WO2023004289A1 - Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use - Google Patents
Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use Download PDFInfo
- Publication number
- WO2023004289A1 WO2023004289A1 PCT/US2022/073850 US2022073850W WO2023004289A1 WO 2023004289 A1 WO2023004289 A1 WO 2023004289A1 US 2022073850 W US2022073850 W US 2022073850W WO 2023004289 A1 WO2023004289 A1 WO 2023004289A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- tcr
- polypeptide
- peptide
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/54—Pancreas
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/12—Dual-specificity kinases (2.7.12)
- C12Y207/12002—Mitogen-activated protein kinase kinase (2.7.12.2), i.e. MAPKK or MEK1 or MEK2
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y306/00—Hydrolases acting on acid anhydrides (3.6)
- C12Y306/04—Hydrolases acting on acid anhydrides (3.6) acting on acid anhydrides; involved in cellular and subcellular movement (3.6.4)
Definitions
- This invention relates to the field of cancer therapy.
- Adoptive T-cell therapy is one potentially powerful treatment for cancer that genetically modifies natural T cells to make them tumor- specific and to improve their ability to destroy tumor cells.
- the genetically modified T cells are able to express chimeric antigen receptors (CARs) or T-cell receptors (TCRs), showing impressive results in multiple clinical trials.
- TCR-engineered T (TCR-T) cells have shown great promise against tumors.
- the potency of TCRs relies on their interaction with peptide-major histocompatibility complex (pMHC), complexes formed by peptide bound to MHC. Intracellular antigens are cut up into peptide chains and displayed by MHC molecules to form pMHCs.
- pMHC peptide-major histocompatibility complex
- Cytoplasmic proteins to be expressed by class I MHC proteins are cleaved into peptide chains by proteolysis. These peptides are then bound to class I MHC proteins, which are expressed on all nucleated cells’ cell surface.
- Some cells called antigen- presenting cells (APCs), express class II MHC proteins. They internalize foreign material proteins by endocytosis and cleave them into peptide chains to bind with class II MHC proteins T-cell receptors from T cells, which must be matched to human leukocyte antigen (HLA) alleles of patients, recognize these pMHCs and cause the killing of cancer cells.
- APCs antigen- presenting cells
- Human class I MHC protein is expressed from 3 gene regions: HLA- A, HLA-B, and HLA-C, and human class II MHC protein is also expressed from 3 gene regions: HLA-DR, HLA-DP, and HLA- DQ.
- This disclosure provides for peptides useful for vaccination and other applications, engineered T cell Receptors (TCRs), cells comprising the peptides and TCRs, and methods of making and using the peptides and TCRs.
- TCRs that specifically recognize a cancer testis antigen such as Fanci, RAD51, or PBK, or peptide therefrom, such as a peptide having the amino acid sequence of KLQEFLQTL (SEQ ID NO:43), RLADEF G V A V (SEQ ID NO:44), or SYQKVIELF (SEQ ID NO:45).
- aspects of the disclosure relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:7.
- Other aspects relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 14.
- Further aspects of the disclosure relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:21.
- aspects relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:28.
- aspects of the disclosure relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:35. Aspects relate to a polypeptide comprising an antigen binding variable region comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:42.
- TCR T-cell receptors
- engineered TCRs such as a TCR comprising a TCR-a polypeptide and a TCR-b polypeptide, wherein the TCR-a polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:7 and the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 14.
- the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:7 and the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85,
- TCR T-cell receptors
- engineered TCRs such as a TCR comprising a TCR-a polypeptide and a TCR-b polypeptide, wherein the TCR-a polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:21 and the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:28.
- the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:21 and the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85,
- TCR T-cell receptors
- engineered TCRs such as a TCR comprising a TCR-a polypeptide and a TCR-b polypeptide, wherein the TCR-a polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:35 and the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:42.
- the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:35 and the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85,
- the TCR-a polypeptide may comprise a CDR3 comprising the amino acid sequence of SEQ ID NO:35 and the TCR-b polypeptide may comprise a CDR3 comprising the amino acid sequence of SEQ ID NO:42.
- the CD3 binding region may comprise a CD3-specific fragment antigen binding (Fab), single chain variable fragment (scFv), single domain antibody, or single chain antibody.
- Fab CD3-specific fragment antigen binding
- US20180222981 which is herein incorporated by reference, discloses variable regions that bind specifically to CD3, which may be used in aspectss of this disclosure.
- Anti- CD3 antibodies and variable regions are disclosed in US20180117152, which is also incorporated by reference.
- aspects of the disclosure relate to a peptide comprising at least 55% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- polypeptides comprising a peptide of the disclosure.
- the peptide or polypeptide may have or have at least 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82,
- Further aspects relate to a molecular complex comprising the peptide or polypeptide of the disclosure and a MHC polypeptide.
- Other aspects of the disclosure relate to a method of producing peptide- specific immune effector cells comprising: contacting a starting population of immune effector cells with a peptide of the disclosure, thereby generating peptide- specific immune effector cells.
- the method further comprises obtaining a population of immune effector cells.
- the disclosure also describes peptide -specific engineered T cells and TCRs produced according to the methods of the disclosure.
- Further aspects relate to an in vitro isolated dendritic cell comprising a peptide, polypeptide, nucleic acid, or expression vector of the disclosure.
- a method for prognosing a patient or for detecting T cell responses in a patient comprising: contacting a biological sample from the patient with a composition, peptide, or polypeptide of the disclosure.
- a composition, peptide, or polypeptide of the disclosure comprising: contacting a biological sample from the patient with a composition, peptide, or polypeptide of the disclosure.
- exemplary binding molecules include antibodies, TCR mimic antibodies, scFvs, nanobodies, camellids, aptamers, and DARPINs.
- kits comprising a peptide, polypeptide, nucleic acid, expression vector, or composition of the disclosure.
- Further method aspects relate to a method of cloning a T cell receptor (TCR), the method comprising (a) contacting a starting population of immune effector cells with the peptide of the disclosure, thereby generating peptide- specific immune effector cells; (b) purifying immune effector cells specific to the peptide, and (c) isolating a TCR sequence from the purified immune effector cells.
- the method further comprises obtaining a population of immune effector cells.
- Further aspects relate to a method of making a cell comprising transferring a nucleic acid or expression vector of the disclosure into the cell.
- Further aspects relate to an in vitro method for making a therapeutic T cell vaccine comprising co-culturing T cells with a peptide of the disclosure.
- Nucleic acids of the disclosure include those that encode for CDR regions, variable regions, engineered TCRs, polypeptides, TCR-a polypeptides, TCR-b polypeptides, peptides, polypeptides, and fusion proteins described herein.
- the nucleic acid may be RNA.
- the nucleic acid may also be DNA or a cDNA encoding the peptide or polypeptide, or a complement of the peptide or polypeptide.
