WO2023010100A1 - Novel anti-sirpa antibodies - Google Patents
Novel anti-sirpa antibodies Download PDFInfo
- Publication number
- WO2023010100A1 WO2023010100A1 PCT/US2022/074286 US2022074286W WO2023010100A1 WO 2023010100 A1 WO2023010100 A1 WO 2023010100A1 US 2022074286 W US2022074286 W US 2022074286W WO 2023010100 A1 WO2023010100 A1 WO 2023010100A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- sequence
- antibody
- cancer
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- SIRP ⁇ Signal-regulatory protein alpha
- SIRP ⁇ is an inhibitory receptor expressed primarily on myeloid cells and dendritic cells.
- SIRP ⁇ is an inhibitory receptor expressed primarily on myeloid cells and dendritic cells.
- SIRP ⁇ is an inhibitory receptor expressed primarily on myeloid cells and dendritic cells.
- SIRP ⁇ is an inhibitory receptor expressed primarily on myeloid cells and dendritic cells.
- the SIRPs family also includes several other transmembrane glycoproteins, including, SIRP ⁇ and SIRP ⁇ . Each member of the SIRPs family contains 3 similar extracellular Ig-like domains with distinct transmembrane and cytoplasmic domains.
- CD47 is a broadly expressed transmembrane glycoprotein with an extracellular N-terminal IgV domain, five transmembrane domains, and a short C-terminal intracellular tail. CD47 functions as a cellular ligand for SIRP ⁇ . Binding of CD47 to SIRP ⁇ delivers a “don’t eat me” signal to suppress phagocytosis, and blocking the CD47 mediated engagement of SIRP ⁇ on a phagocyte can cause removal of live cells bearing “eat me” signals. Tumor cells frequently overexpress CD47 to evade macrophage-mediated destruction.
- CD47 and SIRP ⁇ have been shown to be involved in the regulation of macrophage-mediated phagocytosis (Takenaka et al., Nature Immunol., 8(12): 1313-1323, 2007).
- therapies that block the interaction of CD47 and SIRP ⁇ stimulate phagocytosis of cancer cells in vitro and anti-tumor immune responses in vivo.
- CD47 anti-CD47 antibodies and SIRP ⁇ fusion proteins
- these agents have been associated with hemolytic anemia and thrombocytopenia.
- universal expression of CD47 may also cause antigen sink, which leads to reduced efficacy.
- the antibody or an antigen-binding fragment thereof provided herein comprises: a) the HCDR1 comprises an amino acid sequence of X 1 YYMH (SEQ ID NO: 18), and/or b) the HCDR2 comprises an amino acid sequence of RIDPEDX 2 EX 3 KYAPKFQG (SEQ ID NO: 19), and/or c) the HCDR3 comprises an amino acid sequence of GX 18 X 4 X 5 Y (SEQ ID NO: 20), and/or d) the LCDR1 comprises an amino acid sequence of SASSSVSSSYLY (SEQ ID NO: 10), and/or e) the LCDR2 comprises an amino acid sequence of STSNLAS (SEQ ID NO: 11), and/or f) the LCDR3 comprises an amino acid sequence of X 6 QWSSYPYT (SEQ ID NO: 21), wherein X 1 is A or D; X 2 is G or A; X 3 is T or S; X 4 is L or Y
- the antibody or an antigen-binding fragment thereof provided herein comprises: a) the HCDR1 comprises an amino acid sequence of AYYMH (SEQ ID NO: 7) or DYYMH (SEQ ID NO: 13), and/or consisting of RIDPEDGESKYAPKFQG (SEQ ID NO: 8), RIDPEDGETKYAPKFQG (SEQ ID NO: 14) and RIDPEDAETKYAPKFQG (SEQ ID NO: 17), and/or c) the HCDR3 comprises an amino acid sequence of GSYEY (SEQ ID NO: 9) or GLAY (SEQ ID NO: 15), and/or d) the LCDR1 comprises an amino acid sequence of SASSSVSSSYLY (SEQ ID NO: 10), and/or e) the LCDR2 comprises an amino acid sequence of STSNLAS (SEQ ID NO: 11), and/or f) the LCDR3 comprises an amino acid sequence of YQWSSYPYT (SEQ ID NO: 7)
- the antibody or an antigen-binding fragment thereof provided herein comprises: a) the HCDR1 comprises an amino acid sequence of TYGMS (SEQ ID NO: 22), and/or b) the HCDR2 comprises an amino acid sequence of WINTYSGVX 19 TX 7 ADDFX 8 G (SEQ ID NO: 38), and/or c) the HCDR3 comprises an amino acid sequence of DPHX 9 YGX 10 SPAWFX 11 Y (SEQ ID NO: 39), and/or d) the LCDR1 comprises an amino acid sequence of X 12 ASQX 13 VGIX 14 VA (SEQ ID NO: 40), and/or e) the LCDR2 comprises an amino acid sequence of SASNRX 15 T (SEQ ID NO: 41), and/or f) the LCDR3 comprises an amino acid sequence of QQYSX16YPX17T (SEQ ID NO: 42), wherein X 7 is Y or C; X 8 is K or Q; X 9 is
- the antibody or an antigen-binding fragment thereof provided herein comprises: a) the HCDR1 comprises an amino acid sequence of TYGMS (SEQ ID NO: 22), and/or b) the HCDR2 comprises an amino acid sequence selected from the group consisting of WINTYSGVSTCADDFKG (SEQ ID NO: 23), WINTYSGVPTYADDFQG (SEQ ID NO: 28) and WINTYSGVPTYADDFKG (SEQ ID NO: 33), and/or c) the HCDR3 comprises an amino acid sequence selected from the group consisting of DPHSYGNSPAWFPY (SEQ ID NO: 24), DPHYYGTSPAWFAY (SEQ ID NO: 29) and DPHYYGSSPAWFVY (SEQ ID NO: 34), and/or d) the LCDR1 comprises an amino acid sequence selected from the group consisting of KASQNVGISVA (SEQ ID NO: 25), KASQIVGIAVA (SEQ ID NO: 30)
- the heavy chain variable region comprises: a) a HCDR1 comprising the sequence of SEQ ID NO: 1, a HCDR2 comprising the sequence of SEQ ID NO: 2, and a HCDR3 comprising the sequence of SEQ ID NO: 3; or the sequence of SEQ ID NO: 8, and a HCDR3 comprising the sequence of SEQ ID NO: 9; or c) a HCDR1 comprising the sequence of SEQ ID NO: 13, a HCDR2 comprising the sequence of SEQ ID NO: 14 or SEQ ID NO: 17, and a HCDR3 comprising the sequence of SEQ ID NO: 15; or d) a HCDR1 comprising the sequence of SEQ ID NO: 22, a HCDR2 comprising the sequence of SEQ ID NO: 23, and a HCDR3 comprising the sequence of SEQ ID NO: 24; or e) a HCDR1 comprising the sequence of SEQ ID NO: 22, a HCDR2 comprising the sequence of SEQ ID NO: 3.
- the light chain variable region comprises: a) a LCDR1 comprising the sequence of SEQ ID NO: 4, a LCDR2 comprising the sequence of SEQ ID NO: 5, and a LCDR3 comprising the sequence of SEQ ID NO: 6; or b) a LCDR1 comprising the sequence of SEQ ID NO: 10, a LCDR2 comprising the sequence of SEQ ID NO: 11, and a LCDR3 comprising the sequence of SEQ ID NO: 12; or c) a LCDR1 comprising the sequence of SEQ ID NO: 10, a LCDR2 comprising the sequence of SEQ ID NO: 11, and a LCDR3 comprising the sequence of SEQ ID NO: 16; or d) a LCDR1 comprising the sequence of SEQ ID NO: 25, a LCDR2 comprising SEQ ID NO: 27; or e) a LCDR1 comprising the sequence of SEQ ID NO: 30, a LCDR2 comprising the sequence of SEQ ID NO: 31, and a LCDR3 comprising
- the antibody or an antigen-binding fragment thereof provided herein comprises: a) a HCDR1 comprising the sequence of SEQ ID NO: 1, a HCDR2 comprising the sequence of SEQ ID NO: 2, and a HCDR3 comprising the sequence of SEQ ID NO: 3, a LCDR1 comprising the sequence of SEQ ID NO: 4, a LCDR2 comprising the sequence of SEQ ID NO: 5, and a LCDR3 comprising the sequence of SEQ ID NO: 6; or b) a HCDR1 comprising the sequence of SEQ ID NO: 7, a HCDR2 comprising the sequence of SEQ ID NO: 8, and a HCDR3 comprising the sequence of SEQ ID NO: 9, a LCDR1 comprising the sequence of SEQ ID NO: 10, a LCDR2 comprising the sequence of SEQ ID NO: 11, and a LCDR3 comprising the sequence of SEQ ID NO: 12; or c) a HCDR1 comprising the sequence of SEQ ID NO:
- the antibody or an antigen-binding fragment thereof provided herein further comprises one or more of heavy chain HFR1, HFR2, HFR3 and HFR4, and/or one or more of light chain LFR1, LFR2, LFR3 and LFR4, wherein: a) the HFR1 comprises EVQLVQSGAEVKKPGATVKISCKX 20 SGFNIK (SEQ ID NO: 84) or a homologous sequence of at least 80% sequence identity thereof, and/or b) the HFR2 comprises WVQQAPGKGLEWIG (SEQ ID NO: 74) or a homologous sequence of at least 80% sequence identity thereof, and/or c) the HFR3 sequence comprises homologous sequence of at least 80% sequence identity thereof, and/or d) the HFR4 comprises WGQGTLVTVSS (SEQ ID NO: 76) or a homologous sequence of at least 80% sequence identity thereof, and/or e) the LFR1 comprises EIVLTQSPATLSLSPGER
- the HFR1 comprises EVQLVQSGAEVKKPGATVKISCKASGFNIK (SEQ ID NO: 83) or EVQLVQSGAEVKKPGATVKISCKVSGFNIK (SEQ ID NO: 73), or a homologous sequence of at least 80% sequence identity thereof
- the HFR2 comprises WVQQAPGKGLEWIG (SEQ ID NO: 74) or a homologous sequence of at least 80% sequence identity thereof
- the HFR3 sequence comprises RVTITADTSTNTAYMELSSLRSEDTAVYYCDR (SEQ ID NO: 75) or RVTITADTSTDTAYMELSSLRSEDTAVYYCDR (SEQ ID NO: 82) or a homologous sequence of at least 80% sequence identity thereof
- the HFR4 comprises WGQGTLVTVSS (SEQ ID NO: 76) or a homologous sequence of at least 80% sequence
- the heavy chain variable region comprises the sequence selected from the group consisting of SEQ ID NO: 63, SEQ ID NO: 65 and SEQ ID NO: 67, and a homologous sequence thereof having at least 80% sequence identity yet retaining specific binding affinity to human SIRP ⁇ .
- the light chain variable region comprises the sequence selected from the group consisting of SEQ ID NO: 64 and SEQ ID NO: 66, and a homologous sequence thereof having at least 80% sequence identity yet retaining specific binding affinity to human SIRP ⁇ .
- the heavy chain variable region comprises the sequence of SEQ ID NO: 49 and the light chain variable region comprises the sequence of SEQ ID NO: 50; or b) the heavy chain variable region comprises the sequence of SEQ ID NO: 51 and the light chain variable region comprises the sequence of SEQ ID NO: 52; or c) the heavy chain variable region comprises the sequence of SEQ ID NO: 53 and the light chain variable region comprises the sequence of SEQ ID NO: 54; or d) the heavy chain variable region comprises the sequence of SEQ ID NO: 55 and the light chain variable region comprises the sequence of SEQ ID NO: 56; or e) the heavy chain variable region comprises the sequence of SEQ ID NO: 57 58; or f) the heavy chain variable region comprises the sequence of SEQ ID NO: 59 and the light chain variable region comprises the sequence of SEQ ID NO: 60; or g) the heavy chain variable region comprises the sequence of SEQ ID NO: 61 and the light chain variable region comprises the sequence of SEQ ID NO: 62; or h) the
- the antibody or an antigen-binding fragment thereof provided herein further comprises one or more amino acid residue substitutions or modifications yet retains specific binding affinity to human SIRP ⁇ . one or more of the CDR sequences, and/or in one or more of the non-CDR sequences of the heavy chain variable region or light chain variable region.
- the antibody or an antigen-binding fragment thereof provided herein further comprises an Fc region, optionally an Fc region of human immunoglobulin (Ig), or optionally an Fc region of human IgG.
- the Fc region is derived from human IgG4.
- the Fc region derived from human IgG4 comprises a S228P mutation and/or a L235E mutation.
- the antibody or an antigen-binding fragment thereof provided herein is humanized.
- the antibody or an antigen-binding fragment thereof provided herein is a monoclonal antibody, a bispecific antibody, a multi-specific antibody, a recombinant antibody, a chimeric antibody, a labeled antibody, a bivalent antibody, an anti-idiotypic antibody or a fusion protein.
- the antibody or an antigen-binding fragment thereof provided herein is a diabody, a Fab, a Fab', a F(ab') 2 , a Fd, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, or a bivalent domain antibody.
- the antibody or an antigen-binding fragment thereof provided herein have one or more properties selected from the group consisting of: a) capable of completely blocking interaction between SIRP-alpha v1 and CD47, b) capable of blocking interaction between SIRP-alpha v1 and CD47 at an IC50 of or at an IC50 of no more than 0.6nM (or no more than 0.5nM), as measured by competitive FACS; c) capable of completely blocking interaction between SIRP-alpha v2 and CD47, d) capable of blocking interaction between SIRP-alpha v2 and CD47 at an IC50 of no more than 10nM (or no more than 5nM), as measured by competitive ELISA or at an IC50 of no more than 0.8nM (or no more than 0.7nM), as measured by competitive FACS; e) having no significant inhibition on IFN ⁇ secretion by T cells, CD4 + T cell proliferation or CD8 + T cell proliferation; f) capable of blocking CD47 mediated S
- the present disclosure also provides an antibody or an antigen-binding fragment thereof which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 53, and a light chain variable region comprising the sequence of SEQ ID NO: 54.
- the present disclosure also provides an antibody or an antigen-binding fragment thereof which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 55, and a light chain variable region comprising the sequence of SEQ ID NO: 56.
- the antibody or an antigen-binding fragment thereof which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 61, and a light chain variable region comprising the sequence of SEQ ID NO: 62.
- the antibody or an antigen-binding fragment thereof provided herein is bispecific.
- the antibody or an antigen-binding fragment thereof provided herein is capable of specifically binding to a second antigen other than SIRP ⁇ .
- the second antigen is a tumor antigen, tumor surface antigen, an inflammatory antigen, an antigen of an infectious microorganism.
- the antibody or an antigen-binding fragment thereof provided herein is capable of specifically binding to a second epitope on SIRP ⁇ .
- the antibody or an antigen-binding fragment thereof provided herein is linked to one or more conjugate moieties.
- the conjugate moiety comprises a clearance- modifying agent, a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a luminescent label, a fluorescent label, an enzyme-substrate label, a DNA-alkylator, a topoisomerase inhibitor, a tubulin-binder, a purification moiety, or other anticancer drugs.
- the present disclosure also provides a pharmaceutical composition comprising the antibody or an antigen-binding fragment thereof provided herein, and one or more pharmaceutically acceptable carriers. polynucleotide encoding the antibody or an antigen-binding fragment thereof provided herein. [0038] In another aspect, the present disclosure also provides a vector comprising the isolated polynucleotide provided herein. [0039] In another aspect, the present disclosure also provides a host cell comprising the vector provided herein. [0040] In another aspect, the present disclosure also provides a method of expressing the antibody or an antigen-binding fragment thereof provided herein, comprising culturing the host cell provided herein under the condition at which the vector provided herein is expressed.
- the present disclosure also provides a method of inducing phagocytosis in vitro, comprising contacting a target cell with a SIRP ⁇ positive phagocytic cell sample in the presence of the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, optionally in combination with a target antibody that specifically binds to a target antigen on the target cell, thereby inducing phagocytosis of the target cell by the SIRP ⁇ positive phagocytic cell.
- the present disclosure also provides a method of inducing phagocytosis of a target cell in a subject, comprising administering to the subject the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, optionally in combination with a target antibody that specifically binds to a target antigen on the target cell, in a dose effective to induce phagocytosis of the target cell.
- ADCP antibody-dependent cellular phagocytosis
- the present disclosure also provides a method of treating, preventing or alleviating a disease disorder or condition that can be benefited from induced phagocytosis of a target cell in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, optionally in combination with a target antibody that specifically binds to a target antigen on the target cell.
- the present disclosure also provides a method of treating, preventing or alleviating a SIRP ⁇ related disease disorder or condition in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, optionally in combination with a target antibody that specifically binds to a target antigen on the target cell.
- the target cell is a CD47 expressing cell.
- the target cell is a cancer cell, inflammatory cell, and/or a chronically infected cell.
- the target antigen is tumor antigen, tumor surface antigen, an inflammatory antigen, an antigen of an infectious microorganism.
