrRNA, and recruiting RNA motif can be three segments of one, long single RNA molecule.
  • one, two or three of them can be on separate molecules.
  • the three components can be linked together to form the scaffold via covalent or non-covalent linkage or binding, including, e.g., Watson- Crick base-pairing.
  • the RNA scaffold comprises two separate RNA molecules.
  • the first RNA molecule can comprise the programmable crRNA and a region that can form a stem duplex structure with a complementary region.
  • the second RNA molecule can comprise the complementary region in addition to the tracrRNA and the RNA motif. Via this stem duplex structure, the first and second RNA molecules form an RNA scaffold of this disclosure.
  • the first and second RNA molecules each comprise a sequence (of about 6 to about 20 nucleotides) that base pairs to the other sequence.
  • the tracrRNA and the RNA motif can also be on different RNA molecule and be brought together with another stem duplex structure.
  • the crRNA and the tracrRNA are part of a single RNA molecule.
  • RNAs and related scaffolds of this disclosure can be made by various methods known in the art including cell-based expression, in vitro transcription, and chemical synthesis.
  • the ability to chemically synthesize relatively long RNAs (as long as 200 mers or more) using TC- RNA chemistry allows one to produce RNAs with special features that outperform those enabled by the basic four ribonucleotides (A, C, G, and U).
  • the Cas protein-guide RNA scaffold complexes can be made with recombinant technology using a host cell system or an in vitro translation-transcription system known in the art. Details of such systems and technology can be found in e.g., WO2014144761 WO2014144592, WO2013176772, US20140273226, and US20140273233, the contents of which are incorporated herein by reference in their entireties.
  • the complexes can be isolated or purified, at least to some extent, from cellular material of a cell or an in vitro translationtranscription system in which they are produced.
  • RNA scaffold-mediated effector protein recruitment More specifically, the platform takes advantage of various recruiting RNA motif/RNA binding protein binding pairs.
  • an RNA scaffold is designed such that an RNA motif (e.g., MS2 operator motif), which specifically binds to an RNA binding protein (e.g., MS2 coat protein, MCP), is linked to the gRNA-CRISPR scaffold.
  • an RNA scaffold component of the platform disclosed herein is a designed RNA molecule, which comprises a guide RNA sequence, comprising the crRNA for specific DNA/RNA sequence recognition, and optionally a CRISPR RNA motif (tracrRNA) for Cas protein binding.
  • the RNA scaffold component also comprises the RNA motif for effector recruitment (also referred to as the recruiting RNA motif).
  • the recruiting RNA motif is an RNA aptamer and the RNA binding protein is an aptamer binding protein.
  • the recruiting RNA motif is the MS2 phage operator stemloop and the RNA binding protein is the MS2 Coat Protein (MCP).
  • RNA motif and their binding partners may also be utilized.
  • Further examples of recruiting RNA motif/RNA binding protein pairs can be found in, e.g., Pumpens P, et al.; Intervirology; 2016; 59:74-110, and Tars K. (2020); Biocommunication of Phages, 261-292; the contents of which are incorporated herein by reference in their entireties.
  • GCGGA-3' (SEQ ID NO:6) b. Ku heterodimer MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSV YISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSD YSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKP GGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKP PPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLK KHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCR
  • MS2 phage operator stem loop / MS2 coat protein a.
  • PCP PP7 coat protein
  • the RNA motif may be positioned at various positions of the RNA scaffold.
  • the RNA motif is positioned at the 3' end of the guide RNA, in particular, at the 3' end of the tracrRNA (if present), at the tetra loop of the gRNA, at stem loop 2 of the tracrRNA (if present) or at the stem loop 3 of the tracrRNA (if present).
  • the MS2 aptamer is positioned at the 3' end of the gRNA.
  • the MS2 aptamer may be positioned at the 3' end of the tracrRNA (if present), at the tetra loop of the gRNA, at stem loop 2 of the tracrRNA (if present) and at the stem loop 3 of the tracrRNA (if present).
  • the positioning of the RNA motif (such as the MS2 aptamer) is crucial due to the steric hindrance that can result from the bulky loops.
  • the MS2 aptamer is at the 3' end of the gRNA.
  • the positioning of the MS2 aptamer at the 3' end of the gRNA is therefore reducing steric hindrance with other bulky loops of the RNA scaffold.
  • the recruiting RNA motif may be linked to the guide RNA (in particular to the tracrRNA, if present) via a linker sequence.
  • the linker sequence may be 2, 3, 4, 5, 6, 7 or more than 7 nucleotides.
  • the linker sequence provides flexibility to the RNA scaffold.
  • the linker sequence may be a GC rich sequence.
  • Modifications may be made to the recruiting RNA motif.
  • the modification to the MS2 aptamer is a substitution of the Adenine to 2-aminopurine (2-AP) at position 10.
  • the substitution induces conformational changes resulting in greater affinity.
  • the nucleic acid-targeting motif or guide RNA sequence comprising a crRNA and optionally a CRISPR RNA motif (tracrRNA), can be provided as a single guide RNA (sgRNA).
  • sgRNA single guide RNA
  • the two components are linked via a "repeat: anti-repeat” or a "tetra loop.”
  • the repeat: anti-repeat upper stem can be extended to increase the flexibility, proper folding and stability of the loop.
  • the tetra loop can be extended by 2, 3, 4, 5, 6, 7 bp or more than 7 bp at
  • the RNA scaffold may have one or more of the above mentioned modifications.
  • the one or more modification can be on the different components of the RNA scaffold, e.g., extension of tetra loop of the sgRNA and extension of the RNA motif, or can be on the same component of the RNA scaffold, e.g., extension of the RNA motif and substitution of the RNA motif's nucleotides.
  • the modifications may be two or more, three or more, four or more, or five or more nucleotides.
  • the modification may be the extension of the RNA motif and/or may the substitution of one or more nucleotides.
  • RNA motif is the MS2 aptamer.
  • the MS2 aptamer specifically binds to the MS2 bacteriophage coat protein (MCP).
  • MCP MS2 bacteriophage coat protein
  • the MS2 aptamer is a wild-type MS2 aptamer (SEQ ID NO:11), a mutant MS2 aptamer or variants thereof.
  • the MS2 aptamer comprises a C-5 and/or F-5 mutation.
  • the MS2 aptamer can be a single-copy (i.e., one MS2 aptamer) or a double-copy (i.e., two MS2 aptamers).
  • the RNA motif is a single-copy RNA motif. In other embodiments, the RNA motif comprises more than one copy.
  • the effector fusion protein comprises two components, a RNA binding domain capable of binding to the recruiting RNA motif and an effector domain comprising a base modifying enzyme.
  • the base modifying enzyme has an activity selected from the group consisting of a cytosine deamination activity, an adenosine deamination activity, a DNA methyl transferase activity and a demethylase activity.
  • cytosine and cytidine are used interchangeably with respect to deaminases and deamination activity, as are the terms adenine and adenosine.
  • the RNA-binding domain is not the RNA binding domain of a Cas protein (such as Cas9) or its variant (such as dCas9 or nCas9).
  • a Cas protein such as Cas9
  • dCas9 or nCas9 examples of suitable RNA- binding domains are listed in Table 2, including the RNA motif-RNA binding pairs. Due to the flexibility of the RNA scaffold mediated recruitment, a functional monomer of RNA binding domains, as well as dimers, tetramers, or oligomers could be formed relatively easily near the target DNA or RNA sequence. Effector domain
  • the effector domain or effector protein comprises a base modifying enzyme which has cytidine deaminase activity e.g., AID, APOBEC1, APOBEC3G) or adenosine deaminase activity (e.g., ADA and tadA) or DNA methyl transferase activity (e.g., Dnmtl and Dnmt3a) or demethylase activity (e.g., Tetl and Tet2).
  • the effector is modified to induce or improve DNA editing activity, for example, in the case of ADA and tadA which require modification to edit DNA.
  • the base modifying enzyme is a wild type or genetically engineered version of AID, CDA, APOBEC1, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D, APOBEC3F, or other APOBEC family enzymes.
  • the base modifying enzyme is a cytosine deaminase, such as APOBEC1.
  • the base modifying enzyme is APOBEC1 and comprises the sequence set forth below in SEQ ID NO:17:
  • the effector domain is linked to an RNA binding domain to create the effector fusion protein.
  • This may be by chemical modification, peptide linkers, chemical linkers, covalent or non- covalent bonds, or protein fusion or by any means known to one skilled in the art.
  • the joining can be permanent or reversible. See, for example, U.S. Pat. Nos. 4625014, 5057301, and 5514363, US Application Nos. 20150182596 and 20100063258, and WO2012142515, the contents of which are incorporated herein in their entirety by reference.
  • the effector domain is linked to the RNA binding domain by a peptide linker.