- the nucleic acid may comprise one of SEQ ID NOS:l, 2, or a fragment thereof.
- the nucleic acid comprises a nucleotide having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to one of SEQ ID NOS:l, 8, 15, 22, 29, 36, or a fragment thereof.
- compositions comprising the polypeptides, cells, nucleic acids, or engineered TCRs of the disclosure. Further aspects relate to a method of making an engineered cell comprising transferring a nucleic acid or vector of the disclosure into a cell.
- Methods also include methods of reducing tumor burden; methods of lysing a cancer cell; methods of killing tumor/cancerous cells; methods of increasing overall survival; methods of preventing or reducing the risk of recurrence of cancer; methods of promoting cancer remission; methods of increasing susceptibility to other or additional cancer treatments; methods of reducing the risk of getting cancer or of getting a tumor; methods of increasing recurrent free survival; methods of preventing cancer; and/or methods of reducing, eliminating, or decreasing the spread or metastasis of cancer, the method comprising administering a polypeptide, composition, cell, nucleic acid, or engineered TCR to a subject in need thereof.
- the polypeptide of the disclosure or the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:7.
- the polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO:7.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence with at least or exactly 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 14.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO: 14.
- the engineered TCR may comprise a a TCR-a polypeptide comprising a CDR 3 having an amino acid of SEQ ID NO:7 and a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence of SEQ ID NO: 14.
- the polypeptide of the disclosure or the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:21.
- the polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO:21.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence with at least or exactly 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:28.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO:28.
- the engineered TCR may comprise a a TCR-a polypeptide comprising a CDR 3 having an amino acid of SEQ ID NO:21 and a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence of SEQ ID NO:28.
- the polypeptide of the disclosure or the TCR-a polypeptide may comprise a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:35.
- the polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO:35.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence with at least or exactly 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:42.
- the polypeptide of the disclosure or the TCR-b polypeptide may comprise a CDR3 comprising an amino acid sequence of SEQ ID NO:42.
- the engineered TCR may comprise a a TCR-a polypeptide comprising a CDR 3 having an amino acid of SEQ ID NO:35 and a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence of SEQ ID NO:42.
- the polypeptide may comprise a variable region comprising a CDR1, CDR2, and CDR3 from a TCR-a polypeptide and/or a TCR-b polypeptide.
- the variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:5.
- variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:5.
- variable region comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:6.
- variable region may comprise a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:6.
- the variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:5 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO:6.
- the variable region may comprise an amino acid sequence with at least 70% sequence identity to SEQ ID NO:3.
- variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:3.
- the variable region comprises the amino acid sequence of SEQ ID NO:3.
- the polypeptide comprises a T cell receptor alpha (TCR-a) variable region.
- the polypeptide comprises a TCR-a variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:2.
- the polypeptide comprises the amino acid sequence of SEQ ID NO:2.
- the polypeptide may further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence with at least 80% identity to SEQ ID NO:4.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:4.
- the signal peptide comprises an amino acid sequence of SEQ ID NO:4.
- the variable region comprises a CDR1, CDR2, and/or CDR3. [0019] The variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO: 12.
- variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 12.
- the variable region may comprise a CDR2 with at least 80% sequence identity to SEQ ID NO: 13.
- variable region comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 13
- the variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 12 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO: 13.
- the variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 10.
- variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 10.
- the variable region comprises the amino acid sequence of SEQ ID NO: 10.
- the polypeptide may comprise a T cell receptor beta (TCR-b) variable region.
- the polypeptide comprises a TCR-b variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:9.
- the polypeptide comprises the amino acid sequence of SEQ ID NO:9.
- the polypeptide may comprise or further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence having at least 80% identity to SEQ ID NO: 11.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 11.
- the signal peptide comprises the amino acid sequence of SEQ ID NO: 11.
- the variable region may comprise a CDR1, CDR2, and/or CDR3.
- variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO: 19.
- the variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 19.
- the variable region comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:20.
- variable region may comprise a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:20.
- the variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 19 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO:20.
- the variable region may comprise an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 17.
- variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 17.
- the variable region comprises the amino acid sequence of SEQ ID NO: 17.
- the polypeptide comprises a T cell receptor alpha (TCR-a) variable region.
- the polypeptide comprises a TCR-a variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 16.
- the polypeptide comprises the amino acid sequence of SEQ ID NO: 16.
- the polypeptide may further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence with at least 80% identity to SEQ ID NO: 18.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
- the signal peptide comprises an amino acid sequence of SEQ ID NO: 18.
- the variable region comprises a CDR1, CDR2, and/or CDR3.
- variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:26.
- the variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
- variable region may comprise a CDR2 with at least 80% sequence identity to SEQ ID NO:27.
- the variable region comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:27
- the variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:26 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO:27.
- variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:24. In some aspects, the variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:24. In some aspects, the variable region comprises the amino acid sequence of SEQ ID NO:24.
- the polypeptide may comprise a T cell receptor beta (TCR-b) variable region.
- the polypeptide comprises a TCR-b variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:23.
- the polypeptide comprises the amino acid sequence of SEQ ID NO:23.
- the polypeptide may comprise or further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence having at least 80% identity to SEQ ID NO:25.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
- the signal peptide comprises the amino acid sequence of SEQ ID NO:25.
- the variable region may comprise a CDR1, CDR2, and/or CDR3.
- variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:33.
- the variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
- variable region comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:34.
- the variable region may comprise a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:34.
- variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:33 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO:34.
- the variable region may comprise an amino acid sequence with at least 70% sequence identity to SEQ ID NO:31.
- the variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:31.
- variable region comprises the amino acid sequence of SEQ ID NO:31.
- the polypeptide comprises a T cell receptor alpha (TCR-a) variable region.
- the polypeptide comprises a TCR-a variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:30.
- the polypeptide comprises the amino acid sequence of SEQ ID NO:30.
- the polypeptide may further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence with at least 80% identity to SEQ ID NO:32.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
- the signal peptide comprises an amino acid sequence of SEQ ID NO:32.
- the variable region comprises a CDR1, CDR2, and/or CDR3.
- variable region may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:40.
- the variable region comprises a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
- variable region may comprise a CDR2 with at least 80% sequence identity to SEQ ID NO:41.
- the variable region comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:41
- the variable region may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:40 and/or a CDR2 comprising the amino acid sequence of SEQ ID NO:41.
- variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:38. In some aspects, the variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:38. In some aspects, the variable region comprises the amino acid sequence of SEQ ID NO:38.
- the polypeptide may comprise a T cell receptor beta (TCR-b) variable region.
- the polypeptide comprises a TCR-b variable and constant region.
- the polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:37.
- the polypeptide comprises the amino acid sequence of SEQ ID NO:37.