- the disease, disorder or condition is cancer, solid tumor, a chronic infection, an inflammatory disease, multiple sclerosis, an autoimmune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a septic shock, fibrosis, atherosclerosis, obesity, type II diabetes, a transplant dysfunction, or arthritis.
- the cancer is anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, gallbladder cancer, gastric cancer, lung cancer, bronchial cancer, bone cancer, liver and bile duct cancer, pancreatic cancer, breast cancer, liver cancer, ovarian cancer, testicle cancer, kidney cancer, renal pelvis and ureter cancer, salivary gland cancer, small intestine cancer, urethral cancer, bladder cancer, head and neck cancer, head and neck squamous cell carcinoma, spine cancer, brain cancer, cervix cancer, uterine cancer, endometrial cancer, colon cancer, colorectal cancer, rectal cancer, esophageal cancer, gastrointestinal cancer, skin cancer, prostate cancer, pituitary cancer, vagina cancer, thyroid cancer, throat cancer, glioblastoma, melanoma, myelodysplastic syndrome, sarcoma, teratoma, chronic lymphocytic leukemia (CLL), chronic myeloid leukemia
- the cancer is a CD47-positive cancer.
- the subject is human. subcutaneous, sublingual, or intramuscular administration.
- the method provided herein further comprises administering a therapeutically effective amount of an additional therapeutic agent.
- the additional therapeutic agent is selected from the group consisting of a chemotherapeutic agent, an anti-cancer drug, a radiation therapy agent, an immunotherapy agent, an anti-angiogenesis agent, a targeted therapy agent, a cellular therapy agent, a gene therapy agent, a hormonal therapy agent, an antiviral agent, an antibiotic, an analgesics, an antioxidant, a metal chelator, cytokines, anti- infectious agent, and anti-inflammatory agent.
- the present disclosure also provides a kit comprising the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, and a target antibody that binds to a target antigen expressed on the target cell.
- the target antigen is tumor antigen, tumor surface antigen, or an infectious agent surface antigen.
- the kit provided herein further comprises an additional therapeutic agent.
- the present disclosure also provides a method of modulating SIRP ⁇ activity in a SIRP ⁇ -positive cell, comprising exposing the SIRP ⁇ - positive cell to the antibody or antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein.
- the cell is a phagocytic cell.
- the present disclosure also provides a method of detecting the presence or amount of SIRP ⁇ in a sample, comprising contacting the sample with the presence or the amount of SIRP ⁇ in the sample.
- the present disclosure also provides use of the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein in the manufacture of a medicament for: i) treating, preventing or alleviating a SIRP ⁇ related disease, disorder or condition in a subject; ii) inducing phagocytosis of a target cell in a subject; ii) increasing antibody-dependent cellular phagocytosis (ADCP) effect of a target antibody on a target cell in a subject.
- ADCP antibody-dependent cellular phagocytosis
- the present disclosure also provides a method of potentiating a target antibody in treating a disease, disorder or condition in a subject, comprising: administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof provided herein or the pharmaceutical composition provided herein, in combination with the target antibody, thereby potentiating the target antibody in treating the disease, disorder or condition in the subject.
- the disease, disorder or condition is immune related disease or disorder, tumors and cancers, autoimmune diseases, or infectious disease.
- the immune related disease or disorder is selected from the group consisting of systemic lupus erythematosus, acute respiratory distress syndrome (ARDS), vasculitis, myasthenia gravis, idiopathic pulmonary fibrosis, Crohn's Disease, asthma, rheumatoid arthritis, graft versus host disease, a spondyloarthropathy (e.g., ankylosing spondylitis, psoriatic arthritis, isolated acute enteropathic arthritis associated with inflammatory bowel disease, reactive arthritis, Behcet's syndrome, undifferentiated spondyloarthropathy, anterior uveitis, and sepsis, diabetes, acute coronary syndrome, ischemic reperfusion, psoriasis, progressive systemic sclerosis, atherosclerosis, Sjogren's syndrome, scleroderma, or inflammatory autoimmune myositis.
- ARDS acute respiratory distress syndrome
- vasculitis e.g., ankylos
- the tumors and cancers are solid tumor or hematologic malignancy, optionally selected from the group consisting of non-small cell lung cancer, small cell lung cancer, renal cell cancer, colorectal cancer, ovarian cancer, breast cancer, pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer, mesothelioma, melanoma, head and neck cancer, thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, leukemia, lymphomas, myelomas, mycoses fungoids, merkel cell cancer, and other hematologic malignancies, such as classical Hodgkin lymphoma (CHL), primary mediastinal large B-cell lymphoma, T-cell/histiocyte-rich B-cell lymphoma, EBV-positive and - negative PTLD, and EBV-associated diffuse large B-cell lymphoma (DLBCL), plasmablastic lympho
- CHL Hodgkin
- Figure 1 shows FACS binding curves of anti-SIRPa antibodies 025c, 015c, 042c, 059c, hu1H9G4 (Fig.1A), 071c, 073c (Fig.1B) against CHOK1-human SIRPa v1 cells and 005c (Fig.1C) against 293F-human SIRPa v1 cells.
- Figure 2 shows FACS binding curves of anti-SIRPa antibodies 025c, 015c, 042c, 071c, 073c, hu1H9G4 (Fig.2A), 025c, 059c, 005c, HEFLB (Fig.2B) against CHOK1-human SIRPa v2 cells.
- Figure 3 shows FACS binding curves of anti-SIRPa antibodies against CHOK1-human SIRPb cells (Fig.3C) and their ELISA binding curves against recombinant proteins of human SIRPb ECD (Fig.3A and 3B) and human SIRPbl ECD (Fig.3D and 3E).
- Figure 4 shows FACS binding curves of anti-SIRPa antibodies against 293F- human SIRP ⁇ cells (Fig.4A and Fig.4B) and their ELISA binding curves against recombinant protein of cyno SIRP ⁇ ECD (Fig.4C).
- Figure 5 shows ELISA binding of anti-SIRPa antibodies against recombinant protein of C57BL/6 mouse SIRP ⁇ ECD (Fig.5A) and their FACS binding curves against CHOK1-cyno SIRP ⁇ cells (Fig.5B and Fig.5C).
- Figure 6 shows CD47 and SIRP ⁇ v1 interaction blocking activity of anti- SIRPa antibodies 025c, 015c, 042c, 059c, 071c, 073c, hu1H9G4 (Fig.6A), 025c, 005c, 059c (Fig.6B) as measured by competitive ELISA assay.
- Figure 7 shows CD47 and SIRP ⁇ v2 interaction blocking activity of anti- SIRPa antibodies 025c, 059c (Fig.7A), 025c, 015c, 042c, 071c, 073c, hu1H9G4 (Fig.7B) as measured by competitive ELISA assay.
- Figure 9 shows potential binding epitopes of anti-SIRPa antibodies 025c (Fig.9A), 042c (Fig.9B), 073c (Fig.9C), hu1H9G4 (Fig.9D), HEFLB (Fig.9E) as measured by HDX-MS.
- Figure 10 shows phagocytosis of Raji cells (Fig.10A), DLD1 cells (Fig.10B), and Raji/PD-L1 cells (Fig.10C and Fig.10D) by human macrophages in the presence of the indicated antibodies.
- Figure 11 shows phagocytosis of Raji/PD-L1 cells by human M0 polarized macrophages (Fig.11A) or human M1 polarized macrophages (Fig.11B) in the presence of the indicated antibodies.
- Figure 12 shows the results of an in vivo syngeneic mouse colon carcinoma model to assess activity of combination of anti-SIRP ⁇ treatment and anti-CLDN18.2 treatment.
- Fig.12A shows the weight of each tumor at the end of the study
- Fig.12B shows average tumor volume growth curves for each study group
- Fig.12C shows individual volume growth curves for each tumor. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001.
- Figure 13 shows allogeneic dendritic cells stimulated T cell IFN ⁇ secretion (Fig.13A), proliferation ratios of CD4+ T cells (Fig.13B) and CD8+ T cells (Fig.13C) in the presence of anti-SIRP ⁇ antibodies.
- Figure 14 shows FACS binding curves of humanized antibodies against CHOK1-human SIRPa v1 cells (Fig.14A), CHOK1-human SIRPa v2 cells (Fig.14B), CHOK1-human SIRP ⁇ cells (Fig.14C), and 293F-SIRP ⁇ cells (Fig.14D).
- Figure 15 shows CD47 and SIRP ⁇ interaction blocking activity of humanized antibodies as measured by competitive ELISA assay.
- FIG.15A human CD47 and interaction blocking.
- Figure 16 shows CD47 and SIRP ⁇ interaction blocking activity of humanized antibodies as measured by competitive FACS assay.
- Fig.16A human CD47 and human SIRP ⁇ v1 interaction blocking
- Fig.16B human CD47 and human SIRP ⁇ v2 interaction blocking.
- Figure 17 shows SHP-1 recruitment blocking activity of humanized antibodies as measured by SHP-1 recruitment assay.
- Figure 18 shows phagocytosis of Raji/PD-L1 cells by human macrophages in the presence of the indicated antibodies.
- Fig.18A, Fig.18C and Fig.18E phagocytosis of Raji/PD-L1 cells by human macrophages from SIRPA homozygous v1/v1 (A), SIRPA homozygous v2/v2 (C) or SIRPA heterozygous v1/v2 (E) donor in the presence of anti-SIRPa antibodies plus anti-PD-L1 antibody
- Fig.18B and Fig.18D phagocytosis of Raji/PD-L1 cells by human macrophages SIRPA homozygous v1/v1 (B) or SIRPA homozygous v2/v2 (D) donor in the presence of anti-SIRPa antibodies plus Rituximab.
- a native intact antibody comprises two heavy (H) chains and two light (L) chains.
- Mammalian heavy chains are classified as alpha, delta, epsilon, gamma, and mu, each heavy chain consists of a variable region (VH) and a first, second, third, and optionally fourth constant region (CH1, CH2, CH3, CH4 respectively);
- mammalian light chains are classified as ⁇ or ⁇ , while each light chain consists of a variable region (VL) and a constant region.
- the antibody has a “Y” shape, with the stem of the Y consisting of the second and third constant regions of two heavy chains bound together via disulfide bonding.
- Each arm of the Y includes the variable region and first constant region of a single heavy chain bound to the variable and constant regions of a single light chain.
- the variable regions of the light and heavy chains are responsible for antigen binding.
- the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain CDRs including LCDR1, LCDR2, and LCDR3, heavy chain CDRs including HCDR1, HCDR2, HCDR3).
- CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, IMGT, Chothia, or Al-Lazikani (Al-Lazikani, B., Chothia, C., Lesk, A. M., J. Mol.
- FRs framework regions
- Antibodies are assigned to classes based on the amino acid sequences of the constant regions of their heavy chains.
- the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of alpha, delta, epsilon, gamma, and mu heavy chains, respectively.
- Several of the major antibody classes are divided into subclasses such as IgG1 (gamma1 heavy chain), IgG2 (gamma2 heavy chain), IgG3 (gamma3 heavy chain), IgG4 (gamma4 heavy chain), IgA1 (alpha1 heavy chain), or IgA2 (alpha2 heavy chain).
- the antibody provided herein encompasses any antigen-binding fragments thereof.
- antigen-binding fragment refers to an antibody fragment formed from a portion of an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure.
- antigen-binding fragment examples include, without limitation, a diabody, a Fab, a Fab', a F(ab') 2 , an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single- chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a bispecific antibody, a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody.
- an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody binds.
- Fab with regard to an antibody refers to that portion of the antibody consisting of a single light chain (both variable and constant regions) bound to the variable region and first constant region of a single heavy chain by a disulfide bond.
- Fab' refers to a Fab fragment that includes a portion of the hinge region.
- F(ab') 2 refers to a dimer of Fab’. that portion of the antibody consisting of the second and third constant domains of a first heavy chain bound to the second and third constant domains of a second heavy chain via disulfide bonding.
- Fc with regard to antibody of IgM and IgE isotype further comprises a fourth constant domain.
- the Fc portion of the antibody is responsible for various effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC), and complement dependent cytotoxicity (CDC), but does not function in antigen binding.
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- Single-chain Fv antibody or “scFv” refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence (Huston JS et al. Proc Natl Acad Sci USA, 85:5879(1988)).
- Single-chain Fv-Fc antibody or “scFv-Fc” refers to an engineered antibody consisting of a scFv connected to the Fc region of an antibody.
- “Camelized single domain antibody,” “heavy chain antibody,” or “HCAb” refers to an antibody that contains two V H domains and no light chains (Riechmann L.
- Heavy chain antibodies were originally derived from Camelidae (camels, dromedaries, and llamas). Although devoid of light chains, camelized antibodies have an authentic antigen-binding repertoire (Hamers- Casterman C. et al., Nature. Jun 3; 363(6428):446-8 (1993); Nguyen VK. et al. Immunogenetics.
- a “nanobody” refers to an antibody fragment that consists of a VHH domain from a heavy chain antibody and two constant domains, CH2 and CH3.
- a “diabody” or “dAb” includes small antibody fragments with two antigen- binding sites, wherein the fragments comprise a V H domain connected to a V L domain in the same polypeptide chain (VH-VL or VL-VH) (see, e.g. Holliger P. et al., Proc Natl Acad Sci USA. Jul 15;90(14):6444-8 (1993); EP404097; WO93/11161).
- VH-VL or VL-VH the same polypeptide chain
- the antigen-binding sites may target the same or different antigens (or epitopes).
- a “bispecific ds diabody” is a diabody target two different antigens (or epitopes).
- a “domain antibody” refers to an antibody fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more V H domains are covalently joined with a peptide linker to create a bivalent or multivalent domain antibody.
- the two V H domains of a bivalent domain antibody may target the same or different antigens.
- the term “valent” as used herein refers to the presence of a specified number of antigen binding sites in a given molecule.
- bivalent refers to an antibody or an antigen-binding fragment having only one single antigen-binding site; and the term “multivalent” refers to an antibody or an antigen-binding fragment having multiple antigen-binding sites.
- bivalent refers to an antibody or an antigen-binding fragment having multiple antigen-binding sites.
- a “bispecific” antibody refers to an artificial antibody which has fragments derived from two different monoclonal antibodies and is capable of binding to two different epitopes. The two epitopes may present on the same antigen, or they may present on two different antigens.
- an “scFv dimer” is a bivalent diabody or bispecific scFv (BsFv) comprising V H -V L (linked by a peptide linker) dimerized with another VH-VL moiety such that VH's of one moiety coordinate with the VL's of the other moiety and form two binding sites which can target the same antigens (or epitopes) or different antigens (or epitopes).
- an “scFv dimer” is a bispecific diabody comprising V H1 -V L2 (linked by a peptide linker) associated with V L1 -V H2 (also linked by a peptide linker) such that V H1 and V L1 coordinate and V H2 and V L2 coordinate and each coordinated pair has a different antigen specificity.
- a “dsFv” refers to a disulfide-stabilized Fv fragment that the linkage between the variable region of a single light chain and the variable region of a single heavy chain is a disulfide bond.
- a “(dsFv) 2 ” or “(dsFv-dsFv')” comprises three peptide chains: two V H moieties linked by a peptide linker (e.g. a long flexible linker) and bound to two V L moieties, respectively, via disulfide bridges.
- dsFv-dsFv' is bispecific in which each disulfide paired heavy and light chain has a different antigen specificity.
- the term “chimeric” as used herein, means an antibody or antigen-binding fragment, having a portion of heavy and/or light chain derived from one species, and the rest of the heavy and/or light chain derived from a different species.
- a chimeric antibody may comprise a constant region derived from human and a variable region from a non-human animal, such as from mouse. In a rabbit, a goat, a sheep, a guinea pig, or a hamster.
- the term “humanized” as used herein means that the antibody or antigen- binding fragment comprises CDRs derived from non-human animals, FR regions derived from human, and when applicable, the constant regions derived from human.
- affinity refers to the strength of non-covalent interaction between an immunoglobulin molecule (i.e. antibody) or fragment thereof and an antigen.
- K D value i.e., the ratio of dissociation rate to association rate (k off /k on ) when the binding between the antigen and antigen-binding molecule reaches equilibrium.
- K D may be determined by using any conventional method known in the art, including but are not limited to, surface plasmon resonance method, microscale thermophoresis method, HPLC-MS method and flow cytometry (such as FACS) method.
- a K D value of ⁇ 10 -6 M e.g.
- ⁇ 5x10 -7 M, ⁇ 2x10 -7 M, ⁇ 10 -7 M, ⁇ 5x10- 8 M, ⁇ 2x10 -8 M, ⁇ 10 -8 M, ⁇ 5x10 -9 M, ⁇ 4x10 -9 M, ⁇ 3x10 -9 M, ⁇ 2x10 -9 M, or ⁇ 10 -9 M) can indicate specific binding between an antibody or antigen binding fragments thereof and SIRP ⁇ (e.g. human SIRP ⁇ ).
- SIRP ⁇ e.g. human SIRP ⁇
- the ability to “compete for binding to human SIRP ⁇ ” as used herein refers to the ability of a first antibody or antigen-binding fragment to inhibit the binding interaction between human SIRP ⁇ and a second anti-SIRP ⁇ antibody to any detectable degree.