  • the effector fusion protein can comprise other domains, apart from the RNA binding domain and an effector domain.
  • the effector fusion protein can comprise at least one nuclear localization signal (NLS).
  • NLS nuclear localization signal
  • a NLS comprises a stretch of basic amino acids. Nuclear localization signals are known in the art (see, e.g., Lange et al., J. Biol. Chem., 2007, 282:5101-5105, the entire contents of which are incorporated herein by reference).
  • the NLS can be located at the N-terminus, the C-terminal, or in an internal location of the fusion protein.
  • the fusion protein can comprise at least one cell-penetrating domain to facilitate delivery of the protein into a target cell.
  • the cell-penetrating domain can be a cell-penetrating peptide sequence.
  • Various cell-penetrating peptide sequences are known in the art and examples include that of the HIV-1 TAT protein, TLM of the human HBV, Pep-1, VP22, and a polyarginine peptide sequence.
  • the fusion protein can comprise at least one marker domain.
  • marker domains include fluorescent proteins, purification tags, and epitope tags.
  • the marker domain can be a fluorescent protein.
  • the marker domain can be a purification tag and/or an epitope tag. See, e.g., US 20140273233, the entire contents of which are incorporated herein by reference.
  • AID is used as the effector domain, and as an example to illustrate how the system works.
  • AID is a cytidine deaminase that can catalyze the reaction of deamination of cytidine in the context of DNA or RNA.
  • AID changes a C base to a U base. In dividing cells, this could lead to a C to T point mutation.
  • the change of C to U could trigger cellular DNA repair pathways, mainly excision repair pathway, which will remove the mismatching U-G base-pair, and replace it with a T-A, A-T, C-G, or G-C pair.
  • a point mutation would be generated at the target C-G site.
  • APOBEC is used as the effector domain, and as an example to illustrate how the system works.
  • APOBEC is also a cytidine deaminase that can catalyze the reaction of deamination of cytidine in the context of DNA or RNA.
  • an adenosine deaminase was used as the effector domain, and as an example to illustrate how the system works.
  • An adenosine deaminase can catalyze the reaction of deamination of adenosine in the context of DNA or RNA.
  • an underlying disease causing genetic mutation is an A-T base pair at a specific site
  • Other effector enzymes are expected to generate other types of changes in base-pairing.
  • a non-exhaustive list of examples of base modifying enzymes is detailed in Table 3.
  • the effector proteins provided herein can include functional variants, such as fragments of the effector proteins and proteins homologous to the fragments or proteins, for example, as described in Table 3.
  • a functional variant is considered to share homology to an effector protein, or a fragment thereof, for example, of at least about 70% (e.g., at least about 80%, 90%, 95%, 96%, 97%, 98%, 99%), compared to the wild-type effector protein.
  • APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 1.
  • AP0BEC3A apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A
  • APOBEC3B apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B
  • APOBEC3C apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C
  • APOBEC3D apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D
  • APOBEC3F apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
  • APOBEC3G apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
  • APOBEC3H apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
  • ADA adenosine deaminase
  • ADAR1 adenosine deaminase acting on RNA 1
  • ADAR2 adenosine deaminase acting on RNA 2
  • ADAR3 adenosine deaminase acting on RNA 3
  • CDA Cytidine deaminase
  • Dnmt3a DNA (cytosine-5-)-methyltransferase 3 alpha
  • Dnmt3b DNA (cytosine-5-)-methyltransferase 3 beta tadA: tRNA adenosine deaminase
  • Tetl ten-eleven translocation 1
  • Tet2 ten-eleven translocation 2
  • Tdg thymine DNA glycosylase
  • an RNA scaffold mediated recruitment system was constructed using (i) Cas9, dCas9 or nCas9 from 5.
  • pyogenes as the RNA guided nickase, (ii) an RNA scaffold containing a guide RNA sequence, a tracrRNA, and a recruiting RNA motif comprising a MS2 phage operator stem-loop, and (iii) an effector fusion protein containing a human AID fused to MS2 phage operator stem-loop binding protein (MCP).
  • MCP MS2 phage operator stem-loop binding protein
  • RNA scaffold expression cassette (5. pyogenes), containing a 20-nucleotide programmable sequence, a tracrRNA motif, and an MS2 phage operator stem loop motif (SEQ ID NO: 21):
  • RNA scaffold containing one MS2 loop (lxMS2). Shown below is an RNA scaffold containing two MS2 loops (2xMS2), where MS2 scaffolds are underlined:
  • Effector fusion protein comprising an Effector AID -MCP fusion (SEQ ID NO: 23):
  • Effector fusion protein comprising an Effector Apobecl-MCP fusion (SEQ ID NO: 24):
  • the effector fusion protein can also be obtained as a recombinant polypeptide.
  • Techniques for making recombinant polypeptides are known in the art. See e.g., Creighton, "Proteins: Structures and Molecular Principles," W.H. Freeman & Co., NY, 1983); Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, 2003; and Sambrook et al., Molecular Cloning, A Laboratory Manual,” Cold Spring Harbor Press, Cold Spring Harbor, NY, 2001, the entire contents of which are incorporated herein by reference).
  • the above three components of the platform/system disclosed herein can be expressed using one, two or three expression vectors.
  • the system can be programmed to target virtually any DNA or RNA sequence.
  • similar second generation base editors could be generated by varying the modular components of the system, including any suitable Cas orthologs, deaminase orthologs, and other DNA modification enzymes.
  • the second target nucleic acid sequence is B2M and/or CD52.
  • the method comprises two modules, one targeting the B2M gene and the other targeting CD52.
  • the present disclosure may also be used to (i) knock-out or modify genes that are involved in fratricide of immune cells, such as T cells and NK cells, or (ii) genes that alert the immune system of a subject or animal that a foreign cell, particle or molecule has entered a subject or animal, such as B2M gene or (iii) genes encoding proteins that are current therapeutic targets used to compromise or boost an immune response, such as for example, CD52 and PDCD1 genes.
  • CAR chimeric antigen receptor
  • the present disclosure may be used to generate knock-out of genes, modify or increase the expression of a single gene or multiple genes in various types of cells or cell lines, including but not limited to cells from mammals.
  • the present systems and methods may be applicable to multiplex genetic modification, which, as is known in the art, involves genetically modifying multiple genes or multiple targets within the same gene.
  • the technology may be used for many applications, including but not limited to, knock-out of genes to prevent graft versus host disease by making non-host cells non-immunogenic to the host or prevent host vs. graft disease by making non-host cells resistant to attacks by the host. These approaches are also relevant to generating allogeneic (off-the-shelf) or autologous (patient specific) cell-based therapeutics.
  • Such knock-out genes include, but are not limited to, the T Cell Receptor (TRAC, TRBC1, TRBC2, TRDC, TRGC1, TRGC2), the major histocompatibility complex (MHC class I and class II) genes, including B2M, co-receptors (HLA- F, HLA-G), genes involved in the innate immune response (MICA, MICB, HCP5, STING, DDX41 and Toll-like-receptors (TLRs)), inflammation (NKBBiL, LTA, TNF, LTB, LST1, NCR3, AIF1), heat shock proteins (HSPA1L, HSPA1A, HSPA1B), complement cascade, regulatory receptors (NOTCH family members), antigen processing (TAP, HLA-DM, HLA-DO), increased potency or persistence (such as PD-1, CTLA-4 and other members of the B7 family of checkpoint proteins), genes involved in immunosuppressive immune cells (such as FOXP3 and Interleukin (IL)-10), genes involved
  • One application of the method and system provided herein is to engineer HLA alleles of bone marrow cells or bone marrow cells differentiated from iPS cells to increase haplotype match.
  • the engineered cells can be used for bone marrow transplantation for treating leukemia.
  • Another application is to engineer the negative regulatory element of fetal hemoglobin gene in hematopoietic stem cells for treating sickle cell anemia and beta-thalassemia.
  • the negative regulatory element will be mutated and the expression of fetal hemoglobin gene is reactivated in hematopoietic stem cells, compensating the functional loss due to mutations in adult alpha or beta hemoglobin genes.
  • a further application is to engineer iPS cells for generating allogeneic therapeutic cells for various degenerative diseases including Parkinson's disease (neuronal cell loss), Type 1 diabetes (pancreatic beta cell loss).
  • Other exemplary applications include engineering HIV infection resistant T- Cells by inactivating CCR5 gene and other genes encoding receptors required for HIV entering cells; removing a premature stop codon in the DIVID gene to re-establish expression of dystrophin; and the correction of cancer driver mutations, such as p53 Y163C.