- the polypeptide may comprise or further comprise a signal peptide.
- the signal peptide may comprise an amino acid sequence having at least 80% identity to SEQ ID NO:39.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:39.
- the signal peptide comprises the amino acid sequence of SEQ ID NO:39.
- the variable region may comprise a CDR1, CDR2, and/or CDR3.
- the TCR may comprise a TCR-a polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3 and a TCR-b polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3.
- the TCR-a polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:5 and/or the TCR-b polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO: 12.
- the TCR-a polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:5 and/or the TCR-b polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 12.
- the TCR-a polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:5 and the TCR-b polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 12.
- the TCR-a polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:6 and the TCR-b polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO: 13.
- the TCR-a polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:6 and the TCR-b polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
- the TCR-a polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO:6 and the TCR-b polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO: 13.
- the CDR1, CDR2, and CDR3 of the TCR-a polypeptide may comprise the amino acid sequence of SEQ ID NO: 5, 6, and 7, respectively and wherein the CDR1, CDR3, and CDR3 of the TCR-b polypeptide may comprise the amino acid sequence of SEQ ID NO: 12, 13, and 14, respectively.
- the TCR-a variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:3 and the TCR-b variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 10.
- the TCR-a variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:3 and the TCR-b variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any deriv
- the TCR-a polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO:2 and the TCR-b polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO:9.
- the TCR-a polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:2 and the TCR-b polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (
- the TCR-a and/or TCR-b polypeptide may comprise a signal peptide.
- the signal peptide may comprise SEQ ID NO:4 or 11.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:4 or 11.
- the TCR may comprise a TCR-a polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3 and a TCR-b polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3.
- the TCR-a polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO: 19 and/or the TCR-b polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:26.
- the TCR-a polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 19 and/or the TCR-b polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:26.
- the TCR-a polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 19 and the TCR-b polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:26.
- the TCR-a polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:20 and the TCR-b polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:27.
- the TCR-a polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:20 and the TCR-b polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:27.
- the TCR-a polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO:20 and the TCR-b polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO:27.
- the CDR1, CDR2, and CDR3 of the TCR-a polypeptide may comprise the amino acid sequence of SEQ ID NO: 19, 20, and 21, respectively and wherein the CDR1, CDR3, and CDR3 of the TCR-b polypeptide may comprise the amino acid sequence of SEQ ID NO:26, 27, and 28, respectively.
- the TCR-a variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 17 and the TCR-b variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:24. In some aspects, the TCR-a variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- TCR-b variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:24.
- the TCR-a polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 16 and the TCR-b polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO:23.
- the TCR-a polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 16 and the TCR-b polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%
- the TCR-a and/or TCR-b polypeptide may comprise a signal peptide.
- the signal peptide may comprise SEQ ID NO: 18 or 25.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 18 or 25.
- the TCR may comprise a TCR-a polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3 and a TCR-b polypeptide comprising a variable region comprising CDR1, CDR2, and CDR3.
- the TCR-a polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:33 and/or the TCR-b polypeptide may comprise a CDR1 with at least 80% sequence identity to SEQ ID NO:40.
- the TCR-a polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:33 and/or the TCR-b polypeptide may comprise a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:40.
- the TCR-a polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:33 and the TCR-b polypeptide may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:40.
- the TCR-a polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:34 and the TCR-b polypeptide comprises a CDR2 with at least 80% sequence identity to SEQ ID NO:41.
- the TCR-a polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
- the TCR-b polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:41 and the TCR-b polypeptide comprises a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:41.
- the TCR-a polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO:34 and the TCR-b polypeptide comprises a CDR2 comprising the amino acid sequence of SEQ ID NO:41.
- the CDR1, CDR2, and CDR3 of the TCR-a polypeptide may comprise the amino acid sequence of SEQ ID NO: 33, 34, and 35, respectively and wherein the CDR1, CDR3, and CDR3 of the TCR-b polypeptide may comprise the amino acid sequence of SEQ ID NO:40, 41, and 42, respectively.
- the TCR-a variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:31 and the TCR-b variable region comprises an amino acid sequence with at least 70% sequence identity to SEQ ID NO:38. In some aspects, the TCR-a variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the TCR-b variable region comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:38.
- the TCR-a polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO:30 and the TCR-b polypeptide comprises an amino acid sequence having at least 70% sequence identity to SEQ ID NO:37.
- the TCR-a polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:30 and the TCR-b polypeptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100%
- the TCR-a and/or TCR-b polypeptide may comprise a signal peptide.
- the signal peptide may comprise SEQ ID NO:32 or 39.
- the signal peptide comprises an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:32 or 39.
- the TCR may comprise a modification or is chimeric.
- the variable region of the TCR may be fused to a TCR constant region that is different from the constant region of the cloned TCR that specifically binds to a peptide of the disclosure.
- the TCR-a polypeptide and TCR-b polypeptide may be operably linked.
- the term “operably linked” can refer to a covalent linkage, such as a peptide bond (e.g. the two elements are polypeptides and are on the same polypeptide), or a non-covalent linkage, such as Van der Waals force (e.g. two polypeptides that have a certain degree of specific binding affinity for each other).
- the TCR-a polypeptide and TCR-b polypeptide are operably linked through a peptide bond.
- the TCR-a polypeptide and TCR-b polypeptide are on the same polypeptide and wherein the TCR-b is amino-proximal to the TCR-a.
- the polypeptide may be further defined as a single-chain TCR.
- the TCR-a polypeptide and TCR-b polypeptide may be on the same polypeptide and wherein the TCR-a is amino-proximal to the TCR-b.
- the TCR may comprise a linker between the TCR-a and TCR-b polypeptide.
- the linker may comprise glycine and serine residues. In some aspects, the linker is composed of only glycine and serine residues (a glycine- serine linker).
- the linker may be a flexible linker.
- Exemplary flexible linkers include glycine polymers (G)n, glycine- serine polymers (including, for example, (GS)n, (GSGGS - SEQ ID NO:55)n, (G 4 S)n and (GGGS - SEQ ID NO:62)n, where n is an integer of at least one. In some aspects, n is at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 (or any derivable range therein). Glycine- alanine polymers, alanine- serine polymers, and other flexible linkers known in the art and may be used as a linker in the polypeptides of the disclosure.
- Exemplary linkers can comprise or consist of GGSG (SEQ ID NO:56), GGSGG (SEQ ID NO:57), GSGSG (SEQ ID NO:58), GSGGG(SEQ ID NO:59), GGGSG (SEQ ID NO:60), GSSSG (SEQ ID N0:61), and the like. Further linkers useful in the polypeptides and TCRs of the disclosure are described herein.