- an antibody or antigen-binding fragment that compete for binding to human SIRP ⁇ inhibits the binding interaction between human SIRP ⁇ and a second anti-SIRP ⁇ antibody by at least 85%, or at least 90%. In certain embodiments, this inhibition may be greater than 95%, or greater than 99%. amino acids on an antigen to which an antibody binds. Two antibodies may bind the same or a closely related epitope within an antigen if they exhibit competitive binding for the antigen. An epitope can be linear or conformational (i.e. including amino acid residues spaced apart).
- amino acid refers to an organic compound containing amine (-NH2) and carboxyl (-COOH) functional groups, along with a side chain specific to each amino acid.
- amino acids are also represented as standard single letter or three-letter codes in the present disclosure, which are summarized as follows. to replacing an amino acid residue with a different amino acid residue having a side chain with similar physiochemical properties.
- conservative substitutions can be made among amino acid residues with hydrophobic side chains (e.g. Met, Ala, Val, Leu, and Ile), among amino acid residues with neutral hydrophilic side chains (e.g. Cys, Ser, Thr, Asn and Gln), among amino acid residues with acidic side chains (e.g. Asp, Glu), among amino acid residues with basic side chains (e.g. His, Lys, and Arg), or among amino acid residues with aromatic side chains (e.g. Trp, Tyr, and Phe).
- conservative substitution usually does not cause significant change in the protein conformational structure, and therefore could retain the biological activity of a protein.
- homologous refers to nucleic acid sequences (or its complementary strand) or amino acid sequences that have sequence identity of at least 60% (e.g. at least 65%, 70%, 75%, 80%, 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) to another sequences when optimally aligned.
- Percent (%) sequence identity with respect to amino acid sequence (or nucleic acid sequence) is defined as the percentage of amino acid (or nucleic acid) residues in a candidate sequence that are identical to the amino acid (or nucleic acid) residues in a reference sequence, after aligning the sequences and, if necessary, introducing gaps, to achieve the maximum number of identical amino acids (or nucleic acids).
- percent (%) sequence identity of an amino acid sequence (or nucleic acid sequence) can be calculated by dividing the number of amino acid residues (or bases) that are identical relative to the reference sequence to which it is being compared by the total number of the amino acid residues (or bases) in the candidate sequence or in the reference sequence, whichever is shorter.
- amino acid residues may or may not be considered as identical residues.
- Alignment for purposes of determining percent amino acid (or nucleic acid) sequence identity can be achieved, for example, using publicly available tools such as BLASTN, BLASTp (available on the website of U.S. National Center 215:403–410 (1990); Stephen F. et al., Nucleic Acids Res., 25:3389–3402 (1997)), ClustalW2 (available on the website of European Bioinformatics Institute, see also, Higgins D.G. et al., Methods in Enzymology, 266:383-402 (1996); Larkin M.A.
- effector functions include: complement dependent cytotoxicity (CDC) mediated by interaction of antibodies and C1q on the C1 complex; antibody- dependent cell-mediated cytotoxicity (ADCC) mediated by binding of Fc region of an antibody to Fc receptor on an effector cell; and phagocytosis. Effector functions can be evaluated using various assays such as Fc receptor binding assay, C1q binding assay, and cell lysis assay.
- CDC complement dependent cytotoxicity
- ADCC antibody- dependent cell-mediated cytotoxicity
- Effector functions can be evaluated using various assays such as Fc receptor binding assay, C1q binding assay, and cell lysis assay.
- a polynucleotide or a polypeptide naturally present in a living animal is not “isolated,” but the same polynucleotide or polypeptide is “isolated” if it has been sufficiently separated from the coexisting materials of its natural state so as to exist in a substantially pure state.
- An “isolated nucleic acid sequence” refers to the sequence of an isolated nucleic acid molecule.
- an “isolated antibody or an antigen-binding fragment thereof” refers to the antibody or antigen-binding fragments thereof having a purity of at least 60%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% as determined by electrophoretic methods (such as SDS-PAGE, isoelectric focusing, chromatography or reverse phase HPLC).
- electrophoretic methods such as SDS-PAGE, isoelectric focusing, chromatography or reverse phase HPLC.
- vector refers to a vehicle into which a genetic element may be operably inserted so as to bring about the expression of that genetic element, such as to produce the protein, RNA or DNA encoded by the genetic element, or to replicate the genetic element.
- a vector may be used to transform, transduce, or transfect a host cell so as to bring about expression of the genetic element it carries within the host cell.
- vectors include plasmids, phagemids, cosmids, artificial chromosomes such as yeast artificial chromosome (YAC), bacterial artificial chromosome (BAC), or P1-derived artificial chromosome (PAC), bacteriophages such as lambda phage or M13 phage, and animal viruses.
- a vector may contain a variety of elements for controlling expression, including promoter sequences, transcription initiation sequences, enhancer sequences, selectable elements, and reporter genes.
- the vector may contain an origin of replication.
- a vector may also include materials to aid in its entry into the cell, including but not limited to a viral particle, a liposome, or a protein coating.
- a vector can be an expression vector or a cloning vector.
- the present disclosure provides vectors (e.g. expression vectors) containing the nucleic acid sequence provided herein encoding the antibody or an antigen-binding fragment thereof, at least one promoter (e.g. SV40, CMV, EF-1 ⁇ ) operably linked to the nucleic acid sequence, and at least one selection marker.
- the phrase “host cell” as used herein refers to a cell into which an exogenous polynucleotide and/or a vector can be or has been introduced.
- the term “subject” includes human and non-human animals. Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, mice, rats, cats, rabbits, sheep, dogs, cows, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably. viability, or metastatic activity.
- anti-tumor activity can be shown by a decline in growth rate of abnormal cells that arises during therapy or tumor size stability or reduction, or longer survival due to therapy as compared to control without therapy.
- Such activity can be assessed using accepted in vitro or in vivo tumor models, including but not limited to xenograft models, allograft models, mouse mammary tumor virus (MMTV) models, and other known models known in the art to investigate anti-tumor activity.
- accepted in vitro or in vivo tumor models including but not limited to xenograft models, allograft models, mouse mammary tumor virus (MMTV) models, and other known models known in the art to investigate anti-tumor activity.
- MMTV mouse mammary tumor virus
- Treating” or “treatment” of a disease, disorder or condition as used herein includes preventing or alleviating a disease, disorder or condition, slowing the onset or rate of development of a disease, disorder or condition, reducing the risk of developing a disease, disorder or condition, preventing or delaying the development of symptoms associated with a disease, disorder or condition, reducing or ending symptoms associated with a disease, disorder or condition, generating a complete or partial regression of a disease, disorder or condition, curing a disease, disorder or condition, or some combination thereof.
- diagnosis refers to the identification of a pathological state, disease or condition, such as identification of a SIRP ⁇ related disease, or refer to identification of a subject with a SIRP ⁇ related disease who may benefit from a particular treatment regimen.
- diagnosis contains the identification of abnormal amount or activity of SIRP ⁇ .
- diagnosis refers to the identification of a cancer or an autoimmune disease in a subject.
- biological sample refers to a biological composition that is obtained or derived from a subject of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example based on physical, biochemical, chemical and/or physiological characteristics.
- a biological sample includes, but is not limited to, cells, tissues, organs and/or biological fluids of a subject, obtained by any method known by those some embodiments, the fluid sample is whole blood, plasma, blood serum, mucus (including nasal drainage and phlegm), peritoneal fluid, pleural fluid, chest fluid, saliva, urine, synovial fluid, cerebrospinal fluid (CSF), thoracentesis fluid, abdominal fluid, ascites or pericardial fluid.
- the biological sample is a tissue or cell obtained from heart, liver, spleen, lung, kidney, skin or blood vessels of the subject.
- SIRP ⁇ refers to a regulatory membrane glycoprotein from signal regulatory protein (SIRP) family expressed mainly by myeloid cells, dendritic cells and also by stem cells or neurons.
- SIRP ⁇ signal regulatory protein
- the structure of SIRP ⁇ includes an extracellular domain and a cytoplasmic domain.
- the extracellular domain of SIRP ⁇ consists of a membrane-distal Ig variable-like (IgV) fold, and two membrane- proximal Ig constant-like (IgC) folds.
- the IgV domain of SIRP ⁇ is responsible for the binding of the extracellular Ig-domain of CD47.
- the SIRP ⁇ is human SIRP ⁇ .
- SIRP ⁇ The gene coding for human SIRP ⁇ is a polymorphic gene and several variants were described in human population.
- the most common protein variants are SIRP ⁇ v1 and SIRP ⁇ v2 (accession numbers NP_542970 (P78324) and CAA71403).
- SIRP ⁇ as used herein may be from other animal species, such as from mouse, and cynomolgus, among others.
- Exemplary sequence of Mus musculus (mouse) SIRP ⁇ protein is disclosed in NCBI Ref Seq No. NP_031573, or BAA20376.1, or BAA13521.1.
- Exemplary sequence of Cynomolgus (monkey) SIRP ⁇ protein is disclosed in NCBI Ref Seq No. NP_001271679.
- SIRPs family also comprise several other transmembrane glycoproteins, including, SIRP ⁇ and SIRP ⁇ .
- SIRP ⁇ encoded by SIRP beta gene, generates a positive signal by intracellular signaling of its cytoplasmic tail through its association with a transmembrane protein called DNAX activation protein 12 or DAP12.
- the cytoplasmic tail of DAP12 possesses immunoreceptor tyrosine-based named as SIRPg, is encoded by the SIRPG gene, and is highly homologous in the extracellular Ig domains to SIRP ⁇ and SIRP ⁇ , but the cytoplasmic tail of SIRP ⁇ is distinct. SIRP ⁇ was also shown to bind to CD47 but with a lower affinity than SIRP ⁇ .
- anti-SIRP ⁇ antibody refers to an antibody that is capable of specific binding to SIRP ⁇ (e.g. human or monkey SIRP ⁇ ).
- anti-human SIRP ⁇ antibody refers to an antibody that is capable of specific binding to human SIRP ⁇ .
- SIRP ⁇ related disease, disorder or condition refers to any disease or condition caused by, exacerbated by, or otherwise linked to increased or decreased expression or activities of SIRP ⁇ .
- the SIRP ⁇ related disease, disorder or condition is an immune-related disorder, such as, for example, an autoimmune disease.
- the SIRP ⁇ related disease, disorder or condition is a disorder related to excessive cell proliferation, such as, for example, cancer.
- the SIRP ⁇ related disease or condition is characterized in expressing or over-expressing of SIRP ⁇ gene and/or SIRP ⁇ signature genes.
- the SIRP ⁇ related disease or condition is characterized in expressing or over-expressing of CD47.
- the term “pharmaceutically acceptable” indicates that the designated carrier, vehicle, diluent, excipient(s), and/or salt is generally chemically and/or physically compatible with the other ingredients comprising the formulation, and physiologically compatible with the recipient thereof.
- the term “SIRP ⁇ -positive cell” as used herein refer to a cell (e.g. a phagocytic cell) that expresses SIRP ⁇ on the surface of the cell. In some embodiments, a “SIRP ⁇ -positive cell” may also express SIRP ⁇ or SIRP ⁇ on the surface of the cell. [0097] Anti-SIRP ⁇ Antibodies fragments thereof.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments provided herein are capable of specific binding to SIRP ⁇ .
- the antibodies and the antigen-binding fragments thereof provided herein specifically bind to human SIRP ⁇ at an K D value of no more than 10 -7 M, no more than 8 ⁇ 10 -8 M, no more than 5 ⁇ 10 -8 M, no more than 2 ⁇ 10 -8 M, no more than 8 ⁇ 10 -9 M, no more than 5 ⁇ 10 -9 M, no more than 2 ⁇ 10 -9 M, no more than 10 -9 M, no more than 8 ⁇ 10 -10 M, no more than 7 ⁇ 10 -10 M, or no more than 6 ⁇ 10- 10 M, or no more than 5 ⁇ 10 -10 M, or no more than 4 ⁇ 10 -10 M using Bio-Layer Interferometry technology (Octet system).
- Octet system is based on bio-layer interferometry (BLI) technology, see, for example, Sultana A. et al., Current protocols in protein science, 02 Feb 2015, 79:19.25.1-19.25.26.
- the K D value is measured by the method as described in Example 5.2.5 of the present disclosure.
- Binding of the antibodies or the antigen-binding fragments thereof provided herein to human SIRP ⁇ can also be represented by “half maximal effective concentration” (EC 50 ) value, which refers to the concentration of an antibody where 50% of its maximal binding is observed.
- EC 50 half maximal effective concentration
- the EC 50 value can be measured by binding assays known in the art, for example, direct or indirect binding assay such as enzyme- linked immunosorbent assay (ELISA), flow cytometry assay, and other binding assay.
- ELISA enzyme- linked immunosorbent assay
- the antibodies and the antigen-binding fragments thereof provided herein specifically bind to human SIRP ⁇ v1 or human SIRP ⁇ v2 at an EC 50 (i.e.50% binding concentration) of no more than 0.5 nM, no more than 0.2 nM, no more than 0.1 nM, no more than 0.09 nM, no more than 0.08 nM, no more than 0.07 nM, no more than 0.06 nM or no more than 0.05 nM as measured by enzyme-linked immunosorbent assay (ELISA).
- ELISA enzyme-linked immunosorbent assay
- the antibodies and the antigen-binding fragments thereof provided herein specifically bind to human SIRP ⁇ v1at an EC 50 of no more more than 1.0 nM) as measured by FACS assay.
- the antibodies and the antigen-binding fragments thereof provided herein specifically bind to human SIRP ⁇ v2 at an EC 50 of no more than 12.1 nM (e.g.
- the antibodies and antigen-binding fragments thereof provided herein has no specific binding to mouse SIRP ⁇ .
- An antibody or antigen-binding fragment thereof that with “no specific binding” to mouse SIRP ⁇ is one that exhibits no detectable binding to mouse SIRP ⁇ or exhibits a binding to mouse SIRP ⁇ at a level comparable to that a control antibody under equivalent assay conditions.
- a control antibody can be any antibody that is known not to bind to mouse SIRP ⁇ .
- the antibodies and antigen-binding fragments thereof provided herein specifically bind to SIRP ⁇ at an EC 50 of no more than 40 nM (e.g. no more than 30 nM, no more than 1 nM, no more than 0.9 nM, no more than 0.8 nM, no more than 0.7 nM, no more than 0.4 nM) as measured by FACS assay.
- the antibodies and antigen-binding fragments thereof provided herein specifically bind to SIRP ⁇ ECD at an EC 50 of no more than 3 nM (e.g., no more than 2 nM, no more than 0.9 nM, no more than 0.8 nM, no more than 0.7 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.1 nM, no more than 0.05 nM,) as measured by ELISA assay.
- the antibodies and antigen-binding fragments thereof provided herein bind to SIRP ⁇ at an EC 50 of no more than 80 nM (e.g.
- fragment thereof provided herein are capable of completely blocking interaction between SIRP-alpha and CD47.
- completely block interaction between two interacting molecules, it is meant that an antibody is capable of inhibiting at least 80% binding between the two interacting molecules, or capable of inhibiting at least 50% signal transduction induced by interaction of the two molecules.
- the signal transduction induced by interaction between SIRP-alpha and CD47 can be characterized by SHP1 recruitment to intracellular portion (e.g. C-terminal tail) of SIRP-alpha.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein capable of completely blocking interaction between SIRP-alpha v1 and CD47.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of blocking at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% of the binding between SIRP- alpha v1 and CD47 as measured by competitive ELISA assay.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of blocking at least 97% or at least 98% of the binding between SIRP-alpha v1 and CD47 as measured by competitive FACS assay.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of blocking interaction between SIRP-alpha v1 and CD47 at an IC50 of no more than 4nM (or no more than 3nM), as measured by competitive ELISA assay or at an IC50 of no more than 0.6nM (or no more than 0.5nM), as measured by competitive FACS assay.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein capable of completely blocking interaction between SIRP-alpha v2 and CD47.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of blocking at least 80%, 85%, 90%, 95%, 96%, 97% or 98% of the binding between SIRP-alpha v2 and CD47 as measured by competitive ELISA assay. In certain embodiments, the anti- blocking at least 98% or at least 99% of the binding between SIRP-alpha v2 and CD47 as measured by competitive FACS assay.
- the anti- SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein capable of blocking interaction between SIRP-alpha v2 and CD47 at an IC50 of no more than 55nM (or no more than 6nM, no more than 5nM, no more than 3nM or no more than 2nM), as measured by competitive ELISA assay or at an IC50 of no more than 3nM (or no more than 2nM), as measured by competitive FACS assay.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of blocking the binding at least 50%, 60%, 70%, or 80% of signal transduction induced by interaction of SIRP-alpha and CD47.
- an antibody may block signal transduction induced by interaction between SIRP-alpha and CD47, but does not significantly block binding between the SIRP-alpha and CD47.
- SIRP-alpha and CD47 can bind to each other in the presence of such an anti-SIRP-alpha antibody, they are rendered less effective in signal transduction.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein have no significant inhibition on IFN ⁇ secretion by T cells, CD4 + T cell proliferation or CD8 + T cell proliferation. It has been reported that adhesion of human T cells to antigen-presenting cells through SIRP ⁇ -CD47 interaction co-stimulates T cell proliferation.