  • the guide RNA molecules can be delivered to the target cell via various methods, without limitation, listed below. Firstly, direct introduction of synthetic RNA molecules (whether sgRNA, crRNA, or tracrRNA and modifications thereof) to the cell of interest by electroporation, nucleofection, transfection, via nanoparticles, via viral mediated RNA delivery, via non-viral mediated delivery, via extracellular vesicles (for example exosome and microvesicles), via eukaryotic cell transfer (for example by recombinant yeast ) and other methods that can package the RNA molecules and can be delivered to the target viable cell without changes to the genomic landscape.
  • synthetic RNA molecules whether sgRNA, crRNA, or tracrRNA and modifications thereof
  • RNA molecules include non-integrative transient transfer of DNA polynucleotides that includes the relevant sequence for the protein recruitment so that the molecule can be transcribed into the target guide RNA molecule, this includes, without limitation, DNA-only vehicles (for example, plasmids, MiniCircles, MiniVectors, MiniStrings, Protelomerase generated DNA molecules (for example Doggybones), artificial chromosome (for example HAC), cosmids), via DNA vehicles by nanoparticles, extracellular vesicles (for example exosome and microvesicles), via eukaryotic cell transfer (for example by recombinant yeast), transient viral transfer by AAV, non-integrating viral particles (for example lentivirus and retrovirus based systems), cell penetrating peptides and other technology that can mediate the introduction of DNA into a cell without direct integration into the genomic landscape.
  • DNA-only vehicles for example, plasmids, MiniCircles, MiniVectors, Mini
  • Another method for the introduction of the guide RNA include the use of integrative gene transfer technology for stable introduction of the machinery for guide RNA transcription into the genome of the target cells, this can be controlled via constitutive or promoter inducible systems to attenuate the guide RNA expression and this can also be designed so that the system can be removed after the utility has been met (for example, introducing a Cre-Lox recombination system), such technology for stable gene transfer includes, but not limited to, integrating viral particles (for example lentivirus, adenovirus, and retrovirus based systems), transposase mediate transfer (for example Sleeping Beauty and Piggybac), exploitation of the non-homologous repair pathways introduced by DNA breaks (for example utilising CRISPR and TALEN) technology and a surrogate DNA molecule, and other technology that encourages integration of the target DNA into a cell of interest.
  • integrative gene transfer technology for stable introduction of the machinery for guide RNA transcription into the genome of the target cells, this can be controlled via constitutive or promoter in
  • the method for delivering the effector fusion protein and the CRISPR targeting components are often mediated by the same technology. In some situations, there are advantages to mediate the delivery of the effector fusion protein by one method and the CRISPR targeting components via another method.
  • the applicable methods, and not limited to, are listed below. Firstly, the direct introduction of mRNA and Protein molecules directly to the cell of interest by electroporation, nucleofection, transfection, via nanoparticles, via viral mediated packaged delivery, extracellular vesicles (for example exosome and microvesicles), via eukaryotic cell transfer (for example by recombinant yeast), and other methods that can package the macromolecules and can be delivered to the target viable cell without integration into genomic landscape.
  • Other methods for the introduction of the coding sequence of the effector fusion protein include non-integrative transient transfer of DNA polynucleotides that includes the relevant sequence for the protein recruitment so that the molecule or molecules can be transcribed and translated into the target protein molecule.
  • DNA-only vehicles for example, plasmids, MiniCircles, MiniVectors, MiniStrings, Protelomerase generated DNA molecules (for example Doggybones), artificial chromosome (for example HAC), cosmids
  • DNA vehicles by nanoparticles, extracellular vesicles (for example exosome and microvesicles), via eukaryotic cell transfer (for example by recombinant yeast), transient viral transfer by AAV, non-integrating viral particles (for example lentivirus and retrovirus based systems), and other technology that can mediate the introduction of DNA into a cell without direct integration into the genomic landscape.
  • DNA-only vehicles for example, plasmids, MiniCircles, MiniVectors, MiniStrings, Protelomerase generated DNA molecules (for example Doggybones), artificial chromosome (for example HAC), cosmids
  • DNA vehicles by nanoparticles, extracellular vesicles (for example exosome and microvesicles),
  • Another method for the introduction of the effector fusion protein (such as a deaminase) and/or the CRISPR targeting components includes the use of integrative gene transfer technology for stable introduction of the machinery for transcription and translation into the genome of the target cells, this can be controlled via constitutive or inducible promoter systems to attenuate the molecule, or molecules expression, and this can also be designed so that the system can be removed after the utility has been met (for example, introducing a Cre-Lox recombination system), such technology for stable gene transfer includes, but not limited to, integrating viral particles (for example lentivirus, adenovirus and retrovirus based systems), transposase mediate transfer (for example Sleeping Beauty and Piggybac), exploitation of the non- homologous repair pathways introduced by DNA breaks (for example utilising CRISPR and TALEN) technology and a surrogate DNA molecule, and other technology that encourages integration of the target DNA into a cell of interest.
  • integrative gene transfer technology for stable introduction of the machinery for
  • the nucleic acids encoding the RNA scaffold, the effector fusion protein or the nickase can be cloned into one or more intermediate expression vectors for introducing into prokaryotic or eukaryotic cells for replication and/or transcription.
  • Intermediate vectors are typically prokaryotic vectors, e.g., plasmids, or shuttle vectors, or insect vectors, for storage or manipulation of the nucleic acid encoding the RNA scaffold or protein components for production of the RNA scaffold or protein components.
  • the nucleic acids can also be cloned into one or more expression vectors, for administration to a plant cell, animal cell.
  • the nucleic acids can be cloned into one or more expression vectors, for administration to a mammalian cell or a human cell, fungal cell, bacterial cell, or protozoan cell. Accordingly, the present disclosure provides nucleic acids that encode any of the RNA scaffold or proteins mentioned above. In some embodiments, the nucleic acids are isolated and/or purified.
  • the present disclosure also provides recombinant constructs or vectors having sequences encoding one or more of the RNA scaffold or proteins described above.
  • the constructs include a vector, such as a plasmid or a viral vector, into which a nucleic acid sequence of the disclosure has been inserted, in a forward or reverse orientation.
  • the construct further includes regulatory sequences, including a promoter, operably linked to the sequence.
  • suitable vectors and promoters are known to those of skill in the art, and are commercially available.
  • Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are also described in, e.g., Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press), the entire contents of which are incorporated herein by reference.
  • the method of the disclosure further comprises maintaining the cells under appropriate conditions such that the guide RNA guides the effector protein to the targeted site in the target sequence, and the effector domain modifies the target sequence.
  • the cell can be maintained under conditions appropriate for cell growth and/or maintenance. Suitable cell culture conditions are well known in the art and are described, for example, in Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or "Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 3rd edition, 2001), Santiago et al. (2008) PNAS 105:5809-5814; Moehle et al.
  • Cells useful for the methods provided herein can be freshly isolated primary cells or obtained from a frozen aliquot of a primary cell culture.
  • cells are electroporated for uptake of gRNAs and the base editing fusion protein.
  • electroporation conditions for some assays e.g., for T cells
  • electroporated T cells are allowed to recover in a cell culture medium and then cultured in a T cell expansion medium. In some cases, electroporated cells are allowed to recover in the cell culture medium for about 5 to about 30 minutes (e.g., about 5, 10, 15, 20, 25, 30 minutes).
  • the recovery cell culture medium is free of an antibiotic or other selection agent.
  • the T cell expansion medium is complete CTS OpTmizer T-cell Expansion or Immunocult-XT Expansion medium.
  • Example 1 Integration of a promoter-less transgene in the TRAC locus of T cells with expression of the transgene driven by the TRAC endogenous promoter and destruction of TCRa/b expression