- a first region is carboxy-proximal to a second region when the first region is attached to the carboxy terminus of the second region. There may be further intervening amino acid residues between the first and second regions. Thus, the regions need not be immediately adjacent, unless specifically specified as not having intervening amino acid residues.
- amino-proximal is similarly defined in that a first region is amino-proximal to a second region when the first region is attached to the amino terminus of the second region. Similarly, there may be further intervening amino acid residues between the first and second regions unless stated otherwise.
- a CDR may also comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 16, 18, 19, 20, 21, 22, 23, or more contiguous amino acid residues (or any range derivable therein) flanking one or both sides of a particular CDR sequence; therefore, there may be one or more additional amino acids at the N-terminal or C-terminal end of a particular CDR sequence, such as those shown in SEQ ID NOS:5-7, 12-14, 19-21, 26-28, 33-35, and 40-42.
- a CDR may also be a fragment of a CDR described herein and may lack at least 1, 2, 3, 4, or 5 amino acids from the C-terminal or N-terminal end of a particular CDR sequence.
- the TCR or fusion protein may be conjugated to a detection or therapeutic agent.
- the agent may comprise a fluorescent molecule, radiative molecule, or toxin.
- the TCR or fusion protein is conjugated to an agent described herein.
- the disclosure also provides for a nucleic acid encoding a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:7 and/or a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO: 14.
- the nucleic acid encodes a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:7 and/or the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 14.
- the nucleic acid may encode for a TCR-a polypeptide comprising a CDR1, CDR2, and CDR3 and/or a TCR-b polypeptide comprising a CDR1, CDR2, and CDR3.
- the nucleic acid may encode for a TCR-a comprising a CDR1 with at least 80% sequence identity to SEQ ID NO:5 and/or a TCR-b comprising a CDR1 with at least 80% sequence identity to SEQ ID NO: 12.
- the nucleic acid encodes for a TCR-a comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:5 and/or a TCR-b comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 12.
- the nucleic acid encodes for a TCR-a comprising a CDR2 with at least 80% sequence identity to SEQ ID NO:6 and/or a TCR- b comprising a CDR2 with at least 80% sequence identity to SEQ ID NO: 13.
- the nucleic acid encodes for a TCR-a comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:6 and/or a TCR-b comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 13.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 3 and/or a TCR-b variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 10.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:3 and/or a TCR-b variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87,
- the nucleic acid encodes a TCR-a polypeptide chain comprises the amino acid sequence of SEQ ID NO:3 and/or a TCR-b chain comprising an amino acid of SEQ ID NO: 10.
- the nucleic acid comprises SEQ ID NO:l and/or SEQ ID NO:8.
- the nucleic acid comprises a nucleic acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:l and/or having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the disclosure also provides for a nucleic acid encoding a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:21 and/or a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:28.
- the nucleic acid encodes a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:21 and/or the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:28.
- the nucleic acid may encode for a TCR-a polypeptide comprising a CDR1, CDR2, and CDR3 and/or a TCR-b polypeptide comprising a CDR1, CDR2, and CDR3.
- the nucleic acid may encode for a TCR-a comprising a CDR1 with at least 80% sequence identity to SEQ ID NO: 19 and/or a TCR-b comprising a CDR1 with at least 80% sequence identity to SEQ ID NO:26.
- the nucleic acid encodes for a TCR-a comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 19 and/or a TCR-b comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:26.
- the nucleic acid encodes for a TCR-a comprising a CDR2 with at least 80% sequence identity to SEQ ID NO:20 and/or a TCR-b comprising a CDR2 with at least 80% sequence identity to SEQ ID NO:27.
- the nucleic acid encodes for a TCR-a comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:20 and/or a TCR-b comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:27.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO: 17 and/or a TCR-b variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO:24.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO: 17 and/or a TCR-b variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:24.
- the nucleic acid encodes a TCR- a polypeptide chain comprises the amino acid sequence of SEQ ID NO: 17 and/or a TCR-b chain comprising an amino acid of SEQ ID NO:24. In some aspects, the nucleic acid comprises SEQ ID NO: 15 and/or SEQ ID NO:22.
- the nucleic acid comprises a nucleic acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:15 and/or having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:22.
- the disclosure also provides for a nucleic acid encoding a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:35 and/or a TCR-b polypeptide comprising a CDR3 comprising an amino acid sequence with at least 80% sequence identity to SEQ ID NO:42.
- the nucleic acid encodes a TCR-a polypeptide comprising a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:35 and/or the TCR-b polypeptide comprises a CDR3 comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:42.
- the nucleic acid may encode for a TCR-a polypeptide comprising a CDR1, CDR2, and CDR3 and/or a TCR-b polypeptide comprising a CDR1, CDR2, and CDR3.
- the nucleic acid may encode for a TCR-a comprising a CDR1 with at least 80% sequence identity to SEQ ID NO:33 and/or a TCR-b comprising a CDR1 with at least 80% sequence identity to SEQ ID NO:40.
- the nucleic acid encodes for a TCR-a comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:33 and/or a TCR-b comprising a CDR1 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:40.
- the nucleic acid encodes for a TCR-a comprising a CDR2 with at least 80% sequence identity to SEQ ID NO:34 and/or a TCR-b comprising a CDR2 with at least 80% sequence identity to SEQ ID NO:41.
- the nucleic acid encodes for a TCR-a comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:34 and/or a TCR-b comprising a CDR2 having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:41.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO:31 and/or a TCR-b variable region comprising an amino acid sequence with at least 70% sequence identity to SEQ ID NO:38.
- the nucleic acid encodes a TCR-a variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:31 and/or a TCR-b variable region comprising an amino acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:38.
- the nucleic acid encodes a TCR- a polypeptide chain comprises the amino acid sequence of SEQ ID NO:31 and/or a TCR-b chain comprising an amino acid of SEQ ID NO:38. In some aspects, the nucleic acid comprises SEQ ID NO:29 and/or SEQ ID NO:36.
- the nucleic acid comprises a nucleic acid sequence having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:29 and/or having or having at least 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any derivable range therein) sequence identity to SEQ ID NO:36.
- the nucleic acid may comprise a TCR-a (TRA) and TCR-b (TRB) gene.
- the nucleic acid may be polycistronic.
- the nucleic acid may also comprise an internal ribosome entry site (IRES) or a P2A linker.
- the nucleic acid may comprise a cDNA encoding the TCR-a and/or TCR-b genes.
- the nucleic acid may encode or further encode for a polypeptide comprising a CD3 binding region.
- the CD3 binding region comprises a CD3-specific fragment antigen binding (Fab), single chain variable fragment (scFv), single domain antibody, or single chain antibody.
- the peptide may comprise at least 6 contiguous amino acids of a peptide of one of SEQ ID NOS:43-45.