- T cell proliferation can be determined using methods known in the art, for example, by T cell proliferation assay such as those described in Example 4.2.9 of the present disclosure, for example, by using CellTrace Violet (Life Technologies) labelling to determine proliferation population.
- the antibodies or antigen-binding fragment thereof provided herein do not significantly reduce proliferation of CD4 + T cells or CD8 + T cells or impact IFN ⁇ secretion. fragment thereof provided herein show no more than 50% (or no more than 40%, no more than 30%, no more than 20%, or no more than 10%) inhibition on the IFN ⁇ secretion by T cells, CD4 + T cell proliferation or CD8 + T cell proliferation, relative to a control level obtained with a control antibody (e.g.
- the anti- SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein show no detectable inhibition on IFN ⁇ secretion by T cells, CD4 + T cell proliferation or CD8 + T cell proliferation.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein as a single agent do not induce phagocytosis of certain CD47-expressing cell such as Raji cell.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein is capable of increasing antibody-dependent cellular phagocytosis (ADCP) effect of a target antibody.
- ADCP antibody-dependent cellular phagocytosis
- the target antibody binds to a target antigen expressed on the target cell, and the ADCP effects of the target antibody on the target cell is increased.
- the target cell also expresses CD47.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of binding to an epitope comprising an amino acid sequence of YNQKEGHFPRVTTVSDL (SEQ ID NO: 36).
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of binding to an epitope comprising an amino acid sequence of SGAGTEL (SEQ ID NO: 72), and/or TNVDPVGESVS (SEQ ID NO: 87).
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein are capable of binding to an epitope comprising an amino acid sequence of TNVDPVGESVSY (SEQ ID NO: 90).
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising one or more (e.g.1, 2, 3, 4, 5, or 6) CDRs sequences of antibodies 005, 015, 025, 042, 071, 073 and/or 059.
- the present disclosure provides chimeric antibodies, humanized antibodies, antibody derivatives and antibody variants of antibodies 005, 015, 025, 042, 071, 073 and/or 059.
- Antibody “005” and “005c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 49, and a light chain variable region having the amino acid sequence of SEQ ID NO: 50.
- Antibody “015” and “015c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the amino acid sequence of SEQ ID NO: 51, and a light chain variable region having the amino acid sequence of SEQ ID NO: 52.
- Antibody “025” and “025c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the sequence of SEQ ID NO: 53, and a light chain variable region having the sequence of SEQ ID NO: 54.
- Antibody “042” and “042c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the sequence of SEQ ID NO: 55, and a light chain variable region having the sequence of SEQ ID NO: 56.
- Antibody “059” and “059c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the sequence of SEQ ID NO: 57, and a light chain variable region having the sequence of SEQ ID NO: 58.
- monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the sequence of SEQ ID NO: 59, and a light chain variable region having the sequence of SEQ ID NO: 60.
- Antibody “073” and “073c” as used herein respectively refers to a monoclonal hybridoma antibody and chimeric antibody comprising a heavy chain variable region having the sequence of SEQ ID NO: 61, and a light chain variable region having the sequence of SEQ ID NO: 62.
- Table 1 below shows the CDR amino acid sequences of antibodies 005, 015, 025, 042, 071, 073, 059, 005c, 015c, 025c, 042c, 059c, 071c and 073.
- CDR boundaries in Table 1 were defined or identified by the convention of Kabat, although a skilled person in the art can appreciate that CDRs can also be defined using other conventions such as IMGT, Chothia, or Al-Lazikani, or can be defined in a mixed way using two or more conventions.
- Table 2 shows the heavy chain and light chain variable region amino acid sequences of antibodies 005, 015, 025, 042, 071, 073, 059, 005c, 015c, 025c, 042c, 059c, 071c and 073. [00129] Table 1. CDR amino acid sequences of 7 antibodies
- each of antibodies 005, 015, 025, 042, 059, 071, 073, 005c, 015c, 025c, 042c, 059c, 071c and 073 can bind to SIRP ⁇ and that antigen-binding specificity is provided primarily by the CDR1, CDR2 and CDR3 regions
- the HCDR1, HCDR2 and HCDR3 sequences and LCDR1, LCDR2 and LCDR3 sequences of antibodies 005, 015, 025, 042, 059, 071, 073, 005c, 015c, 025c, 042c, 059c, 071c and 073 can be “mixed and matched” (i.e., CDRs from different antibodies can be mixed and matched, but each antibody must contain a HCDR1, HCDR2 and HCDR3 and a LCDR1, LCDR2 and LCDR3) to create anti-SIRP ⁇ binding molecules of the present disclosure.
- SIRP ⁇ binding of such “mixed and matched” antibodies can be tested using the binding assays described above and in the Examples.
- the HCDR1, HCDR2 and/or HCDR3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence (s).
- the LCDR1, LCDR2 and/or LCDR3 sequence from a particular VL sequence preferably is replaced with a structurally similar CDR sequence (s).
- VH and VL sequences can be created by substituting one or more VH and/or VL CDR region sequences with structurally similar sequences from the CDR sequences disclosed herein for monoclonal hybridoma antibodies 005, 015, 025, 042, 059, 071 and 073 or for chimeric antibodies 005c, 015c, 025c, 042c, 059c, 071c and 073c.
- HCDR1 comprising the sequence selected from the group consisting of SEQ ID NOs: 1, 7, 13, 18, 22 and 43
- HCDR2 comprising the sequence selected from the group consisting of SEQ ID NOs: 2, 8, 14, 17, 19, 23, 28, 33, 38 and 44
- HCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 3, 9, 15, 20, 24, 29, 34, 39 and 45
- LCDR1 comprising the sequence selected from the group consisting of SEQ ID NOs: 4, 10, 25, 30, 35, 40 and 46
- LCDR2 comprising the sequence selected from the group consisting of SEQ ID NOs: 5, 11, 26, 31, 41 and 47
- LCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 6, 12, 16, 21, 27, 32, 37, 42 and 48.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising the HCDR1 comprises an amino acid sequence of X1YYMH (SEQ ID NO: 18); the HCDR2 comprises an amino acid sequence of RIDPEDX 2 EX 3 KYAPKFQG (SEQ ID NO: 19); the HCDR3 comprises an amino acid sequence of GX 18 X 4 X 5 Y (SEQ ID NO: 20); the LCDR1 comprises an amino acid sequence of SEQ ID NO: 10; the LCDR2 comprises an amino acid sequence of SEQ ID NO: 11, and the LCDR3 comprises an amino acid sequence of X 6 QWSSYPYT (SEQ ID NO: 21), wherein X 1 is A or D; X 2 is G or A; X 3 is T or S; X 4 is L or Y; X 5 is E or A; X 6 is Y or H; and X 18 is S or absent.
- X 1 is A or D
- X 2 is G or A
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising HCDR1 comprising the sequence selected from the group consisting of SEQ ID NOs: 7 and 13; and/or HCDR2 comprising the sequence selected from the group consisting of SEQ ID NOs: 8, 14, and 17; and/or HCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 9 and 15; and/or LCDR1 comprising the sequence of SEQ ID NO: 10; and/or LCDR2 comprising the sequence of SEQ ID NO: 11; and/or LCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 12 and 16.
- the HCDR1 comprises an amino acid sequence of SEQ ID NO: 22; the HCDR2 comprises an amino acid sequence of WINTYSGVX19TX7ADDFX8G (SEQ ID NO: 38); the HCDR3 comprises an amino acid sequence of DPHX 9 YGX 10 SPAWFX 11 Y (SEQ ID NO: 39); the LCDR1 comprises an amino acid sequence of X 12 ASQX 13 VGIX 14 VA (SEQ ID NO: 40); the LCDR2 comprises an amino acid sequence of SASNRX 15 T (SEQ ID NO: 41); and the LCDR3 comprises an amino acid sequence of QQYSX16YPX17T (SEQ ID NO: 42), wherein X 7 is Y or C; X 8 is K or Q; X 9 is Y or S; X 10 is N or T or S; X 11 is P or A or V; X 12 is E or K; X 13 is N or I; X 14 is S or A;
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising HCDR1 comprising the sequence of SEQ ID NO: 22; and/or HCDR2 comprising the sequence selected from the group consisting of SEQ ID NOs: 23, 28, and 33; and/or HCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 24, 29, and 34; and/or LCDR1 comprising the sequence of SEQ ID NO: 25, 30, and 35; and/or LCDR2 comprising selected from the group consisting of SEQ ID NOs: 31, and 26; and/or LCDR3 comprising the sequence selected from the group consisting of SEQ ID NOs: 27, 32 and 37.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 1, a HCDR2 comprising the sequence of SEQ ID NO: 2, a HCDR3 comprising the sequence of SEQ ID NO: 3, a LCDR1 comprising the sequence of SEQ ID NO: 4, a LCDR2 comprising the sequence of SEQ ID NO: 5, and a LCDR3 comprising the sequence of SEQ ID NO: 6.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 7, a HCDR2 comprising the sequence of SEQ ID NO: 8, sequence of SEQ ID NO: 10, a LCDR2 comprising the sequence of SEQ ID NO: 11, and a LCDR3 comprising the sequence of SEQ ID NO: 12.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 13, a HCDR2 comprising the sequence of SEQ ID NO: 14 or 17, a HCDR3 comprising the sequence of SEQ ID NO: 15, a LCDR1 comprising the sequence of SEQ ID NO: 10, a LCDR2 comprising the sequence of SEQ ID NO: 11, and a LCDR3 comprising the sequence of SEQ ID NO: 16.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 22, a HCDR2 comprising the sequence of SEQ ID NO: 23, a HCDR3 comprising the sequence of SEQ ID NO: 24, a LCDR1 comprising the sequence of SEQ ID NO: 25, a LCDR2 comprising the sequence of SEQ ID NO: 26, and a LCDR3 comprising the sequence of SEQ ID NO: 27.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 22, a HCDR2 comprising the sequence of SEQ ID NO: 28, a HCDR3 comprising the sequence of SEQ ID NO: 29, a LCDR1 comprising the sequence of SEQ ID NO: 30, a LCDR2 comprising the sequence of SEQ ID NO: 31, and a LCDR3 comprising the sequence of SEQ ID NO: 32.
- the present disclosure provides anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a HCDR1 comprising the sequence of SEQ ID NO: 22, a HCDR2 comprising the sequence of SEQ ID NO: 33, a HCDR3 comprising the sequence of SEQ ID NO: 34, a LCDR1 comprising the sequence of SEQ ID NO: 35, a LCDR2 comprising the sequence of SEQ ID NO: 26, and a LCDR3 comprising the sequence of SEQ ID NO: 37.
- HCDR1 comprising the sequence of SEQ ID NO: 43
- HCDR2 comprising the sequence of SEQ ID NO: 44
- a HCDR3 comprising the sequence of SEQ ID NO: 45
- LCDR1 comprising the sequence of SEQ ID NO: 46
- LCDR2 comprising the sequence of SEQ ID NO: 47
- LCDR3 comprising the sequence of SEQ ID NO: 48.
- CDRs are known to be responsible for antigen binding. However, it has been found that not all of the 6 CDRs are indispensable or unchangeable.
- the antibodies and antigen-binding fragments thereof provided herein comprise suitable framework region (FR) sequences, as long as the antibodies and antigen-binding fragments thereof can specifically bind to SIRP ⁇ .
- the CDR sequences provided in Table 1 above are obtained from mouse antibodies, but they can be grafted to any suitable FR sequences of any suitable species such as mouse, human, rat, rabbit, among others, using suitable methods known in the art such as recombinant techniques.
- the antibodies and antigen-binding fragments thereof provided herein are humanized.
- a humanized antibody or antigen-binding fragment is desirable in its reduced immunogenicity in human.
- a humanized antibody is chimeric in its variable regions, as non-human CDR sequences are grafted to human or substantially human FR sequences.
- Humanization of an antibody or antigen- binding fragment can be essentially performed by substituting the non-human (such as murine) CDR genes for the corresponding human CDR genes in a human immunoglobulin gene (see, for example, Jones et al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature 332:323-327; Verhoeyen et al. (1988) Science 239:1534-1536). selected to achieve this purpose using methods known in the art.
- “best-fit” approach can be used, where a non-human (e.g.
- rodent antibody variable domain sequence is screened or BLASTed against a database of known human variable domain sequences, and the human sequence closest to the non-human query sequence is identified and used as the human scaffold for grafting the non- human CDR sequences (see, for example, Sims et al., (1993) J. Immunol.151:2296; Chothia et al. (1987) J. Mot. Biol.196:901).
- a framework derived from the consensus sequence of all human antibodies may be used for the grafting of the non-human CDRs (see, for example, Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J.
- Table 3 below shows the CDR amino acid sequences of 5 humanized antibodies for antibody 025, which are designated as hu025.021, hu025.023, hu025.033, hu025.059 and hu025.060.
- the CDR boundaries were defined or identified by the convention of Kabat.
- Table 3 below shows the amino acid sequences for the six CDRs of 5 humanized antibodies hu025.021, hu025.023, hu025.033, hu025.059 and hu025.060.
- Table 4 below shows the heavy chain and light chain variable region amino acid sequences of 5 humanized antibodies hu025.021, hu025.023, hu025.033, hu025.059 and hu025.060.
- Table 5 shows the FR amino acid sequences of 5 humanized antibodies hu025.021, hu025.023, hu025.033, hu025.059 and hu025.060.
- Table 3. CDR amino acid sequences of 5 humanized antibodies
- Table 4 Variable region amino acid sequences of 5 humanized antibodies [00151] Table 5.
- FR amino acid sequences of 5 humanized antibodies X 20 is A or V; X 21 is N or D; X 22 is Y or F.
- the humanized antibodies or antigen-binding fragments thereof provided herein are composed of substantially all human sequences except for the CDR sequences which are non-human.
- the variable region FRs, and constant regions if present are entirely or substantially from human immunoglobulin sequences.
- the human FR sequences and human constant region sequences may be derived from different human immunoglobulin genes, for example, FR sequences derived from one human antibody and constant region from another human antibody.
- the humanized antibody or antigen- binding fragment thereof comprises human heavy chain HFR1-4, and/or light chain LFR1-4.
- the FR regions derived from human may comprise the same amino acid sequence as the human immunoglobulin from which it is derived.
- one or more amino acid residues of the human FR are substituted with the corresponding residues from the parent non-human antibody. This may be desirable in certain embodiments to make the humanized antibody or its fragment closely approximate the non-human parent antibody structure, so as to optimize binding characteristics (for example, increase binding affinity).
- the humanized antibody or antigen-binding fragment thereof provided herein comprises no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in each of the human FR sequences, or no more than 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid residue substitutions in all the FR sequences of a heavy or a light chain variable domain.
- such change in amino acid residue could be present in heavy chain FR regions only, in light chain FR regions only, or in both chains.
- one or more amino acids of the human FR sequences are randomly mutated to increase binding affinity.
- corresponding amino acid(s) of the parent non-human antibody so as to increase binding affinity.
- the present disclosure also provides humanized anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a heavy chain HFR1 comprising the sequence of EVQLVQSGAEVKKPGATVKISCKX20SGFNIK (SEQ ID NO: 84) or a homologous sequence of at least 80% sequence identity thereof, a heavy chain HFR2 comprising the sequence of WVQQAPGKGLEWIG (SEQ ID NO: 74) or a homologous sequence of at least 80% sequence identity thereof, a heavy chain HFR3 comprising the sequence of RVTITADTSTX21TAYMELSSLRSEDTAVYYCDR (SEQ ID NO: 85) or a homologous sequence of at least 80% sequence identity thereof, and a heavy chain HFR4 comprising the sequence of WGQGTLVTVSS (SEQ ID NO: 76) or a homologous sequence of at least 80% sequence identity thereof, wherein X 20 is A or V; X 21 is N or D
- the present disclosure also provides humanized anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a light chain LFR1 comprising the sequence of EIVLTQSPATLSLSPGERATLSC (SEQ ID NO: 77) or a homologous sequence of at least 80% sequence identity thereof, a light chain LFR2 comprising the sequence of WYQQKPGQAPKLWIY (SEQ ID NO: 78) or a homologous sequence of at least 80% sequence identity thereof, a light chain LFR3 comprising the sequence of GIPARFSGSGSGTDX 22 TLTISSLEPEDFAVYYC (SEQ ID NO: 86) or a homologous sequence of at least 80% sequence identity thereof, and a light chain LFR4 comprising the sequence of FGQGTKLEIK (SEQ ID NO: 80) or a homologous sequence of at least 80% sequence identity thereof, wherein X 22 is Y or F.
- a light chain LFR1 comprising the sequence of EIVLTQSPATL
- the present disclosure also provides humanized anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising a heavy chain HFR1 comprising a sequence selected from the group consisting of SEQ ID heavy chain HFR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 75, and 82, and a heavy chain HFR4 comprising a sequence of SEQ ID NO: 76; and/or a light chain LFR1 comprising a sequence from the group consisting of SEQ ID NO: 77, a light chain LFR2 comprising a sequence selected from the group consisting of SEQ ID NOs: 78, a light chain LFR3 comprising a sequence selected from the group consisting of SEQ ID NOs: 79 and 81, and a light chain LFR4 comprising a sequence selected from the group consisting of SEQ ID NO: 80.