  • Pan T lymphocytes were used to prove the utility of the CRISPR system targeting module (nCas9-UGI-UGI) for specific integration in the TRAC locus of a promoter-less transgene.
  • the Pan T cells were activated utilizing anti-CD3 and anti-CD28 antibodies and then electroporated with mRNA for nCas9-UGI-UGI component and two sgRNAs targeting opposite strands in the first exon of the TRAC gene.
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognised by the sgRNAs resulted in a staggered double strand break (DSB).
  • DSB staggered double strand break
  • cells were transduced with an AAV6 virus used to promote integration of a GFP coding sequence in frame with the TRAC gene. Integration of the transgene by homologous directed repair (HDR) or non-homologous end joining (NHEJ) induced by the DSB at this locus resulted in efficient knock-out of the TRAC gene and disruption of the TCRa/b complex. After transduction, the cells were incubated for 4-7 days and cells were checked for GFP expression and surface knock-out of TCRa/b by flow cytometry.
  • HDR homologous directed repair
  • NHEJ non-homologous end joining
  • Knock-in guide RNAs To disrupt the TRAC locus and place the GFP under its transcriptional control, we designed sgRNA pairs targeting the 5' end of the first exon of TRAC and an AAV vector with homology arms to the target locus and encoding a self-cleaving P2A peptide followed by the GFP cDNA.
  • the sgRNAs to target the TRAC locus were designed following the rule of the PAM-out configuration (PAM sites faced the outside of the target region), with the cleavage sites 40- 70 bp apart.
  • the knock-in guides were designed without the lxMS2 aptamer.
  • the sgRNAs were synthesized by Horizon Discovery (formerly Dharmacon).
  • Synthetic sgRNA sequences (SEQ ID NO: 29) mN*mN*NNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • N (spacer) any of G, U, A or C
  • RNA molecules were custom synthesized by TriLink Biotechnologies utilizing the modified nucleotides pseudouridine and 5-Methyl-Cytosine.
  • the AAV plasmids were custom synthesized by GenScript. Based on a pAAV backbone, we designed the pAAV-TRAC-GFP containing in order: 0.9 kb left homology arm of genomic TRAC flanking the 5' gRNA targeting sequence, a GSG (gly-ser-gly) peptide followed by a selfcleaving P2A peptide in frame with the first exon of TRAC, a GFP coding sequence, the bovine growth hormone polyA signal (bGHpA) and 0.9kb right homology arm of the genomic TRAC flanking the 3' gRNA targeting sequence.
  • bGHpA bovine growth hormone polyA signal
  • CD3 + T cells were either isolated from whole blood or outsourced from Hemacare. Briefly, peripheral blood mononuclear cells were isolated by density gradient centrifugation (SepMate PBMC isolation tube, STEMCELL Technologies) and T lymphocytes were then purified using the EasySepTM Human T Cell Isolation Kit (STEMCELL Technologies).
  • T cells were electroporated using the Neon Electroporator (Thermofisher). Neon Electroporator conditions were 1600v/10ms/3 pulses with a lOpI tip with 250k cells, combined total of mRNA amount of l-5pg and 2pM each of the targeting gRNAs. Post-electroporation cells were transferred to Immunocult XT media with lOOU/ml IL- 2, lOOU/ml IL-7 and lOOU/ml IL-15 (STEMCELL Technologies) and cultured at 37 ?C and 5% CO; for 48-72 hours.
  • Recombinant AAV6 particles were generated by Vigene Biosciences. Where applicable, recombinant AAV6 particles carrying the GFP coding sequence were added to the culture 2 to 4 h after electroporation, at the lxlO 6 genome copies (GC) per cell. Subsequently, edited cells were cultured at 37 2 C and 5% CO 2 for 96 hours , maintaining the density of ⁇ 1 x 10 6 cells per ml.
  • T cell identity and QC were confirmed by CD3 antibody staining (Biolegend). T cell activation was confirmed by CD25 staining. GFP positive cells were measured by flow cytometry at 7 days post electroporation/transduction. Levels of TCR-/GFP+ cells were assessed at 7 days post electroporation/transduction by flow cytometry using a TCRa/p antibody (Biolegend). Any phenotype data was reported as percentage of viable cells, as ascertained by viability dye staining.
  • Example 2 Integration of a CAR gene in the TRAC locus of T cells with expression of the transgene driven by the TRAC endogenous promoter and destruction of TCR expression
  • Pan T lymphocytes were used to prove the utility of the enzyme in the CRISPR system, the targeting module, (nCas9-UGI-UGI) for specific integration in the TRAC locus of a CAR gene.
  • the Pan T cells were activated utilizing anti-CD3 and anti- CD28 antibodies and then electroporated with mRNA for nCas9-UGI-UGI component and two sgRNAs targeting opposite strands in the first exon of the TRAC gene.
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognised by the sgRNAs resulted in a staggered double strand break (DSB).
  • DSB staggered double strand break
  • cells were transduced with an AAV6 virus used to promote integration of a CAR coding sequence in frame with the TRAC gene. Integration of the transgene by homologous directed repair (HDR) or non-homologous end joining (NHEJ) induced by the DSB at this locus resulted in efficient knock-out of the TRAC gene and disruption of the TCR complex. After transduction, the cells were incubated for 4-7 days and cells were checked for CAR expression and surface knock-out of TCR by flow cytometry.
  • HDR homologous directed repair
  • NHEJ non-homologous end joining
  • sgRNA pairs targeting the 5' end of the first exon of TRAC and an AAV vector with homology arms to the target locus and encoding a self-cleaving P2A peptide followed by the CAR cDNA.
  • the sgRNAs to target the TRAC locus were designed following the rule of the PAM-out configuration (PAM sites faced the outside of the target region), with the cleavage sites 40-70 bp apart.
  • the knock-in guides were designed without the lxMS2 aptamer.
  • the sgRNAs were synthesised by Horizon Discovery (formerly Dharmacon).
  • Synthetic sgRNA sequences (SEQ ID NO: 29) mN*mN*NNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • RNA molecules were custom synthesized by TriLink Biotechnologies utilizing the modified nucleotides pseudouridine and 5-Methyl-Cytosine.
  • the AAV plasmids were custom synthesized by GenScript. Based on a pAAV backbone we designed the pAAV-TRAC-1928Z_CAR and the pAAV-TRAC-GFP containing in order: 0.9 kb left homology arm of genomic TRAC flanking the 5' gRNA targeting sequence, a GSG (gly-ser-gly) peptide followed by a self-cleaving P2A peptide in frame with the first exon of TRAC, the 1928z CAR used in YescartaTM therapy or a GFP coding sequence, the bovine growth hormone polyA signal (bGHpA) and 0.9kb right homology arm of the genomic TRAC flanking the 3' gRNA targeting sequence.
  • bGHpA bovine growth hormone polyA signal
  • CD19-CAR (Kochenderfer et al 2009, J Immunotherapy) comprised a single chain variable fragment scFV specific for the human CD19 derived from the FMC63 mouse hybridoma (Nicholson et al 1997, Mol Immunology), a portion of the human CD28 molecule (a hinge extracellular part, a transmembrane domain and the entire intracellular domain) and the entire domain of CD3- zeta chain ( Figure 2).
  • CD3 + T cells were either isolated from whole blood or outsourced from Hemacare. Briefly, peripheral blood mononuclear cells were isolated by density gradient centrifugation (SepMate PBMC isolation tube, STEMCELL Technologies) and T lymphocytes were then purified using the EasySepTM Human T Cell Isolation Kit (STEMCELL Technologies).
  • T cells were electroporated using the Neon Electroporator (Thermofisher). Neon Electroporator conditions were 1600v/10ms/3 pulses with a lOpI tip with 250k cells, combined total of mRNA amount of l-5pg and 2pM each of the targeting gRNAs. Post-electroporation, cells were transferred to Immunocult XT media with lOOU/ml IL-2, lOOU/ml IL-7 and lOOU/ml IL-15 (STEMCELL Technologies) and cultured at 37 -C and 5% CO2 for 48-72 hours.
  • Thermofisher Neon Electroporator conditions were 1600v/10ms/3 pulses with a lOpI tip with 250k cells, combined total of mRNA amount of l-5pg and 2pM each of the targeting gRNAs.
  • Post-electroporation cells were transferred to Immunocult XT media with lOOU/ml IL-2,
  • Recombinant AAV6 particles were generated by Vigene Biosciences. Where applicable, recombinant AAV6 particles carrying the CD19-CAR coding sequence were added to the culture 2 to 4 h after electroporation, at the lxlO 6 GC per cell. Subsequently, edited cells were cultured at 37 2 C and 5% CO2 for 96 hours , maintaining the density of ⁇ 1 x 10 6 cells per ml.
  • T cell identity and QC was confirmed by CD3 antibody staining (Biolegend). T cell activation was confirmed by CD25 staining.
  • CD19-CAR positive cells were detected by flow cytometry using an Anti-FMC63 scFv Antibody (AcroBiosystem) at 96 hours post electroporation/transduction. Levels of TCR-/CAR+ cells were assessed by combined staining with a TCRa/b antibody (Biolegend). Any phenotype data was reported as percentage of viable cells, as ascertained by viability dye staining.
  • primary human Pan T lymphocytes were used to prove the utility of the CRISPR-aptamer based gene editing system for specific integration in the TRAC locus of a CAR gene and simultaneous knock-out of TRAC, B2M and CD52 genes by the cytosine base editing system.
  • base editing guided knock-out was achieved through recruitment of the deaminase on the target site by a sgRNA-aptamer.