- the peptide may comprise, consist of, or comprise at least 4, 5, 6, 7, 8, 9, or 10 contiguous amino acids of a peptide of one of SEQ ID NOS:43-45.
- the peptide may comprise or consist of the amino acid sequence of one of SEQ ID NOS:43-45.
- the peptide comprises or consists of SEQ ID NO:43.
- the peptide comprises or consists of SEQ ID NO:44.
- the peptide comprises or consists of SEQ ID NO:45.
- the peptide is 13 amino acids in length or shorter.
- the peptide may have at least, at most, exactly, or consist of 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids (or any range derivable therein). In a specific aspect, the peptide consists of 10 amino acids. In a specific aspect, the peptide consists of 9 amino acids. The peptide may consist of 8 amino acids. The peptide may consist of 7 amino acids. The peptide may consist of 6 amino acids. In some aspects, the peptide is immunogenic. The term immunogenic may refer to the production of an immune response, such as a protective immune response. The peptide may be modified. The modification may comprise conjugation to a molecule. The molecule may be an antibody, a lipid, an adjuvant, or a detection moiety (tag).
- the peptide may comprise 100% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- Peptides of the disclosure also include those that have or have at least 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67,
- the peptide may have or have at least 60% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 66% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 70% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 77% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 80% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 88% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have or have at least 90% sequence identity to a peptide of one of SEQ ID NOS:43-45.
- the peptides of the disclosure may have 1, 2, or 3 substitutions relative to a peptide of one of SEQ ID NOS:43-45.
- the peptide may have at least or have at most 1, 2, 3, 4, or 5 substitutions relative to a peptide of one of SEQ ID NOS:43-45.
- the composition may be formulated for parenteral administration, intravenous injection, intramuscular injection, inhalation, or subcutaneous injection.
- the peptide may be comprised in a liposome, lipid-containing nanoparticle, or in a lipid-based carrier.
- the compositions of the disclosure are formulated as a vaccine.
- the composition may further comprise an adjuvant.
- the dendritic cell comprises a mature dendritic cell.
- the cell may be a cell with an HLA-A type.
- the HLA may be a HLA-A, HLA-B, or HLA-C.
- the cell is an HLA-A02 type.
- the cell may also be an HLA-A24 type.
- the cell is an HLA-A0201 type or a HLA-A2402 type.
- the cell is an HLA-A01, HLA-A02, HLA-A11, HLA-A24, HLA-B07, HLA-B08, HLA-B 15, or HLA-B40.
- the method may further rcomprise isolating the expressed peptide or polypeptide.
- the T cell comprises a CD8+ T cell.
- the T cell is a CD4+ T cell, a Thl, Th2, Thl7, Th9, or Tfh T cell, a cytotoxic T cell, a memory T cell, a central memory T cell, or an effector memory T cell.
- the vector may comprise both of the TCR-a and TCR-b genes.
- the vector may comprise a promoter that directs the expression of the nucleic acid.
- the promoter may comprise a murine stem cell vims (MSCV) promoter.
- the cell comprises a stem cell, a progenitor cell, an immune cell, or a natural killer (NK) cell.
- the cell comprises a hematopoietic stem or progenitor cell, a T cell, a cell differentiated from mesenchymal stem cells (MSCs) or an induced pluripotent stem cell (iPSC).
- MSCs mesenchymal stem cells
- iPSC induced pluripotent stem cell
- the cell may be isolated or derived from peripheral blood mononuclear cell (PBMCs).
- the T cell comprises a cytotoxic T lymphocyte (CTL), a CD8+ T cell, a CD4+ T cell, an invariant NK T (iNKT) cell, a gamma-delta T cell, a NKT cell, or a regulatory T cell.
- CTL cytotoxic T lymphocyte
- iNKT invariant NK T
- gamma-delta T cell a NKT cell, or a regulatory T cell.
- the cell is isolated from a cancer patient.
- the cell is isolated from a non-cancerous patient.
- the cell is isolated from a healthy patient.
- the cell may be frozen or may have never been frozen.
- the cell may be in cell culture.
- the cell lacks endogenous expression of TCR genes.
- the cell further comprises a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the composition has been determined to be serum-free, mycoplasma-free, endotoxin-free, and/or sterile.
- the method may comprise or further comprise culturing the cell in media, incubating the cell at conditions that allow for the division of the cell, screening the cell, and/or freezing the cell.
- the subject has been diagnosed with cancer, such as a cancer described herein.
- the cancer may comprise a solid tumor.
- the subject may be one that has been previously been treated for the cancer.
- the subject may be one that has been determined to be resistant to the previous treatment.
- the method may comprise or further comprise the administration of an additional therapy.
- the cancer may be further defined as a solid tumor.
- the cancer may also be a blood cancer, such as leukemia.
- the cancer may be a cancer described herein.
- the cancer may be a stage I, II, III, or IV cancer.
- the cancer may comprise metastatic and/or recurrent cancer.
- the cancer may comprise a FANCI antigen-positive cancer.
- the cancer may comprise a cancer that expresses a peptide of SEQ ID NO:43.
- the cancer may comprise a RAD51 antigen positive cancer.
- the cancer may comprise cancer cells that are positive for a peptide of SEQ ID NO:44.
- the cancer may comprise a PBK antigen positive cancer.
- the cancer may comprise cancer cells that are positive for a peptide of SEQ ID NO:45.
- the subject may be one that has been determined to have a FANCI antigen positive cancer.
- the subject may be one that has been determined to have cancer cells that are positive for a peptide of SEQ ID NO:43.
- the subject may be one that has been determined to have a RAD5 1 antigen positive cancer.
- the subject may be one that has been determined to have cancer cells that are positive for a peptide of SEQ ID NO:44.
- the subject may be one that has been determined to have a PBK antigen positive cancer.
- the subject may be one that has been determined to have cancer cells that are positive for a peptide of SEQ ID NO:45.
- the cancer is a FANCI, RAD51, or PBK overexpressing cancer, such as overexpression compared to a non-cancerous subject.
- the subject or patient may be one that has been determined to have FANCI, RAD51, or PBK antigen overexpression in a biological sample.
- the biological sample may comprise cancer cells or a biopsy.
- the subject may be a mammal.
- the subject comprises a laboratory test animal, such as a mouse, rat, rabbit, dog, cat, horse, or pig.
- the subject is a human.
- the subject has been determined to be HLA-A2 and/or HLA-A*0201 positive.
- the subject has been determined to have cancerous cells that express a peptide of one of SEQ ID NOS:43-45.
- compositions of the disclosure may be formulated as a vaccine.
- the compositions and methods of the disclosure provide for prophylactic therapies to prevent cancer.
- the compositions and methods of the disclosure provide for therapeutic therapies to treat existing cancers, such as for the treatment of patients with cancer.
- the composition may comprise or further comprise an adjuvant.
- Adjuvants are known in the art and include, for example, TLR agonists and aluminum salts.