- a heavy chain HFR1 comprising a sequence selected from the group consisting of SEQ ID heavy chain HFR3 comprising a sequence selected from the group consisting of
- the present disclosure also provides humanized anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising HFR1, HFR2, HFR3, and/or HFR4 sequences contained in a heavy chain variable region selected from a group consisting of: hu025.021-VH/ hu025.023-VH (SEQ ID NO: 63), hu025.033-VH (SEQ ID NO: 65) and hu025.059-VH/ hu025.060-VH (SEQ ID NO: 67).
- the present disclosure also provides humanized anti-SIRP ⁇ antibodies and antigen-binding fragments thereof comprising LFR1, LFR2, LFR3, and/or LFR4 sequences contained in a light chain variable region selected from a group consisting of: hu025.021-VL/ hu025.033-VL/ hu025.059-VL (SEQ ID NO: 64), and hu025.023-VL/ hu025.060-VL (SEQ ID NO: 66).
- the humanized anti-SIRP ⁇ antibodies and antigen- binding fragments thereof provided herein comprise a heavy chain variable domain sequence selected from the group consisting of SEQ ID NO: 63, SEQ ID NO: 65, and SEQ ID NO: 67; and/or a light chain variable domain sequence selected from the group consisting of SEQ ID NO: 64 and SEQ ID NO: 66.
- the present disclosure also provides exemplary humanized antibodies of 025, including: 1) antibody “hu025.021” comprising the heavy chain variable region of SEQ ID NO: 63 and the light chain variable region of SEQ ID NO: 64; 63, and the light chain variable region of SEQ ID NO: 66; 3) antibody “hu025.033” comprising the heavy chain variable region of SEQ ID NO: 65, and the light chain variable region of SEQ ID NO: 64; 4) antibody “hu025.059” comprising the heavy chain variable region of SEQ ID NO: 67, and the light chain variable region of SEQ ID NO: 64; and 5) antibody “hu025.060” comprising the heavy chain variable region of SEQ ID NO: 67, and the light chain variable region of SEQ ID NO: 66.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments provided herein comprise all or a portion of the heavy chain variable domain and/or all or a portion of the light chain variable domain.
- the anti-SIRP ⁇ antibody or an antigen-binding fragment thereof provided herein is a single domain antibody which consists of all or a portion of the heavy chain variable domain provided herein. More information of such a single domain antibody is available in the art (see, e.g. U.S. Pat.
- the anti-SIRP ⁇ antibodies or the antigen-binding fragments thereof provided herein further comprise an immunoglobulin (Ig) constant region, which optionally further comprises a heavy chain and/or a light chain constant region.
- the heavy chain constant region comprises CH1, hinge, and/or CH2-CH3 regions (or optionally CH2-CH3-CH4 regions).
- the anti-SIRP ⁇ antibodies or the antigen-binding fragments thereof provided herein comprises heavy chain constant regions of human IgG1, IgG2, IgG3, or IgG4.
- the light chain constant region comprises C ⁇ or C ⁇ .
- the heavy chain constant region comprises an Fc region.
- Fc region is known to mediate effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) of the antibody.
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- Fc regions of different Ig isotypes have different abilities to induce effector functions. For example, Fc regions of IgG1 and IgG3 have been recognized to induce both ADCC and CDC more effectively than those of IgG2 and IgG4.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments thereof provided herein comprises an Fc region of IgG1 or IgG3 isotype, which could induce ADCC or CDC; or alternatively, a constant region of IgG4 or IgG2 isotype, which has reduced or depleted effector function.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein comprise a wild type human IgG4 Fc region or other wild type human IgG4 alleles.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein has reduced effector functions.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein comprise an Fc region of IgG1 isotype and comprise one or more amino acid substitution(s) to reduce or eliminate effector functions.
- exemplary of such substitution(s) in IgG1 can be at a position selected from the group consisting of: 234, 235, 237, and 238, 268, 297, 309, 330, and 331.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein is of IgG1 isotype and comprise one or more amino acid substitution(s) selected from the group consisting of: N297A, N297Q, N297G, L235E, L234A, L235A, L234F, L235E, P331S, and any combination thereof.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein is of IgG2 isotype, and comprises one or more amino acid substitution(s) to reduce or eliminate effector functions, selected from the group consisting of: H268Q, V309L, A330S, P331S, V234A, G237A, P238S, V234A/G237A/P238S/H268A/V309L/A330S/ P331S).
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein is of IgG4 isotype, and comprises one or more amino acid substitution(s) to reduce or eliminate effector functions.
- substitution(s) in IgG4 can be at a position selected from the group consisting of: 228, 234, 235,237, 238, 265, 297, 322, 329 and 331.
- substitution(s) include without limitation, S228P, L235E, L234A, L235A, N297A, N297Q, N297G, P329G, K322Q, P331S, D265A, G237A, P238S, and any combination thereof.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments provided herein is of IgG4 isotype and comprises one or more amino acid substitution(s) at one or more points of 228 and 235.
- the anti- SIRP ⁇ antibodies and antigen-binding fragments provided herein is of IgG4 isotype and comprises S228P mutation in the Fc region. In certain embodiments, the anti- SIRP ⁇ antibodies and antigen-binding fragments provided herein is of IgG4 isotype and comprises L235E mutation in the Fc region. [00169] In certain embodiments, the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein is of IgG2/IgG4 cross isotype. Examples of IgG2/IgG4 cross isotype is described in Rother RP et al., Nat Biotechnol 25:1256– 1264 (2007).
- the antibodies or the antigen-binding fragments thereof provided herein have a specific binding affinity to human SIRP ⁇ which is sufficient to provide for diagnostic and/or therapeutic use.
- the antibodies or antigen-binding fragments thereof provided herein can be a monoclonal antibody, a polyclonal antibody, a humanized antibody, a chimeric antibody, a recombinant antibody, a bispecific antibody, a multi-specific antibody, a labeled antibody, a bivalent antibody, an anti-idiotypic antibody, or a fusion protein. rather than in animals.
- the present disclosure provides an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, which competes for binding to SIRP ⁇ with the antibody or antigen-binding fragment thereof provided herein.
- the present disclosure provides an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 53, and a light chain variable region comprising the sequence of SEQ ID NO: 54.
- the present disclosure provides an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 55, and a light chain variable region comprising the sequence of SEQ ID NO: 56.
- the present disclosure provides an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, which competes for binding to human SIRP ⁇ with an antibody comprising a heavy chain variable region comprising the sequence of SEQ ID NO: 61, and a light chain variable region comprising the sequence of SEQ ID NO: 62.
- the present disclosure provides an anti-SIRP ⁇ antibody or antigen-binding fragment thereof, which binds to an epitope different from that bound by HEFLB or hu1H9G4.
- HEFLB refers to an antibody or antigen binding fragment thereof comprising a heavy chain variable region having an amino acid sequence of SEQ ID NO: 68, and a light chain variable region having an amino acid sequence of SEQ ID NO: 69. thereof comprising a heavy chain variable region having an amino acid sequence of SEQ ID NO: 70, and a light chain variable region having an amino acid sequence of SEQ ID NO: 71.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6 shows the VH and VL amino acid sequences of HEFLB and hu1H9G4.
- Table 6
- the antibody variants retain binding specificity to SIRP ⁇ modification(s) or substitution(s).
- the antibody variants may have improved antigen-binding affinity, improved glycosylation pattern, reduced risk of glycosylation, reduced deamination, reduced or depleted effector function(s), improved FcRn receptor binding, increased pharmacokinetic half-life, pH sensitivity, and/or compatibility to conjugation (e.g. one or more introduced cysteine residues).
- the parent antibody sequence may be screened to identify suitable or preferred residues to be modified or substituted, using methods known in the art, for example “alanine scanning mutagenesis” (see, for example, Cunningham and Wells (1989) Science, 244:1081-1085).
- target residues e.g. charged residues such as Arg, Asp, His, Lys, and Glu
- a neutral or negatively charged amino acid e.g. alanine or polyalanine
- substitution at a particular amino acid location demonstrates an interested functional change, then the position can be identified as a potential residue for modification or substitution.
- the potential residues may be further assessed by substituting with a different type of residue (e.g. cysteine residue, positively charged residue, etc.).
- Affinity variants of antibodies may contain modifications or substitutions in one or more CDR sequences as provided in Tables 1 and 3 above, one or more FR sequences as provided in Table 5 above, or the heavy or light chain variable region sequences provided in Tables 2 and 4 above.
- FR sequences can be readily identified by a person skilled in the art based on the CDR sequences in Tables 1 and 3 above and variable region sequences in Tables 2 and 4 above, as it is well-known in the art that a CDR region is flanked by two FR regions in the variable region.
- the affinity variants retain specific binding affinity to SIRP ⁇ of the parent antibody, or even have improved SIRP ⁇ specific binding affinity over the parent antibody.
- At least one (or all) of the substitution(s) in the CDR sequences, FR sequences, or variable region sequences comprises a conservative substitution.
- one or more amino acid residues may be substituted yet the resulting antibody or antigen-binding fragment still retain the binding affinity or binding capacity to SIRP ⁇ , or even have an improved binding affinity or capacity.
- a library of antibody variants such as Fab or scFv variants
- phage display technology can be generated and expressed with phage display technology, and then screened for the binding affinity to human SIRP ⁇ .
- the humanized antibody or antigen-binding fragment thereof provided herein comprises one or more amino acid residue substitutions in one or more of the CDR sequences, and/or one or more of the FR sequences.
- an affinity variant comprises no more than 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substitutions in the CDR sequences and/or FR sequences in total.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof comprise 1, 2, or 3 CDR sequences having at least 80% (e.g. at least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) sequence identity to that (or those) listed in Tables 1 and 3 above yet retaining the specific binding affinity to SIRP ⁇ at a level similar to or even higher than its parent antibody.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof comprise one or more variable region sequences having at least 80% (e.g.
- substitutions, insertions, or deletions occur in regions outside the CDRs (e.g. in the FRs).
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein also encompass glycosylation variants, which can be obtained to either increase or decrease the extent of glycosylation of the antibodies or antigen binding fragments thereof.
- the antibodies or antigen binding fragments thereof may comprise one or more modifications that introduce or remove a glycosylation site.
- a glycosylation site is an amino acid residue with a side chain to which a carbohydrate moiety (e.g. an oligosaccharide structure) can be attached.
- Glycosylation of antibodies is typically either N-linked or O-linked.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue, for example, an asparagine residue in a tripeptide sequence such as asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline.
- O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly to serine or threonine.
- the anti-SIRP ⁇ antibodies and antigen-binding fragments provided herein comprise a mutation at N297 (e.g. N297A, N297Q, or N297G) to remove the glycosylation site.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein also encompass cysteine-engineered variants, which comprise one or more introduced free cysteine amino acid residues.
- a free cysteine residue is one which is not part of a disulfide bridge.
- a cysteine-engineered variant is useful for conjugation with for example, a cytotoxic and/or imaging compound, a label, or a radioisoptype among others, at the site of the engineered cysteine, through for example a maleimide or haloacetyl.
- Methods for engineering antibodies or antigen-binding fragments thereof to introduce free cysteine residues are known in the art, see, for example, WO2006/034488.
- Fc Variants The anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein also encompass Fc variants, which comprise one or more amino acid residue modifications or substitutions at the Fc region and/or hinge region, for example, to provide for altered effector functions such as ADCC and CDC. Methods of altering ADCC activity by antibody engineering have been described in the art, see for example, Shields RL. et al., J Biol Chem.2001.276(9): 6591-604; Idusogie EE. et al., J Immunol.2000.164(8):4178-84; Steurer W.
- CDC activity of the antibodies or antigen-binding fragments provided herein can also be altered, for example, by improving or diminishing C1q binding and/or CDC (see, for example, WO99/51642; Duncan & Winter Nature 322:738-40 (1988); U.S. Pat. No.5,648,260; U.S. Pat. No.5,624,821; and WO94/29351 concerning other examples of Fc region variants).
- One or more amino acids selected from amino acid acid residue to alter Clq binding and/or reduced or abolished complement dependent cytotoxicity (CDC) see, U.S. Pat. No.6,194,551 by Idusogie et al.).
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein can be of IgG1, IgG2, IgG3, or IgG4 isotype and has reduced effector functions, as disclosed herein.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof comprise one or more amino acid substitution(s) that improves pH- dependent binding to neonatal Fc receptor (FcRn).
- Such a variant can have an extended pharmacokinetic half-life, as it binds to FcRn at acidic pH which allows it to escape from degradation in the lysosome and then be translocated and released out of the cell.
- Methods of engineering an antibody or antigen-binding fragment thereof to improve binding affinity with FcRn are well-known in the art, see, for example, Vaughn, D. et al., Structure, 6(1): 63-73, 1998; Kontermann, R. et al., Antibody Engineering, Volume 1, Chapter 27: Engineering of the Fc region for improved PK, published by Springer, 2010; Yeung, Y. et al., Cancer Research, 70: 3269-3277 (2010); and Hinton, P.
- anti-SIRP ⁇ antibodies or antigen-binding fragments thereof comprise one or more amino acid substitution(s) in the interface of the Fc region to facilitate and/or promote heterodimerization.
- modifications comprise introduction of a protuberance into a first Fc polypeptide and a cavity into a second Fc polypeptide, wherein the protuberance can be positioned in the cavity so as to promote interaction of the first and second Fc polypeptides to form a heterodimer or a complex.
- Antigen-binding Fragments types of antigen-binding fragments are known in the art and can be developed based on the anti-SIRP ⁇ antibodies provided herein, including for example, the exemplary antibodies whose CDRs are shown in Tables 1 and 3 above, and variable sequences are shown in Tables 2 and 4 above, and their different variants (such as affinity variants, glycosylation variants, Fc variants, cysteine-engineered variants and so on).
- an anti-SIRP ⁇ antigen-binding fragment provided herein is a diabody, a Fab, a Fab', a F(ab') 2 , a Fd, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv'), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a camelized single domain antibody, a nanobody, a domain antibody, and a bivalent domain antibody.
- Various techniques can be used for the production of such antigen-binding fragments.
- Illustrative methods include, enzymatic digestion of intact antibodies (see, e.g. Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)), recombinant expression by host cells such as E. Coli (e.g. for Fab, Fv and ScFv antibody fragments), screening from a phage display library as discussed above (e.g.
- the antigen-binding fragment is a scFv.
- Generation of scFv is described in, for example, WO 93/16185; U.S. Pat. Nos.5,571,894; and 5,587,458.
- ScFv may be fused to an effector protein at either the amino or the carboxyl terminus to provide for a fusion protein (see, for example, Antibody Engineering, ed.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof provided herein are bivalent, tetravalent, hexavalent, or multivalent. example, trivalent, tetravalent, hexavalent, and so on.
- a bivalent molecule can be monospecific if the two binding sites are both specific for binding to the same antigen or the same epitope. This, in certain embodiments, provides for stronger binding to the antigen or the epitope than a monovalent counterpart. Similar, a multivalent molecule may also be monospecific.
- the first valent of binding site and the second valent of binding site are structurally identical (i.e. having the same sequences), or structurally different (i.e. having different sequences albeit with the same specificity).
- a bivalent can also be bispecific, if the two binding sites are specific for different antigens or epitopes. This also applies to a multivalent molecule. For example, a trivalent molecule can be bispecific when two binding sites are monospecific for a first antigen (or epitope) and the third binding site is specific for a second antigen (or epitope).
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof is bispecific.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof is capable of specifically binding to a second antigen other than SIRP ⁇ .
- the second antigen is a tumor antigen, tumor surface antigen, or an infectious agent surface antigen.
- the second antigen is selected from the group consisting of CD19, CD20, CD22, CD24, CD25, CD30, CD33, CD38, CD44, CD52, CD56, CD70, CD96, CD97, CD99, CD123, CD279 (PD-1), CD274 (PD-L1), GPC-3, B7-H3, B7-H4, TROP2, CLDN18.2, EGFR, HER2, CD117, C-Met, PTHR2, and HAVCR2 (TIM3). fragments thereof provided herein are capable of specifically binding to a second epitope on SIRP ⁇ .
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof further comprise one or more conjugate moieties.
- the conjugate moiety can be linked to the antibodies or antigen-binding fragments thereof.
- a conjugate moiety is a moiety that can be attached to the antibody or antigen-binding fragment thereof. It is contemplated that a variety of conjugate moieties may be linked to the antibodies or antigen-binding fragments thereof provided herein (see, for example, “Conjugate Vaccines”, Contributions to Microbiology and Immunology, J. M. Cruse and R. E. Lewis, Jr. (eds.), Carger Press, New York, (1989)).
- conjugate moieties may be linked to the antibodies or antigen-binding fragments thereof by covalent binding, affinity binding, intercalation, coordinate binding, complexation, association, blending, or addition, among other methods.
- the antibodies or antigen-binding fragments thereof can be linked to one or more conjugates via a linker.