  • CAR integration and consequent TRAC knock-out was achieved through the same enzyme used for the CRISPR system, combined with sgRNAs.
  • the Pan T cells were activated utilizing anti-CD3 and anti-CD28 antibodies and then electroporated with the following components: (i) mRNA encoding the deaminase-MCP, (ii) mRNA encoding nCas9-UGI-UGI protein, (iii) two sgRNAs targeting opposite strands in the first exon of the TRAC gene and (iv) sgRNA-aptamer for two different genes.
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognized by the sgRNAs resulted in staggered double strand breaks (DSB).
  • cells were transduced with an AAV6 virus used to promote integration of a CAR coding sequence in frame with the TRAC gene by homologous directed repair (HDR). Integration of the transgene by HDR or non- homologous end joining (NHEJ) induced by the DSB at this locus resulted in efficient knockout of the TRAC gene and disruption of the TCR complex.
  • HDR homologous directed repair
  • NHEJ non- homologous end joining
  • the cells were incubated for 4-7 days and were then checked for CAR expression and surface knock-out of TCR, B2M and CD52 by flow cytometry. Base conversion was measured by targeted PCR amplification and Sanger sequencing. Multi-antibody panel was used to ascertain multiplex KO level within the CAR+ population by flow cytometry.
  • Synthetic lxMS2 sgRNA sequence (SEQ ID NO: 32) mN*mN*NNNNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCGCACAUGAGGAUCACCCAUGU GCUUUUmU*mU*U
  • Table 4 crRNA sequences in the single-guide RNAs (sgRNAs) for TRAC, TRBC1, TRBC2, PDCD1, CD52 and B2M genes.
  • sgRNAs single-guide RNAs
  • Table 4 An example list of guide designs for guide RNA sequences that can create a functional knock-out using the base editing technology exemplified. The list includes guides specific to the introduction of a premature stop codon and splice disruption sites, which were generated by an in-house proprietary software.
  • sgRNA pairs targeting the 5' end of the first exon of TRAC and an AAV vector with homology arms to the target locus and encoding a self-cleaving P2A peptide followed by the CAR cDNA.
  • the sgRNAs to target the TRAC locus were designed following the rule of the PAM-out configuration (PAM sites faced the outside of the target region), with the cleavage sites 40-70 bp apart.
  • the knock-in guides were designed without the lxMS2 aptamer.
  • the sgRNAs were synthesized by Horizon Discovery (formerly Dharmacon).
  • Synthetic sgRNA sequences (SEQ ID NO: 29) mN*mN*NNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • RNA molecules were custom synthesized by TriLink Biotechnologies utilising the modified nucleotides pseudouridine and 5-Methyl-Cytosine.
  • the AAV plasmids were custom synthesized by GenScript. Based on a pAAV backbone we designed the pAAV-TRAC-1928Z_CAR containing in order: 0.9 kb left homology arm of genomic TRAC flanking the 5' gRNA targeting sequence, a GSG (gly-ser-gly) peptide followed by a self-cleaving P2A peptide in frame with the first exon of TRAC, the 1928z CAR used in YescartaTM therapy, the bovine growth hormone polyA signal (bGHpA) and 0.9kb right homology arm of the genomic TRAC flanking the 3' gRNA targeting sequence.
  • the CD19-CAR Kerat et al.
  • J Immunotherapy comprised a single chain variable fragment scFV specific for the human CD19 derived from the FMC63 mouse hybridoma (Nicholson et al. 1997, Mol Immunology), a portion of the human CD28 molecule (a hinge extracellular part, a transmembrane domain and the entire intracellular domain) and the entire domain of CD3-zeta chain.
  • a second AAV vector was designed and cloned where the CD19-CAR CDS was replaced by the turboGFP coding sequence.
  • CD3 + T cells were either isolated from whole blood or outsourced from Hemacare. Briefly, peripheral blood mononuclear cells were isolated by density gradient centrifugation (SepMate PBMC isolation tube, STEMCELL Technologies) and T lymphocytes were then purified using the EasySepTM Human T Cell Isolation Kit (STEMCELL Technologies).
  • T cells were electroporated using the Neon Electroporator (Thermofisher). Neon Electroporator conditions were 1600v/10ms/3 pulses with a lOpI tip with 250k cells, combined total of mRNA amount of l-5pg, for both the Deaminase-MCP and nCas9-UGI-UGI, and where applicable 2pM each of the targeting gRNAs.
  • Post-electroporation cells were transferred to Immunocult XT media with lOOU/ml IL-2, lOOU/ml IL-7 and lOOU/ml IL-15 (STEMCELL Technologies) and cultured at 37 2 C and 5% CO2 for 48-72 hours.
  • Recombinant AAV6 particles were generated by Vigene Biosciences. Where applicable, recombinant AAV6 particles were added to the culture 2 to 4 h after electroporation, at the lxlO 6 GC per cell. Subsequently, edited cells were cultured at 37C and 5% CO2 for 96 hours , maintaining the density of ⁇ 1 x 10 6 cells per ml.
  • T cell identity and QC was confirmed by CD3 antibody staining (Biolegend). T cell activation was confirmed by CD25 staining.
  • CD19-CAR+ cells were detected by flow cytometry using an Anti-FMC63 scFv Antibody (AcroBiosystem) at 96 hours post electroporation/transduction. Phenotypic Gene Multiplex KO was assessed at 96 hours post electroporation/transduction: TRAC was confirmed by TCRab antibody staining (Biolegend), B2M by B2M-Antibody (Biolegend) and CD52 with a CD52-antibody (Biolegend); any phenotype data was reported as percentage of viable cells, as ascertained by viability dye staining.
  • Table 5 Single guide RNAfor knock-in integration in the TRAC locus.
  • An example list of guide designs for guide RNA sequences that, when used as a pair and combined with the nCas9- UGI-UGI of the Examples, generate two nicks in opposite strands, creating a functional knockout and inducing site-specific integration using the base editing technology exemplified and a template transgene with homology arms to the locus.
  • Single guide RNA with PAM located 5' to the integration site have to be combined with single guide RNA with PAM located 3' to the integration site.
  • Example 4 Generation of iPSC cell lines for allogeneic CAR therapy by CRISPR-aptamer based gene editing system
  • iPSCs induced pluripotent stem cells
  • base editing guided knock-out is achieved through recruitment of the deaminase on the target site by a sgRNA-aptamer.
  • CAR integration and consequent B2M knock-out is achieved through the same enzyme used for the CRISPR system (combined with sgRNAs) and the base editing system.
  • the advantage over previous systems is that one enzyme or single RNA guided nickase is used to achieve all the modifications, i.e., the same enzyme is used for the CAR gene knock-in and for the TRAC and CIITA genes knock-out.
  • the iPSCs are cultivated in cell line specific media, disassociated, and then electroporated with mRNA components for both the deaminase-MCP, nCas9-UGI-UGI components, two sgRNAs targeting opposite strands in the first exon of the B2M gene, sgRNA-aptamer for two different genes (TRAC and CIITA), and an exogenous dsDNA template.
  • TRAC and CIITA sgRNA-aptamer for two different genes
  • DSB staggered double strand break
  • the exogenous dsDNA template contained homology arms relevant to the DNA break target site on the B2M locus and also contained the CAR transgene cassette. After electroporation, the cells are incubated for 4-7 days and are then checked for CAR expression and knock-out of B2M and CIITA by flow cytometry. Also, base conversion is measured by targeted PCR amplification and Sanger sequencing for TRAC and CIITA. Multi-antibody panel is used to ascertain multiplex KO level within the CAR+ population by flow cytometry.
  • the technology may generate iPSC lines with both the inclusion of a transgene, in a very specific locus, and multiplex editing at the same time, which may be superior to the current technology available. These edited iPSCs can then be utilised to differentiate, or forward program, into clinically relevant iPSC derived allogeneic CAR T cells.
  • Example 5 Generation of improved NK-cells for allogeneic CAR therapy by CRISPR-aptamer based gene editing system
  • NK-cells are used to prove the utility of the CRISPR based gene editing method for specific integration in the CISH locus of a CAR and simultaneous knock-out of PD1 and NKG2A.
  • base editing guided knock-out is achieved through recruitment of the deaminase on the target site by sgRNA-aptamer.
  • CAR integration and consequent CISH knock-out is achieved through the same enzyme used for the CRISPR system and for the base editing system.
  • the advantage over previous systems is that one enzyme, or single RNA guided nickase, is used to achieve both the modifications.
  • the NK-cells are electroporated with mRNA components for both the deaminase-MCP, nCas9- UGI-UGI components, two sgRNAs targeting opposite strands in the first exon of the CISH gene, and sgRNA-aptamer for two different genes (PD1 and NKG2A).
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognized by the sgRNAs result in a staggered double strand break (DSB).
  • DSB staggered double strand break
  • cells are transduced with an AAV6 virus used to promote integration of a CAR coding sequence in frame with the CISH gene by homologous directed repair (HDR).
  • HDR homologous directed repair
  • the technology may generate NK cells with both the inclusion of a transgene, in a very specific locus, and multiplex editing at the same time, which may be superior to the current technology available.