- the methods of the disclosure may comprise or further comprise screening the cell for one or more cellular properties, such as for TCR expression, incorporation of nucleic acids encoding TCR genes, or for immunogenic properties, such as binding of the TCR to a cancer antigen such as a peptide of one of SEQ ID NOS:43-45.
- the method may comprise or further comprise administering a cell or a composition comprising a cell and wherein the cell comprises an autologous cell.
- the cell comprises a non- autologous cell.
- the cell may also be allogenic or xenogenic.
- compositions may comprise a MHC polypeptide and a peptide of the disclosure and wherein the MHC polypeptide and/or peptide is conjugated to a detection tag.
- suitable detection tags include, but are not limited to radioisotopes, fluorochromes, chemiluminescent compounds, dyes, and proteins, including enzymes.
- the tag may be simply detected or it may be quantified .
- a response that is simply detected generally comprises a response whose existence merely is confirmed, whereas a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
- the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
- luminescent tags that produce signals include, but are not limited to bioluminescence and chemiluminescence.
- suitable fluorescent tags include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade Blue.TM., and Texas Red.
- Other suitable optical dyes are described in the Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6th). Detection tags also include streptavidin or it’s binding partner, biotin.
- the MHC polypeptide and peptide may be operatively linked.
- operatively linked refers to a situation where two components are combined or capable of combining to form a complex.
- the components may be covalently attached and/or on the same polypeptide, such as in a fusion protein or the components may have a certain degree of binding affinity for each other, such as a binding affinity that occurs through van der Waals forces.
- aspects of the disclosure relate to wherein the MHC polypeptide and peptide are operatively linked through a peptide bond. Further aspects relate to wherein the MHC polypeptide and peptide are operatively linked through van der Waals forces.
- the peptide-MHC may be operatively linked to form a pMHC complex.
- at least two pMHC complexes are operatively linked together.
- Other aspects include, include at least, or include at most 2, 3, 4, 5, 6, 7, 8, 9, or 10 pMHC complexes operatively linked to each other.
- at least two MHC polypeptides are linked to one peptide.
- the average ratio of MHC polypeptides to peptides is 1:1 to 4:1. In some aspects, the ratio or average ratio is at least, at most, or about 1, 2, 3, 4, 5, or 6 to about 1, 2, 3, 4, 5, or 6 (or any derivable range therein).
- the peptide is complexed with MHC
- the MHC comprises HLA-A, HLA-B, or HLA-C type.
- the peptides may be loaded onto dendritic cells, lymphoblastoid cells, peripheral blood mononuclear cells (PBMCs), artificial antigen presentation cells (aAPC) or artificial antigen presenting surfaces.
- the artificial antigen presenting surface comprises a MHC polypeptide conjugated or linked to a surface. Exemplary surfaces include a bead, microplate, glass slide, or cell culture plate.
- Method of the disclosure may further comprise counting the number of T cells bound with peptide and/or MHC.
- the composition comprising T cells may be isolated from a subject.
- the subject may be one, as defined herein, such as a human subject.
- the method may further comprise sorting the number of T cells bound with peptide and/or MHC.
- Methods of the disclosure may also comprise or further comprise sequencing one or more TCR genes from T cells bound with peptide and/or MHC.
- the method comprises or further comprises sequencing the TCR alpha and/or beta gene(s) from a TCR, such as a TCR that binds to a peptide of the disclosure.
- Methods may also comprise or further comprise grouping of lymphocyte interactions by paratope hotspots (GLIPH) analysis. This is further described in Glanville et ak, Nature. 2017 Jul 6; 547(7661): 94-98, which is herein incorporated by reference.
- LMIPH paratope hotspots
- compositions of the disclosure may be serum-free, mycoplasma-free, endotoxin-free, and/or sterile.
- the methods may further comprise culturing cells of the disclosure in media, incubating the cells at conditions that allow for the division of the cell, screening the cells, and/or freezing the cells.
- the methods may also further comprise isolating the expressed peptide or polypeptide from a cell of the disclosure.
- Methods of the disclosure may comprise or further comprise screening the dendritic cell for one or more cellular properties.
- the method further comprises contacting the cell with one or more cytokines or growth factors.
- the one or more cytokines or growth factors may comprise GM-CSF.
- the cellular property comprises cell surface expression of one or more of CD86, HLA, and CD 14.
- the dendritic cell may be derived from a CD34+ hematopoietic stem or progenitor cell.
- the contacting in the methods of the disclosure may be further defined as co culturing the starting population of immune effector cells with antigen presenting cells (APCs), wherein the APCs present the peptide on their surface.
- APCs antigen presenting cells
- the APCs are dendritic cells.
- the dendritic cell is derived from a peripheral blood monocyte (PBMC).
- PBMC peripheral blood monocyte
- the dendritic cells are isolated from PBMCs.
- the dendritic cells or the cells in which the DCs are derived from are isolated by leukaphereses.
- Peptide-MHC (pMHC) complexes in the aspects of the disclosure may be made by contacting a peptide of the disclosure with a MHC complex.
- the peptide is expressed in the cell and binds to endogenous MHC complex to form a pMHC.
- peptide exchange is used to make the pMHC complex.
- cleavable peptides such as photocleavable peptides may be designed that bind to and stabilize the MHC. Cleavage of the peptide (eg.
- peptides of the disclosure may be used as “rescue peptides” in the peptide exchange procedure.
- Further aspects of the disclosure relate to pMHC complexes comprising a peptide of the disclosure.
- the pMHC complex may be operatively linked to a solid support or may be attached to a detectable moiety, such as a fluorescent molecule, a radioisotope, or an antibody.
- peptide-MHC multimeric complexes that include, include at least or include at most 1, 2, 3, 4, 5, or 6 peptide-MHC molecules operatively linked together.
- the linkage may be covalent, such as through a peptide bond, or non-covalent.
- pMHC molecules may be bound to a biotin molecule.
- Such pMHC molecules may be multimerized through binding to a streptavidin molecule.
- pMHC multimers may be used to detect antigen- specific T cells or TCR molecules that are in a composition or in a tissue. The multimers may be used to detect peptide- or peptide- specific T cells in situ or in a biopsy sample.
- Multimers may be bound to a solid support or deposited on a solid support, such as an array or slide. Cells may then be added to the slide, and detection of the binding between the pMHC multimer and cell may be conducted. Accordingly, the pMHC molecules and multimers of the disclosure may be used to detect and diagnose cancer in subjects or to determine immune responses in individuals with cancer.
- the methods may comprise or further comprise obtaining a population of cells.
- Obtaining, as defined in the methods described herein, may comprise or further comprise isolating starting population of immune effector cells from peripheral blood mononuclear cells (PBMCs).
- the starting population of immune effector cells is obtained from a subject.