- the antibodies or antigen-binding fragments thereof provided herein may be engineered to contain specific sites outside the epitope binding portion that may be utilized for binding to one or more conjugate moieties.
- such a site may include one or more reactive amino acid residues, such as for example cysteine or histidine residues, to facilitate covalent linkage to a conjugate moiety.
- the antibodies or antigen-binding fragments thereof may be linked to a conjugate moiety indirectly, or through another conjugate moiety.
- the antibodies or antigen-binding fragments thereof provided herein may be conjugated to biotin, then indirectly conjugated to a second conjugate that is conjugated to avidin.
- the conjugate moiety comprises a chemotherapeutic agent, a toxin, a radioactive isotope, a lanthanide, a detectable label (e.g.
- a “toxin” can be any agent that is detrimental to cells or that can damage or kill cells.
- toxin examples include, without limitation, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, MMAE, MMAF, DM1, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin and analogs thereof, antimetabolites (e.g., taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, MMAE, MMAF, DM1, vinblastine, colchicin, doxorubi
- methotrexate 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine
- alkylating agents e.g. mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU)
- cyclothosphamide busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin
- anthracyclines e.g. daunorubicin (formerly daunomycin) and doxorubicin
- antibiotics e.g.
- detectable label may include a fluorescent labels (e.g. fluorescein, rhodamine, dansyl, phycoerythrin, or Texas Red), enzyme-substrate labels (e.g.
- the conjugate moiety can be a clearance-modifying agent which helps increase half-life of the antibody.
- Illustrative example include alcohol, polyvinyl pyrrolidone, copolymers of ethylene glycol/propylene glycol, and the like.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules.
- the conjugate moiety can be a purification moiety such as a magnetic bead.
- the antibodies or antigen-binding fragments thereof provided herein is used as a base for a conjugate.
- nucleic acid or “polynucleotide” as used herein refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double- stranded form. Unless otherwise indicated, a particular polynucleotide sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- DNA deoxyribonucleic acids
- RNA ribonucleic acids
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (see Batzer et al., Nucleic Acid Res.19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
- DNA encoding the monoclonal antibody is readily isolated and sequenced using conventional procedures (e.g. by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- the encoding DNA may also be obtained by synthetic methods.
- the isolated polynucleotide that encodes the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof can be inserted into a vector for further cloning the art. Many vectors are available.
- the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter (e.g. SV40, CMV, EF-1 ⁇ ), and a transcription termination sequence.
- the present disclosure provides vectors comprising the isolated polynucleotide provided herein.
- the polynucleotide provided herein encodes the antibodies or antigen-binding fragments thereof, at least one promoter (e.g. SV40, CMV, EF-1 ⁇ ) operably linked to the nucleic acid sequence, and at least one selection marker.
- promoter e.g. SV40, CMV, EF-1 ⁇
- vectors include, but are not limited to, retrovirus (including lentivirus), adenovirus, adeno-associated virus, herpesvirus (e.g. herpes simplex virus), poxvirus, baculovirus, papillomavirus, papovavirus (e.g.
- SV40 lambda phage, and M13 phage
- Vectors comprising the polynucleotide sequence encoding the antibody or antigen-binding fragment thereof can be introduced to a host cell for cloning or gene expression.
- Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above.
- Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram- positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g. E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g.
- yeast are suitable cloning or expression hosts for anti-SIRP ⁇ antibody-encoding vectors. Saccharomyces cerevisiae, or common baker’s yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g. K.
- lactis K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans, and K. marxianus; yarrowia (EP 402,226); Pichia pastoris (EP 183,070); Candida; Trichoderma reesia (EP 244,234); Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as, e.g.
- Suitable host cells for the expression of glycosylated antibodies or antigen- fragment thereof provided herein are derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruiffly), and Bombyx mori have been identified.
- a variety of viral strains for transfection are publicly available, e.g. the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
- Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
- interest has been greatest in vertebrate cells, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure.
- Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol.36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary sertoli cells (TM4, Mather, Biol.
- COS-7 monkey kidney CV1 line transformed by SV40
- human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol.36:59 (1977)
- baby hamster kidney cells BHK, ATCC CCL 10
- Chinese hamster ovary sertoli cells TM4, Mather, Biol.
- monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL- 1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci.
- the host cell is a mammalian cultured cell line, such as CHO, BHK, NS0, 293 and their derivatives.
- Host cells are transformed with the above-described expression or cloning vectors for anti-SIRP ⁇ antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- the antibody may be produced by homologous recombination known in the art.
- the host cell is capable of producing the antibody or antigen-binding fragment thereof provided herein.
- the present disclosure also provides a method of expressing the antibody or an antigen-binding fragment thereof provided herein, comprising culturing the host cell provided herein under the condition at which the vector of the present disclosure is expressed.
- the host cells used to produce the antibodies or antigen-binding fragments thereof provided herein may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium (MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium (DMEM), Sigma) are suitable for culturing the host cells.
- any of the media described in Ham et al., Meth. Enz.58:44 (1979), Barnes et al., Anal. Biochem.102:255 (1980), U.S. Pat. No.4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90/03430; WO 87/00195; or U.S. Pat. Re.30,985 may be used as culture media for the host cells.
- any of these media may be supplemented as epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN TM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to a person skilled in the art.
- the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to a person skilled in the art.
- the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10:163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min.
- sodium acetate pH 3.5
- EDTA EDTA
- PMSF phenylmethylsulfonylfluoride
- Cell debris can be removed by centrifugation.
- supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- the anti-SIRP ⁇ antibodies or antigen-binding fragments thereof prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, DEAE-cellulose ion exchange chromatography, ammonium sulfate precipitation, salting out, and affinity chromatography, with affinity chromatography being the preferred purification technique.
- immunoaffinity purification of the antibody and antigen-binding fragment thereof The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
- Protein A can be used to purify antibodies that are based on human gamma1, gamma2, or gamma4 heavy chains (Lindmark et al., J. Immunol. Meth.62:1-13 (1983)). Protein G is recommended for all mouse isotypes and for human gamma3 (Guss et al., EMBO J. 5:15671575 (1986)).
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the Bakerbond ABX TM resin (J. T. Baker, Phillipsburg, N.J.) is useful for purification.
- Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSE TM chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
- the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g. from about 0-0.25M salt).
- elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g. from about 0-0.25M salt).
- salt concentrations e.g. from about 0-0.25M salt.
- Pharmaceutical acceptable carriers for use in the pharmaceutical compositions disclosed herein may include, for example, pharmaceutically acceptable agents, isotonic agents, buffers, antioxidants, anesthetics, suspending/dispending agents, sequestering or chelating agents, diluents, adjuvants, excipients, or non-toxic auxiliary substances, other components known in the art, or various combinations thereof.
- Suitable components may include, for example, antioxidants, fillers, binders, disintegrants, buffers, preservatives, lubricants, flavorings, thickeners, coloring agents, emulsifiers or stabilizers such as sugars and cyclodextrins.
- Suitable antioxidants may include, for example, methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum, catalase, citric acid, cysteine, thioglycerol, thioglycolic acid, thiosorbitol, butylated hydroxanisol, butylated hydroxytoluene, and/or propyl gallate.
- inclusion of one or more antioxidants such as methionine in a composition comprising an antibody or antigen-binding fragment thereof and conjugates provided herein decreases oxidation of the antibody or antigen-binding fragment thereof. This reduction in oxidation prevents or reduces loss of binding affinity, thereby improving antibody stability and maximizing shelf-life.
- compositions that comprise one or more antibodies or antigen-binding fragments thereof as disclosed herein and one or more antioxidants such as methionine. Further provided are methods for preventing oxidation of, extending the shelf-life of, and/or improving the efficacy of an antibody or antigen-binding fragment provided herein by mixing the antibody or antigen- binding fragment with one or more antioxidants such as methionine.
- pharmaceutical acceptable carriers may include, for example, aqueous vehicles such as sodium chloride injection, Ringer's injection, isotonic dextrose injection, sterile water injection, or dextrose and lactated Ringer's injection, nonaqueous vehicles such as fixed oils of vegetable origin, cottonseed oil, corn oil, sesame oil, or peanut oil, antimicrobial agents at bacteriostatic or fungistatic concentrations, isotonic agents such as sodium chloride or dextrose, buffers such as phosphate or citrate buffers, antioxidants such as sodium bisulfate, local anesthetics carboxymethylcelluose, hydroxypropyl methylcellulose, or polyvinylpyrrolidone, emulsifying agents such as Polysorbate 80 (TWEEN-80), sequestering or chelating agents such as EDTA (ethylenediaminetetraacetic acid) or EGTA (ethylene glycol tetraacetic acid), ethyl alcohol
- aqueous vehicles such
- Antimicrobial agents utilized as carriers may be added to pharmaceutical compositions in multiple-dose containers that include phenols or cresols, mercurials, benzyl alcohol, chlorobutanol, methyl and propyl p-hydroxybenzoic acid esters, thimerosal, benzalkonium chloride and benzethonium chloride.
- Suitable excipients may include, for example, water, saline, dextrose, glycerol, or ethanol.
- Suitable non-toxic auxiliary substances may include, for example, wetting or emulsifying agents, pH buffering agents, stabilizers, solubility enhancers, or agents such as sodium acetate, sorbitan monolaurate, triethanolamine oleate, or cyclodextrin.
- the pharmaceutical compositions can be a liquid solution, suspension, emulsion, pill, capsule, tablet, sustained release formulation, or powder.
- Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, polyvinyl pyrollidone, sodium saccharine, cellulose, magnesium carbonate, etc.
- the pharmaceutical compositions are formulated into an injectable composition.
- the injectable pharmaceutical compositions may be prepared in any conventional form, such as for example liquid solution, suspension, emulsion, or solid forms suitable for generating liquid solution, suspension, or emulsion.
- Preparations for injection may include sterile and/or non-pyretic solutions ready for injection, sterile dry soluble products, such as lyophilized powders, ready to be combined with a solvent just prior to use, including hypodermic tablets, sterile suspensions ready for injection, sterile dry insoluble products ready to be combined with a vehicle just prior to use, and sterile and/or non-pyretic emulsions.
- the solutions may be either aqueous or nonaqueous. an ampoule, a vial or a syringe with a needle.
- a sterile, lyophilized powder is prepared by dissolving an antibody or antigen-binding fragment as disclosed herein in a suitable solvent.
- the solvent may contain an excipient which improves the stability or other pharmacological components of the powder or reconstituted solution, prepared from the powder.
- Excipients include, but are not limited to, water, dextrose, sorbital, fructose, corn syrup, xylitol, glycerin, glucose, sucrose or other suitable agent.
- the solvent may contain a buffer, such as citrate, sodium or potassium phosphate or other such buffer known to a person skilled in the art at, in one embodiment, about neutral pH.
- a buffer such as citrate, sodium or potassium phosphate or other such buffer known to a person skilled in the art at, in one embodiment, about neutral pH.
- Subsequent sterile filtration of the solution followed by lyophilization under standard conditions known to a person skilled in the art provides a desirable formulation.
- the resulting solution will be apportioned into vials for lyophilization.
- Each vial can contain a single dosage or multiple dosages of the anti-SIRP ⁇ antibody or antigen-binding fragment thereof or composition thereof. Overfilling vials with a small amount above that needed for a dose or set of doses (e.g. about 10%) is acceptable so as to facilitate accurate sample withdrawal and accurate dosing.
- the lyophilized powder can be stored under appropriate conditions, such as at about 4 °C to room temperature.
- Reconstitution of a lyophilized powder with water for injection provides a formulation for use in parenteral administration.
- the sterile and/or non-pyretic water or other liquid suitable carrier is added to lyophilized powder.
- the precise amount depends upon the selected therapy being given, and can be empirically determined.
- Kits [00251] In certain embodiments, the present disclosure provides a kit comprising the antibody or an antigen-binding fragment thereof provided herein.
- the target cell can be a tumor cell, an inflammatory cell, and/or a chronically infected cell that express CD47.
- the target antigen is a tumor antigen, tumor surface antigen, or an infectious agent surface antigen.
- the kits further comprise an additional therapeutic agent.
- the additional therapeutic agent can be an anti-cancer therapeutic agent, anti- inflammatory agent or an anti-infection agent.
- the additional therapeutic agent is selected from the group consisting of a chemotherapeutic agent, an anti-cancer drug, radiation therapy, an immunotherapy agent, an anti-angiogenesis agent, a targeted therapy, a cellular therapy, a gene therapy, a hormonal therapy, an antiviral agent, an antibiotic, an analgesics, an antioxidant, a metal chelator, and cytokines.
- kits can further include, if desired, one or more of various conventional pharmaceutical kit components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers etc., as will be readily apparent to a person skilled in the art.
- the present disclosure provides a method of inducing phagocytosis of a target cell in vitro, comprising contacting the target cell with a SIRP ⁇ positive phagocytic cell sample in the presence of the antibody or an antigen- binding fragment thereof provided herein, thereby inducing the phagocytosis of the target cell by the SIRP ⁇ positive phagocytic cell.
- the target cell is a CD47 expressing cell.
- the present disclosure provides a method of inducing phagocytosis of a target cell in a subject, comprising administering to the subject the antibody or an antigen-binding fragment thereof provided herein and/or the pharmaceutical composition provided herein in a dose effective to induce phagocytosis of the target cell.
- the present disclosure provides a method of inducing phagocytosis of a target cell in a subject, comprising administering to the subject the antibody or an antigen-binding fragment thereof provided herein and/or the pharmaceutical composition provided herein in combination with a target antibody that specifically binds to a target antigen on the target cell, in a dose effective to induce phagocytosis of the target cell.
- the present disclosure provides a method of increasing antibody-dependent cellular phagocytosis (ADCP) effect of a target antibody on a target cell in a subject, comprising: administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof provided herein and/or the pharmaceutical composition provided herein, in combination with the target antibody having Fc region, thereby increasing ADCP of the target antibody on the target cell, wherein the target antibody binds to a target antigen expressed on the target cell.
- the target antibody binds to a target antigen expressed on the target cell
- the ADCP effects of the target antibody on the target chronically infected cell that express CD47.
- the present disclosure provides a method of potentiating a target antibody (e.g., anti-CD20 antibody, anti-PD-L1 antibody and anti-Claudin18.2 antibody) in treating a disease, disorder or condition in a subject, comprising: administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof provided herein and/or the pharmaceutical composition provided herein, in combination with the target antibody (e.g., anti-CD20 antibody, anti-PD-L1 antibody and anti-Claudin18.2 antibody), thereby potentiating the target antibody in treating the disease, disorder or condition in the subject.
- the term “potentiate” or “potentiating” refers increasing therapeutic efficacy.
- the target antibody has an Fc region.
- the disease, disorder or condition is immune related disease or disorder, tumors and cancers, autoimmune diseases, or infectious disease.
- the immune related disease or disorder is selected from the group consisting of systemic lupus erythematosus, acute respiratory distress syndrome (ARDS), vasculitis, myasthenia gravis, idiopathic pulmonary fibrosis, Crohn's Disease, asthma, rheumatoid arthritis, graft versus host disease, a spondyloarthropathy (e.g., ankylosing spondylitis, psoriatic arthritis, isolated acute enteropathic arthritis associated with inflammatory bowel disease, reactive arthritis, Behcet's syndrome, undifferentiated spondyloarthropathy, anterior uveitis, and juvenile idiopathic arthritis.), multiple sclerosis, endometriosis, glomerulonephritis, seps
- the condition or a disorder treatable by the methods provided herein include tumors and cancers.
- cancers and tumors include, non-small cell lung cancer, small cell lung cancer, renal cell cancer, colorectal cancer, ovarian cancer, breast cancer, pancreatic cancer, gastric carcinoma, bladder cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, leukemia, lymphomas, myelomas, mycoses fungoids, merkel cell cancer, and other hematologic malignancies, such as classical Hodgkin lymphoma (CHL), primary mediastinal large B-cell lymphoma, T-cell/histiocyte-rich B-cell lymphoma, EBV-positive and - negative PTLD, and EBV-associated diffuse large B-cell lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T-cell lymphoma, nasopharynge
- CHL Hodgkin lymph
- the present disclosure also provides methods of treating a disease, disorder or condition that can be benefited from induced phagocytosis of a target cell in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein, and/or the pharmaceutical composition provided herein disease, disorder or condition that can be benefited from induced phagocytosis of a target cell in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein, and/or the pharmaceutical composition provided herein in combination with a target antibody that specifically binds to a target antigen on the target cell.
- the present disclosure also provides methods of treating a SIRP ⁇ related disease, disorder or condition in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein, and/or the pharmaceutical composition provided herein.
- the present disclosure also provides methods of treating a SIRP ⁇ related disease, disorder or condition in a subject, comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein, and/or the pharmaceutical composition provided herein, in combination with a target antibody that specifically binds to a target antigen on a target cell associated with the SIRP ⁇ related disease.
- the target cell is a CD47 expressing cell.
- the target cells comprise cancer cells, inflammatory cells, and/or chronically infected cells.