  • These edited NK cells can be used as improved CAR-NK cells.
  • primary human Pan T lymphocytes were used to prove the utility of the CRISPR based gene editing system for specific integration in the TRAC locus of a CAR gene and simultaneous knock-out of TRAC, B2M, CD52 and PDCD1 genes by the cytosine base editing system.
  • base editing guided knock-out was achieved through recruitment of the deaminase on the target site by a sgRNA-aptamer.
  • CAR gene integration and consequent TRAC knock-out was achieved through the same enzyme used for the CRISPR system combined to sgRNAs.
  • the advantage over previous systems is that one CRISPR enzyme, or single RNA guided nickase, is used to achieve both the modifications.
  • the Pan T cells were activated utilizing anti-CD3 and anti-CD28 antibodies and then electroporated with mRNA components for the following components: the deaminase-MCP, nCas9-UGI-UGI protein, two sgRNAs targeting opposite strands in the first exon of the TRAC gene and sgRNA-aptamer for three different genes.
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognized by the sgRNAs result in a staggered double strand break (DSB).
  • DSB staggered double strand break
  • cells were transduced with an AAV6 virus used to promote integration of a CAR coding sequence in frame with the TRAC gene by homologous directed repair (HDR).
  • HDR homologous directed repair
  • Allogeneic CAR-T cells were generated with the base editing system of the disclosure.
  • CAR-T cells a pair of synthetic sgRNAs targeting exon 1 of the TRAC locus, sgRNA-aptamers for base editing targeting of B2M, CD52, and PDCD1 and nCas9-UGI-UGI and Apobecl-MCP mRNAs were co-delivered into CD3 positive T-cells.
  • Cas9 samples were electroporated with wildtype Cas9 mRNA and regular sgRNAs. This was followed by transduction with the viral vector AAV6-TRAC-CAR.
  • CD3 + cells were depleted from the culture and the resulting CAR-T cells were incubated with CD19 positive Raji cells, previously loaded with Calcein AM, for 4 hours at 1:1 and 5:1 CAR-T:Raji cells ratio.
  • the allogeneic CAR-T cells of the disclosure killed efficiently antigen positive cancer cells (CD19 positive Raji cells), and was comparable to the wtCas9 outcome. This data shows that the technology can generate CAR-T cells with functional knockout in multiple genes that efficiently work as universal CAR-T cells.
  • sgRNA pairs targeting the 5' end of the first exon of TRAC and an AAV vector with homology arms to the target locus and encoding a self-cleaving P2A peptide followed by the CAR cDNA.
  • the sgRNAs to target the TRAC locus were designed following the rule of the PAM-out configuration (PAM sites faced the outside of the target region), with the cleavage sites 40-70 bp apart.
  • the knock-in guides were designed without the lxMS2 aptamer.
  • the sgRNAs were synthesized by Horizon Discovery (formerly Dharmacon).
  • Synthetic sgRNA sequences (SEQ ID NO: 29) mN*mN*NNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • RNA molecules were custom synthesized by TriLink Biotechnologies utilising the modified nucleotides pseudouridine and 5-Methyl-Cytosine.
  • the AAV plasmids were custom synthesized by GenScript. Based on a pAAV backbone we designed the pAAV-TRAC-1928Z_CAR containing in order: 0.9 kb left homology arm of genomic TRAC flanking the 5' gRNA targeting sequence, a GSG (gly-ser-gly) peptide followed by a self-cleaving P2A peptide in frame with the first exon of TRAC, the 1928z CAR used in YescartaTM therapy, the bovine growth hormone polyA signal (bGHpA) and 0.9kb right homology arm of the genomic TRAC flanking the 3' gRNA targeting sequence. Briefly the CD19-CAR (Kochenderfer et al.
  • J Immunotherapy comprises a single chain variable fragment scFV specific for the human CD19 derived from the FMC63 mouse hybridoma (Nicholson et al. 1997, Mol Immunology) a portion of the human CD28 molecule (a hinge extracellular part, a transmembrane domain and the entire intracellular domain) and the entire domain of CD3-zeta chain.
  • a second AAV vector has been designed and cloned where the CD19-CAR CDS is replaced by the turboGFP coding sequence.
  • CD3 + T cells were either isolated from whole blood or outsourced from Hemacare. Briefly, peripheral blood mononuclear cells were isolated by density gradient centrifugation (SepMate PBMC isolation tube, STEMCELL Technologies) and T lymphocytes were then purified using the EasySepTM Human T Cell Isolation Kit (STEMCELL Technologies).
  • Neon Electroporator Thermofisher
  • Neon Electroporator conditions were 1600v/10ms/3 pulses with a lOpI tip with 250k cells, combined total of mRNA amount of l-5pg, for both the Deaminase-MCP and nCas9-UGI-UGI, and where applicable 2pM each of the targeting gRNAs.
  • Post-electroporation cells were transferred to Immunocult XT media with lOOU/ml IL-2, lOOU/ml IL-7 and lOOU/ml IL-15 (STEMCELL Technologies) and cultured at 37 2 C and 5% CO2 for 48-72 hours.
  • Recombinant AAV6 particles were generated by Vigene Biosciences. Where applicable, recombinant AAV6 particles were added to the culture 2 to 4 h after electroporation, at the lxlO 6 GC per cell. Subsequently, edited cells were cultured at 37 2 C and 5% CO2 for 96 hours , maintaining the density of ⁇ 1 x 10 6 cells per ml.
  • PD1 For the detection of PD1 by flow cytometry, cells were stimulated with PMA (50ng/ml) and ionomycin (250ng/ml) for 48 hours before the analysis.
  • PMA 50ng/ml
  • ionomycin 250ng/ml
  • T cell identity and QC was confirmed by CD3 antibody staining (Biolegend). T cell activation was confirmed by CD25 staining. CD19-CAR+ cells were detected using an Anti- FMC63 scFv Antibody (AcroBiosystem) at 96 hours post electroporation/transduction. Phenotypic Gene Multiplex KO was assessed at 96 hours post electroporation/transduction: TRAC was confirmed by TCRab antibody staining (Biolegend), B2M by B2M-Antibody (Biolegend), CD52 with a CD52-antibody (Biolegend) and PD1 with a PDl-antibody (Biolegend); any phenotype data was reported as percentage of viable cells, as ascertained by viability dye staining.
  • modified CAR-T cells were firstly depleted of CD3 positive cells using the EasySepTM Human CD3 Positive Selection Kit II (Stemcell) and then incubated with CD19 positive Raji cells at a ratio of 1:1 or 5:1 CAR-T:Raji cells. Before incubation, Raji cells were loaded with Calcein AM. After 4 h of incubation, supernatant from the culture has been collected and analyzed for fluorescent emission using a plate reader with Exitation/Emission of 494/517. The level of fluorescence is proportional to the level of killing of the target Raji cells.
  • the percentage of target cell killing is calculated as [(average of test condition - average of negative control condition) / (average of positive control condition - average of negative control condition)]*100, where negative control condition is Raji cells without CAR-T cells and positive control condition is Raji cells exposed to 2% triton to achieve complete lysis.
  • Example 7 Integration of a promoter-less transgene in the B2M locus of iPSCs with expression of the transgene driven by the B2M endogenous promoter and destruction of B2M expression and base editing of the CIITA gene
  • iPSCs were used to prove the utility of the CRISPR-aptamer based gene editing system for specific integration in the B2M locus of a promoter-less transgene (GFP) and simultaneous knock-out of B2M and CIITA genes by the cytosine base editing system.
  • GFP promoter-less transgene
  • CIITA CIITA genes by the cytosine base editing system.
  • base editing guided knock-out was achieved through recruitment of the deaminase to the target site by a sgRNA-aptamer.
  • GFP integration and consequent B2M knock-out was achieved through the same enzyme used for the CRISPR system, combined with sgRNAs.
  • the exogenous DNA template was delivered in the form of circular or linear double-stranded DNA.
  • the exogenous DNA template was flanked by homology arms from the B2M locus.
  • the exogenous DNA template with homology arms was flanked or not on both sides by sgRNAs B2M targeting sequences (CRISPR/Cas9 target sequences (CTS)) ( Figure 13 A and B, respectively).
  • the GFP transgene flanked by homology arms was flanked by the sequence of the gRNA pair that target the B2M locus, so that once the circular doublestranded DNA is co-delivered in the cells together to the CRISPR components, the donor nucleic acid sequence was released as linear DNA from the circular dsDNA following the cut by CRISPR/Cas.
  • iPSCs were electroporated with the following components: (i) mRNA encoding the deaminase-MCP (SEQ ID NO: XX), (ii) mRNA encoding nCas9-UGI-UGI protein , (iii) two sgRNAs targeting opposite strands in the first exon of the B2M gene , (iv) sgRNA-aptamer for CIITA gene and (v) circular or linear double-stranded DNA containing the GFP coding sequence with homology arms to the B2M gene.
  • the homology arms can be flanked (CTS_B2M_tGFP - SEQ ID NO: 136) or not (B2M_tGFP - SEQ ID NO: 135) by sgRNAs B2M targeting sequences (CRISPR/Cas9 target sequences (CTS)).
  • CRISPR/Cas9 target sequences CRISPR/Cas9 target sequences
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognised by the sgRNAs in B2M exon 1 resulted in staggered double strand breaks (DSB).
  • Integration of the GFP transgene was promoted by the homology arms to the B2M locus by homologous directed repair (HDR).