- the methods of the disclosure may comprise or further comprise introducing the peptides or a nucleic acid encoding the peptide into the dendritic cells prior to the co-culturing.
- the introduction of the peptide may be done by transfecting or infecting dendritic cells with a nucleic acid encoding the peptide or by incubating the peptide with the dendritic cells.
- the peptide or nucleic acids encoding the peptide may be introduced by electroporation. Other methods of transfer of nucleic acids are known in the art, such as lipofection, calcium phosphate transfection, transfection with DEAE-dextran, microinjection, and virus-mediated transduction, and are useful in methods of the disclosure for transferring nucleic acids of the disclosure into cells.
- the peptide or nucleic acids encoding the peptide are introduced by adding the peptide or nucleic acid encoding the peptide to the dendritic cell culture media.
- the immune effector cells are co-cultured with a second population of dendritic cells into which the peptide or the nucleic acid encoding the peptide has been introduced.
- a population of CD4-positive or CD8-positive and peptide MHC tetramer-positive T cells are purified from the immune effector cells following the co-culturing.
- the population of CD4-positive or CD8-positive and peptide MHC tetramer-positive T cells are purified by fluorescence activated cell sorting (FACS).
- FACS fluorescence activated cell sorting
- a clonal population of peptide- specific immune effector cells are generated by limiting or serial dilution followed by expansion of individual clones by a rapid expansion protocol.
- purifying further comprises generation of a clonal population of peptide- specific immune effector cells by limiting or serial dilution of sorted cells followed by expansion of individual clones by a rapid expansion protocol.
- Methods of the disclosure may comprise or further comprise cloning of a T cell receptor (TCR) from the clonal population of peptide- specific immune effector cells.
- TCR T cell receptor
- the term isolating in the methods of the disclosure may be defined or further defined as cloning of a T cell receptor (TCR) from the clonal population of peptide- specific immune effector cells.
- cloning of the TCR is cloning of a TCR alpha and a beta chain.
- the TCR is cloned using a 5 ’-Rapid amplification of cDNA ends (RACE) method.
- the TCR alpha and beta chains are cloned using a 5’-Rapid amplification of cDNA ends (RACE) method.
- the cloned TCR is subcloned into an expression vector.
- the expression vector comprises a linker domain between the TCR alpha sequence and TCR beta sequence.
- the expression vector may be a retroviral or lentiviral vector.
- the vector may also be an expression vector described herein.
- the linker domain may comprise a sequence encoding one or more peptide cleavage sites.
- the one or more cleavage sites may be a Furin cleavage site and/or a P2A cleavage site.
- the TCR alpha sequence and TCR beta sequence are linked by an IRES sequence.
- a host cell of the disclosure may be transduced with an expression vector to generate an engineered cell that expresses the TCR alpha and/or beta chains.
- the host cell is an immune cell.
- the immune cell may be a T cell and the engineered cell may be referred to as an engineered T cell.
- the T cell may be type of T cell described herein, such as a CD8 + T cell, CD4+ T cell, or gd T cell.
- the starting population of immune effector cells may be obtained from a subject having cancer and the host cell is allogeneic or autologous to the subject.
- the peptide- specific T cells may be autologous or allogeneic.
- a population of CD4- positive or CD8-positive and peptide MHC tetramer-positive engineered T cells may be purified from the transduced host cells.
- a clonal population of peptide- specific engineered T cells are generated by limiting or serial dilution followed by expansion of individual clones by a rapid expansion protocol.
- purifying in the methods of the disclosure is defined as purifying a population of CD4-positive or CD8-positive and peptide MHC tetramer-positive T cells from the immune effector cells following the co-culturing.
- the peptide may be linked to a solid support.
- the peptide is conjugated to the solid support or is bound to an antibody that is conjugated to the solid support.
- the solid support may comprise a microplate, a bead, a glass surface, a slide, or a cell culture dish.
- the solid support comprises a nanofluidic chip.
- Detecting T cell responses may comprise or further comprise detecting the binding of the peptide to the T cell or TCR.
- detecting T cell responses comprises an ELISA, ELISPOT, or a tetramer assay.
- Methods of the disclosure may also be used for determining the efficacy of a vaccine, such as a cancer vaccine.
- Treatment may refer to any treatment of a disease in a mammal, including: (i) preventing the disease, that is, causing the clinical symptoms of the disease not to develop by administration of a protective composition prior to the induction of the disease; (ii) suppressing the disease, that is, causing the clinical symptoms of the disease not to develop by administration of a protective composition after the inductive event but prior to the clinical appearance or reappearance of the disease; (iii) inhibiting the disease, that is, arresting the development of clinical symptoms by administration of a protective composition after their initial appearance; and/or (iv) relieving the disease, that is, causing the regression of clinical symptoms by administration of a protective composition after their initial appearance.
- the treatment may exclude prevention of the disease.
- x, y, and/or z can refer to “x” alone, “y” alone, “z” alone, “x, y, and z,” “(x and y) or z,” “x or (y and z),” or “x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment or aspect.
- compositions and methods for their use can “comprise,” “consist essentially of,” or “consist of’ any of the ingredients or steps disclosed throughout the specification.
- any method in the context of a therapeutic, diagnostic, or physiologic purpose or effect may also be described in “use” claim language such as “Use of’ any compound, composition, or agent discussed herein for achieving or implementing a described therapeutic, diagnostic, or physiologic purpose or effect.
- Use of the one or more sequences or compositions may be employed based on any of the methods described herein. Other embodiments are discussed throughout this application. Any embodiment or aspect discussed with respect to one aspect of the disclosure applies to other aspects of the disclosure as well and vice versa.
- any limitation discussed with respect to one embodiment or aspect of the invention may apply to any other embodiment or aspect of the invention.
- any composition of the invention may be used in any method of the invention, and any method of the invention may be used to produce or to utilize any composition of the invention.
- Aspects of an embodiment set forth in the Examples are also embodiments that may be implemented in the context of embodiments discussed elsewhere in a different Example or elsewhere in the application, such as in the Summary of Invention, Detailed Description of the Embodiments, Claims, and description of Figure Legends.
- FIG. 1 FANCI-16 HLA-A0201 restricted peptide (KLQEFLQTL - SEQ ID NO:43) CTL generation.
- FIG. 2A-H Functional validation of FANCI-16 peptide specific CTL cell lines.
- FIG. 3. RAD51-254 HLA-A0201 restricted peptide (RLADEFGVAV - SEQ ID NO:44) CTL generation.
- FIG. 4A-E Functional validation of RAD51-254 peptide specific CTL cell lines.
- FIG. 5. PBK-289 HLA-A2402 restricted peptide (SYQKVIELF - SEQ ID NO:45) CTL generation.