- the antibody or an antigen-binding fragment thereof provided herein when used in combination with a target antibody, the antibody or an antigen-binding fragment thereof provided herein can induce selective phagocytosis of the target cell over a non-target cell (e.g. those which do not express the target antigen).
- the target cell expresses a target antigen.
- the target antigen is a tumor antigen, tumor surface antigen, an inflammatory antigen, or an antigen of an infectious microorganism.
- TAA tumor specific antigen
- HBsAg Hepatitis B surface antigen
- the subject is human.
- the subject is homozygous for SIRP ⁇ v1.
- the subject is homozygous for SIRP ⁇ v2.
- the subject is heterozygous SIRP ⁇ v1/v2.
- the subject has a disease, disorder or condition selected from the group consisting of cancer, solid tumor, a chronic infection, an inflammatory disease, multiple sclerosis, an autoimmune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a septic shock, fibrosis, atherosclerosis, obesity, type II diabetes, a transplant dysfunction, and arthritis.
- the cancer is a CD47-positive cancer.
- the subject to be treated has been identified as having a CD47-positive cancer.
- CD47-positive cancer refers to a cancer characterized in expressing CD47 protein in a cancer cell, or expressing CD47 in a cancer cell at a level significantly higher than that would have been expected of a normal cell.
- the presence and/or amount of CD47 in an interested biological sample can be indicative of whether the subject from whom the biological sample is derived could likely respond to an anti-SIRP ⁇ antibody.
- Various methods can be used to determine the presence and/or amount of CD47 in a test biological sample from the subject. For example, the test biological sample can be exposed to anti-CD47 antibody or antigen- binding fragment thereof, which binds to and detects the expressed CD47 protein.
- CD47 can also be detected at nucleic acid expression level, using methods such as qPCR, reverse transcriptase PCR, microarray, SAGE, FISH, and the like.
- the test sample is derived from a cancer cell or tissue, or tumor infiltrating immune cells.
- presence or up-regulated level of the CD47 in the test biological sample indicates likelihood of responsiveness. 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80% or greater, in the expression level of CD47 in the test sample, as compared to the CD47 expression level in a reference sample as detected using the same method.
- the reference sample can be a control sample obtained from a healthy or non-diseased individual, or a healthy or non-diseased sample obtained from the same individual from whom the test sample is obtained.
- the reference sample can be a non-diseased sample adjacent to or in the neighborhood of the test sample (e.g. tumor).
- the reference level can be the level of CD47 expression found in normal cells of the same tissue type, optionally normalized to expression level of another gene (e.g. a house keeping gene). Alternatively, the reference level can be the level of CD47 expression found in healthy subjects.
- the reference sample can be a control sample obtained from a healthy or non-diseased individual, or a healthy or non- diseased sample obtained from the same individual from whom the test sample is obtained.
- a reference is tested and/or determined substantially simultaneously with the testing or determination of interest.
- a reference is a historical reference, optionally embodied in a tangible medium. Typically, as would be understood by the skilled person in the art, a reference is determined or characterized under comparable conditions or circumstances to those under assessment.
- an antibody or antigen-binding fragment thereof provided herein that is administered in combination with the target antibody or one or more additional therapeutic agents may be administered simultaneously with the target antibody or the one or more additional therapeutic agents, and in certain of these embodiments the antibody or antigen-binding fragment thereof and the target antibody or the additional therapeutic agent(s) may be administered as part of the same pharmaceutical composition.
- an antibody or antigen-binding fragment thereof administered “in combination” with the target antibody or an additional therapeutic agent does not have to be administered simultaneously with or in the same administered prior to or after the target antibody or another agent is considered to be administered “in combination” with that agent as the phrase is used herein, even if the antibody or antigen-binding fragment and the target antibody or the second agent are administered via different routes.
- the target antibody or additional therapeutic agents administered in combination with the antibodies or antigen-binding fragments thereof disclosed herein are administered according to the schedule listed in the product information sheet of the additional therapeutic agent, or according to the Physicians' Desk Reference 2003 (Physicians' Desk Reference, 57th Ed; Medical Economics Company; ISBN: 1563634457; 57th edition (November 2002)) or protocols well known in the art.
- methods are provided to treat a disease, disorder or condition in a subject that would benefit from modulation of SIRP ⁇ activity, comprising administering a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein and/or the pharmaceutical composition provided herein to a subject in need thereof.
- the disease or condition is a SIRP ⁇ related disease, disorder or condition.
- the therapeutically effective amount of an antibody or antigen-binding fragment provided herein will depend on various factors known in the art, such as for example body weight, age, past medical history, present medications, state of health of the subject and potential for cross-reaction, allergies, sensitivities and adverse side- effects, as well as the administration route and extent of disease development. Dosages may be proportionally reduced or increased by a person skilled in the art (e.g. physician or veterinarian) as indicated by these and other circumstances or requirements.
- the antibody or antigen-binding fragment provided herein may be administered at a therapeutically effective dosage of about 0.01 mg/kg to about 100 mg/kg.
- the administration dosage may change over the course of treatment.
- the initial certain embodiments the administration dosage may vary over the course of treatment depending on the reaction of the subject.
- Dosage regimens may be adjusted to provide the optimum desired response (e.g. a therapeutic response). For example, a single dose may be administered, or several divided doses may be administered over time.
- the antibodies or antigen-binding fragments thereof provided herein may be administered by any route known in the art, such as for example parenteral (e.g. subcutaneous, intraperitoneal, intravenous, including intravenous infusion, intramuscular, or intradermal injection) or non-parenteral (e.g.
- the antibodies or antigen-binding fragments thereof provided herein may be administered alone or in combination a therapeutically effective amount of an additional therapeutic agent.
- the antibodies or antigen-binding fragments thereof disclosed herein may be administered in combination with an additional therapeutic agent, for example, a chemotherapeutic agent, an anti-cancer drug, radiation therapy, an immunotherapy agent, an anti- angiogenesis agent, a targeted therapy, a cellular therapy, a gene therapy, a hormonal therapy, an antiviral agent, an antibiotic, an analgesics, an antioxidant, a metal chelator, or cytokines.
- immunotherapy refers to a type of therapy that stimulates immune system to fight against disease such as cancer or that boosts immune system in a general way.
- immunotherapy include, without limitation, checkpoint modulators, adoptive cell transfer, cytokines, oncolytic virus and therapeutic vaccines.
- “Targeted therapy” is a type of therapy that acts on specific molecules associated with cancer, such as specific proteins that are present in cancer cells but not normal cells or that are more abundant in cancer cells, or the target molecules in therapy targets a therapeutic agent to a tumor, thereby sparing of normal tissue from the effects of the therapeutic agent.
- the present disclosure further provides methods of modulating SIRP ⁇ activity in SIRP ⁇ -positive cells, comprising exposing the SIRP ⁇ - positive cells to the antibodies or antigen-binding fragments thereof provided herein.
- the SIRP ⁇ -positive cell is a phagocytic cell (e.g. a macrophage).
- the present disclosure provides methods of detecting the presence or amount of SIRP ⁇ in a sample, comprising contacting the sample with the antibody or antigen-binding fragment thereof provided herein, and determining the presence or the amount of SIRP ⁇ in the sample.
- the present disclosure provides a method of diagnosing a SIRP ⁇ related disease, disorder or condition in a subject, comprising: a) contacting a sample obtained from the subject with the antibody or an antigen-binding fragment thereof provided herein; b) determining the presence or amount of SIRP ⁇ in the sample; and c) correlating the presence or the amount of SIRP ⁇ to existence or status of the SIRP ⁇ related disease, disorder or condition in the subject.
- kits comprising the antibody or antigen-binding fragment thereof provided herein, optionally conjugated with a detectable moiety, which is useful in detecting a SIRP ⁇ related disease, disorder or condition.
- the kits may further comprise instructions for use.
- the present disclosure also provides use of the antibody or antigen-binding fragment thereof provided herein in the manufacture of a medicament for treating, preventing or alleviating a SIRP ⁇ related disease, disorder or condition in a subject, in the manufacture of a diagnostic reagent for diagnosing a SIRP ⁇ related disease, disorder or condition.
- a diagnostic reagent for diagnosing a SIRP ⁇ related disease, disorder or condition.
- EXAMPLE 1 Reagent Generation [00260] 1.1 Reference Antibody Generation [00261] The DNA sequences encoding variable regions of anti-SIRP ⁇ reference antibodies HEFLB (see US20140242095), or hu1H9G4 (see WO2019/023347Al) were cloned into the vectors expressing human IgG constant regions.
- variable region amino acid sequences of HEFLB, and hu1H9G4 are shown in Table 6 of the present disclosure.
- the expression plasmids transfected Expi293 cells (Invitrogen) were cultured at 37 ⁇ C for 5 days. Then the culture medium was collected and centrifuged to remove cell pellets. The harvested supernatant was purified using Protein A affinity chromatography column.
- HEFLB and hu1H9G4 are both human IgG4 monoclonal antibodies with the S228P mutation in the constant region. [00262] 1.2.
- SIRP ⁇ , SIRP ⁇ and SIRP ⁇ Stable Expression Cell Lines Generation [00263] The DNA sequence encoding full length human SIRP ⁇ v1 (NP_542970), human SIRP ⁇ (O00241), cyno SIRP ⁇ (NP_001271679), or C57BL/6 mouse SIRP ⁇ (NP_031573) was cloned into the pIRES vector (Clontech) respectively.
- Human SIRP ⁇ (Q9P1W8) expression plasmid was purchased from Sino Biological (HG16111-CF). expression plasmid were selectively cultured and stable clones were obtained and confirmed.
- CHOK1 cells (Invitrogen) transfected with human SIRP ⁇ v1, human SIRP ⁇ , cyno SIRP ⁇ or C57BL/6 mouse SIRP ⁇ expression plasmid were selectively cultured and stable clones were obtained and confirmed.
- CHOK1 cell line stable expressing exogenous human SIRP ⁇ v2 (CAA71403.1) was purchased from KYinno (KC-1720).
- KYinno KC-1720
- Recombinant Proteins Generation [00268] Recombinant proteins of human IgG Fc (hFc) tagged human CD47 extracellular domain (ECD, NP_001768.1, M1-E141), human SIRP ⁇ v1 ECD (NP_542970, M1-R370), human SIRP ⁇ v2 ECD (CAA71403.1, M1-R369), or human SIRP ⁇ ECD (Q9P1W8, M1-P360) were generated by Chempartner.
- Recombinant proteins of 6xHis tagged C57BL/6 mouse SIRP ⁇ ECD, human SIRP ⁇ L ECD (NP_001129316.1) and mouse human IgG Fc (mFc) tagged human CD47 ECD, human SIRP ⁇ v1 were purchased from Biointron.
- Recombinant proteins of 6xHis tagged human SIRP ⁇ v1 ECD, human SIRP ⁇ v2 ECD, human SIRP ⁇ ECD (O00241) were purchased from Sino Biological.
- mice were sacrificed and the spleen cells were collected. 1% (v/v) NH 4 OH was added to lyse erythrocytes. Then the washed spleen cells were fused with SP2/0 mouse myeloma cells (ATCC) by high-efficiency electro- fusion or PEG method. After cell fusion, the fused cells were seeded into 96-well plates at the density of 2x10 4 cells/well with 200 ml DMEM medium containing 20% FBS and 1% HAT. [00279] 2.6.
- ATCC SP2/0 mouse myeloma cells
- Hybridoma Screening 10-12 days after fusion, fusion plates were primarily screened by ELISA assay with human SIRP ⁇ v1 and v2 ECD recombinant proteins or Acumen assay (TTP Labtech) with CHOK1 cells stably expressing human SIRP ⁇ v1.
- the hybridoma cells from positive wells were amplified into 24-well plates for 2nd screening.
- binding activity was assessed by ELISA assay with human SIRP ⁇ v1 and v2 ECD recombinant proteins and FACS assay with CHOK1 cells stably expressing human SIRP ⁇ v1. Clones with top binding activity against different human SIRP ⁇ variants were selected for subcloning.
- Hybridoma cells of each selected clone were seeded into 96-well plates at the density of 1 cell/well by limiting dilution. The plates were screened by the same way as hybridoma primary screening (refer to Example 2.6). The positive single clones were picked and characterized by the same way as hybridoma 2nd screening (refer to Example 2.6). Then the monoclonal hybridoma cell lines with top binding activity were obtained for further hybridoma antibody production, characterization, and sequencing.
- Binding specificity of the purified hybridoma antibodies against human SIRPa variants was detected by ELISA assay using recombinant proteins of Fc tagged human SIRP ⁇ v1 ECD and human SIRP ⁇ v2 ECD.
- HRP horseradish peroxidase
- HEFLB can only bind to human SIRP ⁇ v1 but not human SIRP ⁇ v2.
- Species Cross Reactivity Detection Species cross reactivity of the purified hybridoma antibodies against human, cyno and mouse SIRP ⁇ was determined by FACS assay using CHOK1 cells stably expressing human SIRP ⁇ v1, CHOK1-cyno SIRP ⁇ and C57BL/6 mouse SIRP ⁇ . Briefly the antibodies were incubated with 2x10 5 target cells at 4 ⁇ C for 1 hour. After washing, fluorescence labeled anti-mouse IgG 2 nd antibody (Life Technologies) was added and incubated at 4 ⁇ C for 1 hour.
- Anti-CD47 antibodies may promote red blood cell (RBC) hemagglutination, which leads to potential safety risk.
- RBC red blood cell
- the hemagglutination activity of the purified hybridoma antibodies were tested. Briefly, human RBCs were diluted to 10% in PBS and incubated at 37 ⁇ C for 1 hour at the presence of 100nM antibodies. Evidence of hemagglutination is demonstrated by the presence of non-settled RBCs, appearing as a haze compared to punctuate red dot of non-hemagglutinated RBCs.
- Hemagglutination index was determined by quantitating the area of the RBC pellet in the presence of antibody, normalized to that in the absence of antibody. As summarized in Table 8, all 7 functional antibodies didn’t exhibit hemagglutination activity. [00293] 3.6. SHP-1 Recruitment Detection [00294] The efficacy of the purified hybridoma antibodies to block CD47/SIRPa mediated “don’t eat me” signaling was assessed by cell-based SHP-1 recruitment assay (Figure 8A). Full length human SIRPa v1 was engineered with a small beta-gal fragment (ED) fused to its C-terminal, and the SH2-domain of SHP-1 was engineered with the complementing beta-gal fragment (EA).
- ED beta-gal fragment
- RNA isolated from monoclonal hybridoma cells was reverse-transcribed into cDNA using either isotype-specific anti-sense primers or universal primers following the technical manual of SMARTScribe Reverse Transcriptase. Then the cDNA was used as template to amplify antibody fragments of heavy chain and light chain according to the standard operating procedure (SOP) of rapid amplification of cDNA ends (RACE) of GenScript. Amplified antibody fragments were cloned into a standard cloning vector separately. Colony PCR was performed to screen for clones with inserts of correct sizes and insert fragments were analyzed by DNA sequencing. Finally, the consensus sequences were identified as antibody variable regions of heavy chain and light chain.
- SOP standard operating procedure
- RACE rapid amplification of cDNA ends
- EXAMPLE 4 Chimeric Antibody Generation and Characterization [00297] 4.1. Chimeric Antibody Generation and Production [00298] According to hybridoma sequencing results mouse anti-SIRP ⁇ functional hits were converted into human IgG4 chimeric antibodies with S228P mutation for characterization. Briefly the DNA sequence encoding heavy chain variable region was cloned into the pcDNA3.4-hIgG4P vector (Biointron) carrying human IgG4 heavy chain constant region with S228P mutation. The DNA sequence encoding light chain variable region was cloned into the pcDNA3.4-hIgGk vector (Biointron) carrying human kappa light chain constant region.
- Expi293 cells (Life Technologies) co- transfected with antibody heavy and light chain expression plasmids were expanded at 37 ⁇ C for 5 days.
- the resulting chimeric antibodies are referred to herein as 005c, 015c, 025c, 042c, 059c, 071c, and 073c where the suffix “c” indicates chimeric. [00299] 4.2.
- Binding activity of the purified chimeric antibodies against SIRP ⁇ and SIRP ⁇ l was detected by ELISA assay using recombinant proteins of human SIRP ⁇ ECD ( Figure 3A and 3B), human SIRP ⁇ l ECD ( Figure 3D and 3E) and FACS assay using CHOK1 cells stably expressing human SIRP ⁇ ( Figure 3C).
- Figure 3A to 3C all antibodies as tested bind to human SIRP ⁇ at different levels, among which 042c, 071c and 073c have weaker binding.
- Figure 3D and 3E all antibodies as tested strongly bind to human SIRP ⁇ l.
- EC 50 and top signal calculated using GraphPad Prism9.0 are summarized in Table 10.
- Binding activity of the purified chimeric antibodies against SIRP ⁇ was detected by FACS assay using recombinant protein of cyno SIRP ⁇ ECD ( Figure 4C) and FACS assay using 293F cells stably expressing human SIRP ⁇ ( Figure 4A and 4B).
- Figure 4A and 4B all antibodies as tested bind to human SIRP ⁇ at different levels, among which 042c, 059c, 071c and 073c have very weak binding.