  • Integration of the transgene by HDR or non-homologous end joining (NHEJ) induced by the DSB at this locus resulted in efficient knock-out of the B2M gene.
  • B2M expression level was low in pluripotent stem cell including iPSCs and it can be induced by treatment with interferon-y.
  • iPSCs were used to prove the utility of the CRISPR-aptamer based gene editing system for specific integration in the B2M locus of a scHLA-E trimer transgene (See Figure 12 for the schematic of the construct) and simultaneous knock-out of B2M and CIITA genes by the cytosine base editing system.
  • base editing guided knock-out was achieved through recruitment of the deaminase to the target site by a sgRNA-aptamer.
  • scHLA-E trimer integration and consequent B2M knock-out was achieved through the same enzyme used forthe CRISPR system, combined with sgRNAs.
  • the exogenous DNA template was delivered in the form of circular doublestranded DNA.
  • the exogenous DNA template was flanked by homology arms from the B2M locus, and was flanked or not on both sides by sgRNAs B2M targeting sequences ( Figure 13).
  • the scHLA-E trimer transgene flanked by homology arms was flanked by the sequence of the gRNA pair that target the B2M locus, so that once the circular doublestranded DNA is co-delivered in the cells together to the CRISPR components, the donor nucleic acid sequence is released as linear DNA from the plasmid following cut by CRISPR/Cas.
  • Figure 14 shows a schematic diagram of an example of a suitable scHLA-E trimer delivery strategy.
  • the scHLA-E trimergene was integrated into exon l of the B2M locus in frame with the upstream B2M locus.
  • the exogenous DNA template contained the scHLA-E trimer coding sequence flanked by homology sequences (LHA and RHA). Once integrated, scHLA-E trimer expression was driven by the endogenous B2M promoter while the B2M locus was disrupted.
  • iPSCs were electroporated with the following components: (i) mRNA encoding the deaminase-MCP, (ii) mRNA encoding nCas9-UGI-UGI protein, (iii) two sgRNAs targeting opposite strands in the first exon of the B2M gene, (iv) sgRNA-aptamer for CIITA gene and (v) circular double-stranded exogenous DNA template containing the scHLA-E trimer coding sequence.
  • the two single nicks generated by the nCas9-UGU-UGI at the two target loci recognized by the sgRNAs resulted in staggered double strand breaks (DSB).
  • scHLA-E trimer transgene was promoted by the homology arms to the B2M locus by homologous directed repair (HDR). Integration of the transgene by HDR or non-homologous end joining (NHEJ) induced by the DSB at this locus resulted in efficient knock-out of the B2M gene.
  • B2M expression level is low in pluripotent stem cell including iPSCs and it can be induced by treatment with interferon-y.
  • To detect B2M functional knock-out and successful scHLA-E trimer knock-in in the B2M locus two or four days after electroporation edited cells were treated for 48h with interferon-y and then analyzed by flow cytometry. Base conversion at the CIITA locus was measured by targeted PCR amplification and Sanger sequencing 4-6 days post electroporation.
  • Synthetic lxMS2 sgRNA sequence ( SEQ ID NO: 32) mN*mN*NNNNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCGCACAUGAGGAUCACCCAUGU GCUUUUmU*mU*U
  • Table 6 crRNA sequences in the single-guide RNAs (sgRNAs) for CIITA genes.
  • sgRNAs single-guide RNAs
  • Table 6 An example list of guide designs for guide RNA sequences that can create a functional knock-out using the base editing technology exemplified. The list includes guides specific to the introduction of a premature stop codon and splice disruption sites, which were generated by an in-house proprietary software.
  • sgRNA pairs targeting the 5' end of the first exon of B2M and a donor DNA template with homology arms to the target locus and encoding scHLA-E trimer.
  • the sgRNAs to target the B2M locus were designed following the rule of the PAM-out configuration (PAM sites faced the outside of the target region), with the cleavage sites 40-70 bp apart (Table 7).
  • the knock-in guides were designed without the lxMS2 aptamer.
  • the sgRNAs were synthesised by Horizon Discovery (formerly Dharmacon).
  • Synthetic sgRNA sequences SEQ ID NO: 29) mN*mN*NNNNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCU AGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • 3' sgRNA sequence 2 ( SEQ ID NO: 186) mA*mC*UCUCUUUCUGGCCUGGGUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAG UCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCUmU*mU*U
  • Table 7 Single guide RNA for knock-in integration in the B2M locus.
  • An example list of guide designs for guide RNA sequences that, when used as a pair and combined with the nCas9- UGI-UGI of the Examples, generate two nicks in opposite strands, creating a functional knockout and inducing site-specific integration using the base editing technology exemplified and a template transgene with homology arms to the locus.
  • Single guide RNA with PAM located 5' to the integration site have to be combined with single guide RNA with PAM located 3' to the integration site.
  • RNA molecules were custom synthesized by TriLink Biotechnologies utilizing the modified nucleotides pseudouridine and 5-Methyl-Cytosine.
  • the donor DNA templates were custom synthesized and cloned in the pUC19 cloning plasmid by GenScript.
  • the donor DNA template coding for the scHLA-E trimer contains in order: 0.9 kb left homology arm of genomic B2M flanking the 5' gRNA targeting sequence, the scHLA-E trimer coding sequence, the bovine growth hormone polyA signal (bGHpA) and 0.9kb right homology arm of the genomic B2M flanking the 3' gRNA targeting sequence.
  • the scHLA-E trimer is a chimeric protein that comprises the following elements: (a) the leader peptide of B2M, (b) VMAPRTLIL (a HLA-E-binding peptide), (c) a 15 amino acid linker (G4S)3, (d) a mature human B2M, (e) a 20 amino acid linker (G4S)4 and (f) a mature HLA-E heavy chain.
  • the donor DNA template with homology arms is flanked or not on both sides by the sgRNAs targeting sequences that target the B2M locus.
  • a second donor DNA template has been designed and cloned where the scHLA-E trimer coding sequence was replaced by the turboGFP coding sequence.
  • the above plasmids were digested with specific restriction enzymes to excise the donor DNA template from the plasmid.
  • the fragment of the right size was then purified after gel electrophoresis using a gel purification kit.
  • Frozen human iPSCs were obtained from ThermoFisher Scientific (Gibco line). Cells were thawed and cultured in mTesr-PLUS medium (STEMCELL Technologies) on Vitronectin-XF (STEMCELL Technologies) coated non-adherent cell-culture plasticware (Greiner Bio-One) at 37C and 5% CO2. When confluent cells were passaged in clumps using Versene dissociation reagent (ThermoFisher Scientific). Medium was exchanged at 1-3 day intervals, and cells were passaged at 3-5 day intervals, as required.
  • iPSCs were fed with fresh mTesr-PLUS culture medium (STEMCELL Technologies) containing lOpM Y-27632 (STEMCELL Technologies), then dissociated to single cells using Accutase (ThermoFisher Scientific).
  • 150k-200k cells were resuspended in 20pl of Buffer P3 (Lonza) and combined with l-4pg of modified mRNA (Trilink) encoding Deaminase-MCP and nCas9-UGI proteins, l-4pM of each sgRNA (Agilent) and 1-2 ug of donor DNA.
  • Electroporation was performed with the 4D Nucleofector (Lonza) in a 16x 20pl multi-well cuvette using programmes CM138 or DN100.
  • Post-electroporation cells were seeded on Geltrex (ThermoFisher Scientific) coated cell-culture plasticware (Corning) in mTesr-PLUS (STEMCELL Technologies) with the inclusion of lOpM of the Rho-kinase inhibitor Y-27632 (STEMCELL Technologies) in culture medium for 24hrs post-electroporation to promote cell survival.
  • Two- or 4-days post electroporation cells were treated with interferon- y at a concentration of lOOng/ml in mTesr-PLUS culture medium (STEMCELLTechnologies) for 48h before flow cytometry analysis.
  • Flow cytometry scHLA-E trimer positive cells were detected using an Anti-HLA-E Antibody (Biolegend) after48 hours treatment with interferon-y. Phenotypic knock-out of B2M was assessed after 48 hours treatment with interferon-y using a B2M-Antibody (Biolegend); any phenotype data was reported as percentage of viable cells, as ascertained by viability dye staining.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Hematology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Mycology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Transplantation (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2022/074625 2021-08-06 2022-08-05 Method for producing genetically modified cells Ceased WO2023015307A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
JP2024506903A JP2024534720A (ja) 2021-08-06 2022-08-05 遺伝子改変細胞を作製するための方法
KR1020247007517A KR20240043783A (ko) 2021-08-06 2022-08-05 유전자 변형 세포의 제조 방법
CA3227964A CA3227964A1 (en) 2021-08-06 2022-08-05 Method for producing genetically modified cells
US18/681,775 US20250109413A1 (en) 2021-08-06 2022-08-05 Method for Producing Genetically Modified Cells
CN202280067317.XA CN118159301A (zh) 2021-08-06 2022-08-05 生产基因修饰的细胞的方法
AU2022324118A AU2022324118A1 (en) 2021-08-06 2022-08-05 Method for producing genetically modified cells
EP22854129.8A EP4380627A1 (en) 2021-08-06 2022-08-05 Method for producing genetically modified cells

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163203996P 2021-08-06 2021-08-06
US63/203,996 2021-08-06

Publications (1)

Publication Number Publication Date
WO2023015307A1 true WO2023015307A1 (en) 2023-02-09

Family

ID=85156349

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/074625 Ceased WO2023015307A1 (en) 2021-08-06 2022-08-05 Method for producing genetically modified cells

Country Status (8)

Country Link
US (1) US20250109413A1 (cg-RX-API-DMAC7.html)
EP (1) EP4380627A1 (cg-RX-API-DMAC7.html)
JP (1) JP2024534720A (cg-RX-API-DMAC7.html)
KR (1) KR20240043783A (cg-RX-API-DMAC7.html)
CN (1) CN118159301A (cg-RX-API-DMAC7.html)
AU (1) AU2022324118A1 (cg-RX-API-DMAC7.html)
CA (1) CA3227964A1 (cg-RX-API-DMAC7.html)
WO (1) WO2023015307A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3322804B1 (en) 2015-07-15 2021-09-01 Rutgers, The State University of New Jersey Nuclease-independent targeted gene editing platform and uses thereof
WO2025070822A1 (ja) * 2023-09-29 2025-04-03 味の素株式会社 Hla遺伝子改変細胞
WO2025117745A1 (en) * 2023-12-01 2025-06-05 Caribou Biosciences, Inc. Methods and compositions for improving precision of endonuclease-mediated genome editing
WO2025179057A1 (en) * 2024-02-21 2025-08-28 The Regents Of The University Of California In vivo modification of cell genomes
WO2025255010A1 (en) * 2024-06-03 2025-12-11 X Development Llc Ai-guided synthetic biology development platform, systems, and methods

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190335726A1 (en) * 2016-06-14 2019-11-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2021055459A1 (en) * 2019-09-17 2021-03-25 Rutgers, The State University Of New Jersey Highly efficient dna base editors mediated by rna-aptamer recruitment for targeted genome modification and uses thereof

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190335726A1 (en) * 2016-06-14 2019-11-07 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
WO2021055459A1 (en) * 2019-09-17 2021-03-25 Rutgers, The State University Of New Jersey Highly efficient dna base editors mediated by rna-aptamer recruitment for targeted genome modification and uses thereof

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3322804B1 (en) 2015-07-15 2021-09-01 Rutgers, The State University of New Jersey Nuclease-independent targeted gene editing platform and uses thereof
WO2025070822A1 (ja) * 2023-09-29 2025-04-03 味の素株式会社 Hla遺伝子改変細胞
WO2025117745A1 (en) * 2023-12-01 2025-06-05 Caribou Biosciences, Inc. Methods and compositions for improving precision of endonuclease-mediated genome editing
WO2025179057A1 (en) * 2024-02-21 2025-08-28 The Regents Of The University Of California In vivo modification of cell genomes
WO2025255010A1 (en) * 2024-06-03 2025-12-11 X Development Llc Ai-guided synthetic biology development platform, systems, and methods

Also Published As

Publication number Publication date
JP2024534720A (ja) 2024-09-25
EP4380627A1 (en) 2024-06-12
KR20240043783A (ko) 2024-04-03
AU2022324118A1 (en) 2024-02-22
CA3227964A1 (en) 2023-02-09
CN118159301A (zh) 2024-06-07
US20250109413A1 (en) 2025-04-03

Similar Documents

Publication Publication Date Title
US20250361287A1 (en) Targeted replacement of endogenous t cell receptors
US20250109413A1 (en) Method for Producing Genetically Modified Cells
EP3352798B1 (en) A method for high level and stable gene transfer in lymphocytes
EP4274893B1 (en) Method for producing genetically modified cells
US20240016934A1 (en) Compositions and Methods for Reducing MHC Class II in a Cell
US20230235315A1 (en) Method for producing genetically modified cells
US20250179481A1 (en) Compositions and methods for targeting, editing, or modifying genes
CA3175106A1 (en) Compositions and methods for modifying a target nucleic acid
KR20250155074A (ko) 게놈 편집 조성물 및 사용 방법
WO2023225035A2 (en) Compositions and methods for engineering cells
KR20250037790A (ko) 세포에서 mhc 클래스 i를 감소시키기 위한 조성물 및 방법
US20230203502A1 (en) Rna scaffolds
US20260071238A1 (en) Materials and processes for engineering hypoimmunogenicity
US20250197811A1 (en) Compositions and methods for generating cells with reduced immunogenicity
EP4729070A1 (en) Method of gene editing using base editors for transgene insertion and multiplex gene editing
WO2026082970A1 (en) Method of gene editing using base editors for transgene insertion and multiplex gene editing
CN116802274A (zh) 用于减少细胞中ii类mhc的组合物和方法
CN116745406A (zh) 用于减少细胞中hla-a的组合物和方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22854129

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3227964

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2024506903

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: AU2022324118

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2022324118

Country of ref document: AU

Date of ref document: 20220805

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202447014922

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022854129

Country of ref document: EP

Effective date: 20240306

WWE Wipo information: entry into national phase

Ref document number: 202280067317.X

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 18681775

Country of ref document: US