- Figure 4C 005c, 042c and 073c have very weak binding to cyno SIRP ⁇ , which is correlated with their binding activity to human SIRP ⁇ .
- EC 50 and top signal calculated using GraphPad Prism9.0 are summarized in Table 11.
- 4.2.2 Species Cross Reactivity Detection Species cross reactivity of purified chimeric antibodies was detected by ELISA assay using recombinant protein of C57BL/6 mouse SIRP ⁇ ECD ( Figure 5A) and FACS assay using CHOK1 cells stably expressing cyno SIRP ⁇ ( Figure 5B and 5C). All antibodies as tested bind to cyno SIRP ⁇ at different levels but have no species cross reactivity against C57BL/6 mouse SIRP ⁇ .
- EC 50 and top signal calculated using GraphPad Prism9.0 are summarized in Table 12.
- Blocking ratio was determined by blockade of human CD47 ECD recombinant protein binding to ELISA microplate coated human SIRP ⁇ ECD recombinant protein. IC 50 and top blocking ratio calculated using GraphPad Prism9.0 are summarized in Table 13. Other than 005, all antibodies as tested can block interaction between human CD47 and different human SIRP ⁇ variants. [00308] 4.2.4.
- the purified chimeric antibodies were characterized for binding affinity against human SIRP ⁇ v1, human SIRP ⁇ v2 using Bio-Layer Interferometry technology (Octet system). The association and dissociation curves were fit with 1:1 binding model, and the Ka/Kd/KD values for each antibody were calculated. The affinity data of Ka/Kd/KD values for each antibody are summarized in Table 15. [00313] Competitive ELISA assay was used for epitope binning of purified chimeric antibodies. Briefly excessive competitor antibody and mFc tagged human SIRP ⁇ v1 ECD recombinant protein were co-incubated with ELISA microplate coated antibody.
- 042c binding resulted in less hydrogen deuterium exchange ratio of 2 regions of SGAGTEL and TNVDPVGESVS of His tagged human SIRP ⁇ v1 ECD, indicating these amino acids may be critical for 042c to bind.
- 073c binding resulted in less hydrogen deuterium exchange ratio of the region of TNVDPVGESVSY of His tagged human SIRP ⁇ v1 ECD, indicating these amino acids may be critical for 073c to bind.
- these 3 regions are not located in IgV domain of SIRP ⁇ ECD where CD47 binds to, indicating 042c and 073c may work as allosteric antibody to block interaction of CD47 and SIRP ⁇ or blocking activity of 042c and 073c is steric hindrance effect.
- hu1H9G4 binding resulted in less hydrogen deuterium exchange ratio of the region of YNQKEGHFPRVTTVSDL of His tagged human SIRP ⁇ v1 ECD, indicating these amino acids may be critical for hu1H9G4 to exchange ratio of the region of VGPIQW of his tagged human SIRP ⁇ v1 ECD, indicating these amino acids may be critical for HEFLB to bind.
- Phagocytosis was assayed by determining the percentage of macrophages positive for cell trace violet dye.
- peripheral blood mononuclear cells were seeded into 10 cm tissue culture plates in 1640 supplemented with 10% FBS and 50 ng/ml M-CSF for seven to nine days. Adherent cells were harvested as M0 nonpolarized macrophages.
- M1 polarized macrophages peripheral blood mononuclear cells were seeded into 10 cm tissue culture plates in 1640 supplemented with 10% FBS and 50 ng/ml GM-CSF for 5 days. 50 ug/ml IFN ⁇ and 100 ug/ml LPS were added for additional two to four days culture.
- Adherent cells were harvested as M1 polarized macrophages.
- 015c, 025c, 042c,059c, 071c and 073c showed no single agent activity to enhance tumor cell uptake of Raji cells by M0 macrophages obtained from SIRPA heterozygous v1/v2 individual.
- Rituximab an anti-CD20 antibody
- all the other purified chimeric antibodies as tested potentiated macrophage mediated antibody dependent cellular phagocytosis (ADCP) of Raji cells.
- Cetuximab an anti-EGFR antibody
- all the other purified antibodies as tested effectively enhanced tumor cell uptake of DLD-1 cells by M0 macrophages obtained from SIRPA homozygous v2/v2 individual.
- Combination of SIRP ⁇ antibody plus PD-L1 antibody was tested in phagocytosis assay using M0 macrophages obtained from SIRPA homozygous v1/v1 ( Figure 10C) or v2/v2 ( Figure 10D) individuals.
- PD-L1 antibody 005c, 025c, 042c and 073c effectively potentiated macrophage mediated ADCP of Raji cells stably expressing PD-L1.
- the PD-L1 heavy chain antibody C71 has VH amino acid sequences shown below: [00322] anti- PD-L1 heavy chain antibody C71.VH, SEQ ID NO: 91: [00323] EVQVVESGGGLVQSGGSLKLSCAGSGFTESAGFMVWHRQVPGKERELVAL IATPSGSTNYADSVKGRFTISRDNGKNTVYLQMNSLKPEDTAVYYCNIRGYWGQGTL VTVSS [00324] These data suggest that the antibodies or antigen-binding fragment thereof provided herein potentiate macrophage mediated ADCP of certain tumor cells, when used in combination with an antibody specific for the target antigen of such tumor cells. [00325] 4.2.8.
- Human CD47/human SIRP ⁇ double knock-in mice were inoculated with MC38 cells stably expressing human CD47 and human Claudin18.2 (CLDN18.2).
- Treatment groups includes vehicle (PBS), isotype control, 10 mg per kg (mpk) anti- plus 3 or 10 mpk anti-SIRP ⁇ mAb. Treatment was initiated when tumors reached an average volume of 70-75 mm 3 .
- Mice were dosed intraperitoneally (IP) twice a week for 5 times. Tumor volume was measured twice per week. 3 days post the final dosing, mice were sacrificed and tumors were weighted.
- IP intraperitoneally
- VH and VL amino acid sequences of the anti-CLDN18.2 mAb (22E12) are shown below: [00327] anti-CLDN18.2 mAb (22E12) VH, SEQ ID NO: 88 [00328] QVQLVQSGAEVKKPGASVKVSCKASGYTFTNWVHWVRQAPGQGLEWMGEINPTNARSN YNEKFKKRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARIYYGNSFAHWGQGTLVTVSS [00329] anti-CLDN18.2 mAb (22E12) VL, SEQ ID NO: 89 [00330] DIVMTQSPDSLAVSLGERATINCKSSQSLLNAGNQKNYLTWYQQKPGQPPKLLIYWSS TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNNYYYPLTFGGGTKLEIK [00331] 4.2.9.
- MLR Mixed Lymphocyte Reaction Assay
- IFN ⁇ secretion was determined with human IFN gamma kit 025c, 042c, 059c, 071c and 073c showed no significant impact on IFN ⁇ secretion ( Figure 13A), CD4 + T cell proliferation (Figure 13B), and CD8 + T cell proliferation ( Figure 13C).
- the anti-SIRP ⁇ antibody LSB2.20 (Biolegend) is a potent inhibitor of T cell activation.
- hu1H9G4 showed obvious inhibition of IFN ⁇ secretion and T cell proliferation in this assay.
- EXAMPLE 5 Antibody Humanization [00333] 5.1. Humanization [00334] CDR grafting method was used for humanization of 025c.
- IGHV1- 69-2*01 and IGKV3-11*01 were first selected as humanization templates for heavy and light chain respectively, based on their homology to the original mouse antibody sequences.
- CDRs were then defined using Kabat definition except heavy chain CDR1, which was defined using a combination of Kabat and Chothia systems.
- the potential hotspots removed CDRs and different combinations of canonical residues from 025c were grafted onto the templates and the resulting variants (human IgG4 antibodies with S228P mutation in the constant region) were expressed via a 96-well high-throughput protein expression system.
- Binding Specificity Detection Binding activity of the humanized antibodies against human SIRPa variants was detected by FACS assay using CHOK1 cells stably expressing human SIRP ⁇ v1 ( Figure 14A), human SIRP ⁇ v2 ( Figure 14B), or human SIRP ⁇ ( Figure 14C) and 293F cells stably expressing human SIRP ⁇ ( Figure 14D). All the humanized antibodies as bind to SIRP family members. EC 50 and top signal calculated using GraphPad Prism9.0 are summarized in Table 17. [00338] 5.2.2.
- CD47/SIRP ⁇ Interaction Blocking Activity Detection [00339] The humanized antibodies were tested for the ability to block CD47 and SIRP ⁇ interaction with competitive ELISA assay (refer to methods described in Example 4.2.3.). As shown in Figure 15, all the humanized antibodies as tested were confirmed to retain the similar activity as parental antibody of 025c to block interaction between human CD47 and different human SIRP ⁇ variants. IC 50 and top blocking ratio calculated using GraphPad Prism9.0 are summarized in Table 18. [00340] Competitive FACS assay was also set up to further compare the blocking activity of the humanized antibodies and reference antibodies.
- IC 50 and top blocking ratio calculated using GraphPad Prism9.0 are summarized in Table 19. [00341] 5.2.4. SHP-1 Recruitment Assay [00342] The efficacy of the humanized antibodies to block CD47/SIRPa mediated “don’t eat me” signaling was assessed by cell-based SHP-1 recruitment assay (Figure 17, refer to methods described in Example 3.6). All the humanized antibodies as tested were confirmed to retain the similar activity as the parental antibody of 025c to block CD47 engagement resulted SHP-1 recruitment to SIRPa intracellular tail. IC50 and top blocking ratio calculated using GraphPad Prism9.0 are summarized in Table 20.
- the humanized antibodies were characterized for binding affinity against human SIRP ⁇ v1, human SIRP ⁇ v2 using Surface Plasmon Resonance technology (Biacore system). The association and dissociation curves were fit with 1:1 binding model, and the Ka/Kd/KD values for each antibody were calculated. The affinity data of Ka/Kd/KD values for each antibody are summarized in Table 21. [00345] 5.2.6.
- Reference antibodies and 005c were also tested side by side in these assays.
- 005c which can block CD47 engagement resulted SHP-1 recruitment to SIRPa intracellular tail but not CD47 and SIPR ⁇ interaction, effectively potentiated macrophage mediated ADCP of Raji cells stably expressing PD-L1 in the presence of PD-L1 antibody or Rituximab.
- HEFLB which can’t bind to human SIRP ⁇ v2, didn’t work at all for macrophages obtained from SIRPA homozygous v2/v2 and heterozygous v1/v2 individuals.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Cell Biology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/292,922 US20250270315A1 (en) | 2021-07-28 | 2022-07-28 | Novel anti-sirpa antibodies |
| CN202280053002.XA CN118076638A (zh) | 2021-07-28 | 2022-07-28 | 新型抗sirpa抗体 |
| CA3227854A CA3227854A1 (en) | 2021-07-28 | 2022-07-28 | Novel anti-sirpa antibodies |
| JP2024505469A JP2024531900A (ja) | 2021-07-28 | 2022-07-28 | 新規の抗sirpa抗体 |
| KR1020247006211A KR20240039006A (ko) | 2021-07-28 | 2022-07-28 | 신규 항-sirpa 항체 |
| EP22850533.5A EP4377358A4 (en) | 2021-07-28 | 2022-07-28 | NEW ANTI-SIRPA ANTIBODIES |
| AU2022317822A AU2022317822A1 (en) | 2021-07-28 | 2022-07-28 | Novel anti-sirpa antibodies |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CNPCT/CN2021/109041 | 2021-07-28 | ||
| CN2021109041 | 2021-07-28 | ||
| CNPCT/CN2022/104562 | 2022-07-08 | ||
| CN2022104562 | 2022-07-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023010100A1 true WO2023010100A1 (en) | 2023-02-02 |
Family
ID=85087323
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/074286 Ceased WO2023010100A1 (en) | 2021-07-28 | 2022-07-28 | Novel anti-sirpa antibodies |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20250270315A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4377358A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024531900A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240039006A (cg-RX-API-DMAC7.html) |
| CN (1) | CN118076638A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022317822A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3227854A1 (cg-RX-API-DMAC7.html) |
| TW (1) | TW202313699A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023010100A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024153193A1 (en) * | 2023-01-18 | 2024-07-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Bi-specific molecules targeting sirpa and claudin 18.2 |
| WO2024222863A1 (en) * | 2023-04-27 | 2024-10-31 | LaNova Medicines Limited | Combination treatment targeting sirpa and claudin 18.2 |
| WO2025140296A1 (zh) * | 2023-12-26 | 2025-07-03 | 上海宏成药业有限公司 | 抗dll3抗体或其抗原结合片段及其用途 |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20250164033A (ko) * | 2024-05-14 | 2025-11-24 | 주식회사 지놈앤컴퍼니 | 항-bcam 항체 및 이의 컨쥬게이트 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017030823A2 (en) * | 2015-08-14 | 2017-02-23 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
| WO2021032078A1 (en) * | 2019-08-20 | 2021-02-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-sirpa antibodies |
| WO2021129697A1 (en) * | 2019-12-24 | 2021-07-01 | Lanova Medicines Limited Company | ANTI-SIRPα MONOCLONAL ANTIBODIES AND USES THEREOF |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SG11202012338QA (en) * | 2018-07-10 | 2021-01-28 | Univ Kobe Nat Univ Corp | ANTI-SIRPa ANTIBODY |
-
2022
- 2022-07-28 CA CA3227854A patent/CA3227854A1/en active Pending
- 2022-07-28 AU AU2022317822A patent/AU2022317822A1/en active Pending
- 2022-07-28 JP JP2024505469A patent/JP2024531900A/ja active Pending
- 2022-07-28 KR KR1020247006211A patent/KR20240039006A/ko active Pending
- 2022-07-28 CN CN202280053002.XA patent/CN118076638A/zh active Pending
- 2022-07-28 TW TW111128255A patent/TW202313699A/zh unknown
- 2022-07-28 WO PCT/US2022/074286 patent/WO2023010100A1/en not_active Ceased
- 2022-07-28 US US18/292,922 patent/US20250270315A1/en active Pending
- 2022-07-28 EP EP22850533.5A patent/EP4377358A4/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017030823A2 (en) * | 2015-08-14 | 2017-02-23 | Merck Sharp & Dohme Corp. | Anti-tigit antibodies |
| WO2021032078A1 (en) * | 2019-08-20 | 2021-02-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-sirpa antibodies |
| WO2021129697A1 (en) * | 2019-12-24 | 2021-07-01 | Lanova Medicines Limited Company | ANTI-SIRPα MONOCLONAL ANTIBODIES AND USES THEREOF |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4377358A4 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024153193A1 (en) * | 2023-01-18 | 2024-07-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Bi-specific molecules targeting sirpa and claudin 18.2 |
| WO2024222863A1 (en) * | 2023-04-27 | 2024-10-31 | LaNova Medicines Limited | Combination treatment targeting sirpa and claudin 18.2 |
| WO2025140296A1 (zh) * | 2023-12-26 | 2025-07-03 | 上海宏成药业有限公司 | 抗dll3抗体或其抗原结合片段及其用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022317822A1 (en) | 2024-02-22 |
| KR20240039006A (ko) | 2024-03-26 |
| CA3227854A1 (en) | 2023-02-02 |
| JP2024531900A (ja) | 2024-09-03 |
| EP4377358A4 (en) | 2025-12-17 |
| EP4377358A1 (en) | 2024-06-05 |
| US20250270315A1 (en) | 2025-08-28 |
| TW202313699A (zh) | 2023-04-01 |
| CN118076638A (zh) | 2024-05-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN112867507B (zh) | 新型抗sirpa抗体 | |
| US20240052052A1 (en) | Novel anti-cd24 antibodies | |
| US20250270315A1 (en) | Novel anti-sirpa antibodies | |
| WO2020156405A1 (en) | Novel bispecific cd3/cd20 polypeptide complexes | |
| KR20240128709A (ko) | 신규한 항-tslp 항체 | |
| US20250368734A1 (en) | Novel anti-gprc5d antibodies, bispecific antigen binding molecules that bind gprc5d and cd3, and uses thereof | |
| CA3228641A1 (en) | Fap/cd40 binding molecule and medicinal use thereof | |
| TW202417494A (zh) | 新穎抗lilrb4抗體及其用途 | |
| US11773172B2 (en) | Anti-EGFR antibody polypeptide | |
| WO2022063272A1 (en) | Novel anti-claudin18 antibodies | |
| US20240336686A1 (en) | Novel multi-specific molecules | |
| CN116120461B (zh) | 新型抗药抗体以及其用途 | |
| WO2023072294A1 (en) | Novel anti-lag3 antibodies | |
| HK40106257A (zh) | 新型抗sirpa抗体 | |
| HK40045149A (en) | Novel anti-sirpa antibodies | |
| TW202542184A (zh) | 與cd3及lilrb4結合之新穎抗體及其用途 | |
| TW202413417A (zh) | 新穎抗cd3抗體及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22850533 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2024505469 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280053002.X Country of ref document: CN Ref document number: 3227854 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022317822 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2022317822 Country of ref document: AU Date of ref document: 20220728 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20247006211 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247006211 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022850533 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022850533 Country of ref document: EP Effective date: 20240228 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18292922 Country of ref document: US |