- FIG. 6A-E Functional validation of PBK-289 peptide specific CTL cell lines. DETAILED DESCRIPTION OF THE INVENTION
- the peptides of the disclosure may be from the FANCI (FA complementation group
- the FANCI protein may have the amino acid of SEQ ID NO:46: DQKILSLAAEKTADKLQEFLQTLREGDLTNLLQNQAVKGKVAGALLRAIFKGSPCSE EAGTLRRRKIYTCCIQLVESGDLQKEIASEIIGLLMLEAHHFPGPLLVELANEFISAVRE GSLVNGKSLELLPIILTALATKKENLAYGKGVLSGEECKKQLINTLCSGRWDQQYVI QLT S MFKD VPLT AEE VEFV VEKALS MF S KMNLQEIPPL V Y QLL VLS S KGS RKS VLEGI IAFFSALDKQHNEEQSGDELLDVVTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKH LKV GQQGDS NNNLS PF S IALLLS VTRIQRF QDQ VLDLLKTS V VKS FKDLQLLQGS KFL QNLVPHRS Y V S
- Isoforms of the FANCI gene is represented by GENBANK ACCESSION NOS: NP_001106849.1, NP_001363839.1, NP_001363840.1, NP_060663.2, XP_011520058.1, and XP_011520066.1.
- the sequences associated with these GENBANK NOS. are herein incorporated by reference.
- the peptide of SEQ ID NO:43 represents a peptide from the FANCI gene.
- the peptides of the disclosure may be from a RAD51 (RAD51 recombinase) cancer antigen.
- the RAD51 protein may have the amino acid of SEQ ID NO:47: M AMQMQLE AN ADTS VEEES FGPQPIS RLEQC GIN AND VKKLEE AGFHT VE A V AY AP KKELINIKGIS E AK ADKILTES RS V ARLECNS VIL V Y CTLRLS GS S DS P AS AS R V V GTT GGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLL A V AERY GLS GS D VLDN V AY AR AFNTDHQT QLL Y Q AS AMM VES R Y ALLIVDS AT AL YRTD Y S GRGELS ARQMHL ARFLRMLLRLADEF G V A V VITN Q V V AQ VDG A AMFA AD PKKPIGGNIIAH AS TTRLYLRKGRGETRIC KI YDS PCLPE AE AMFAIN ADG V GD AKD (SEQ ID NO:47).
- Isoforms of the RAD51 gene is represented by GENBANK ACCESSION NOS:. NP_001157741.1, NP_001157742.1, NP_002866.2, NP_597994.3, XP_011520163.1, XP_011520159.1, XP_011520164.1, XP_011520162.1, XP_006720689.1, XP_011520160.1, and XP_011520161.1
- the sequences associated with these GENBANK NOS. are herein incorporated by reference.
- the peptide of SEQ ID NO:44 represents a peptide from the RAD51 gene.
- the peptides of the disclosure are from a PBK (PDZ binding kinase) cancer antigen.
- the PBK protein may have the amino acid of SEQ ID NO:48: MEGIS NFKTPS KLS EKKKS VLC S TPTINIP AS PFMQKLGF GTG VN V YLMKRS PRGLS H S PW A VKKINPICNDH YRS V Y QKRLMDE AKILKS LHHPNIV G YRAFTE ANDGS LCLA MEYGGEKSI ,NDT JEER YK ASODPEP A AIII ,KV AT NMAR GT .KYI TGOEKKI .1 TfGDTKSS N V VIKGDFETIKICD V G V S LPLDENMT AP AFITILL V S VTDPE AC YIGTEP WKPKE A VE EN G VITD KADIFAFGLTLWEMMTLS IPHINLS NDDDDED KTFDES DFDDE A YY A ALG TRPPINMEELDES Y QK VIELF S V CTNEDPKDRPS A AHIVE ALETD V (SEQ ID
- Isoforms of the PBK gene is represented by GENBANK ACCESSION NOS:. NP_001265874.1, NP_001349969.1, NP_060962.2. The sequences associated with these GENBANK NOS. are herein incorporated by reference.
- the peptide of SEQ ID NO:45 represents a peptide from the PBK gene.
- T-cell receptors comprise two different polypeptide chains, termed the T-cell receptor a (TCRa) and b (TCRP) chains, linked by a disulfide bond. These a:b heterodimers are very similar in structure to the Fab fragment of an immunoglobulin molecule, and they account for antigen recognition by most T cells. A minority of T cells bear an alternative, but structurally similar, receptor made up of a different pair of polypeptide chains designated g and d.
- T-cell receptor Both types differ from the membrane -bound immunoglobulin that serves as the B-cell receptor: a T-cell receptor has only one antigen-binding site, whereas a B-cell receptor has two, and T-cell receptors are never secreted, whereas immunoglobulin can be secreted as antibody.
- Both chains of the T-cell receptor have an amino-terminal variable (V) region with homology to an immunoglobulin V domain, a constant (C) region with homology to an immunoglobulin C domain, and a short hinge region containing a cysteine residue that forms the interchain disulfide bond.
- V amino-terminal variable
- C constant
- a short hinge region containing a cysteine residue that forms the interchain disulfide bond Each chain spans the lipid bilayer by a hydrophobic transmembrane domain, and ends in a short cytoplasmic tail.
- the three-dimensional structure of the T-cell receptor has been determined. The structure is indeed similar to that of an antibody Fab fragment, as was suspected from earlier studies on the genes that encoded it.
- the T-cell receptor chains fold in much the same way as those of a Fab fragment, although the final structure appears a little shorter and wider. There are, however, some distinct differences between T-cell receptors and Fab fragments. The most striking difference is in the Ca domain, where the fold is unlike that of any other immunoglobulin-like domain.
- the half of the domain that is juxtaposed with the €b domain forms a b sheet similar to that found in other immunoglobulin-like domains, but the other half of the domain is formed of loosely packed strands and a short segment of a helix.
- the intramolecular disulfide bond which in immunoglobulin-like domains normally joins two b strands, in a Ca domain joins a b strand to this segment of a helix.
- Va CDR2 loop which is oriented at roughly right angles to the equivalent loop in antibody V domains, as a result of a shift in the b strand that anchors one end of the loop from one face of the domain to the other.
- a strand displacement also causes a change in the orientation of the Ub CDR2 loop in two of the seven Ub domains whose structures are known.
- crystallographic structures of seven T-cell receptors have been solved to this level of resolution.
- the term “engineered” refers to T cell receptors that have TCR variable regions grafted onto TCR constant regions to make a chimeric polypeptide that binds to peptides and antigens of the disclosure.
- the TCR comprises intervening sequences that are used for cloning, enhanced expression, detection, or for therapeutic control of the construct, but are not present in endogenous TCRs, such as multiple cloning sites, linker, hinge sequences, modified hinge sequences, modified transmembrane sequences, a detection polypeptide or molecule, or therapeutic controls that may allow for selection or screening of cells comprising the TCR.
- the TCR comprises non-TCR sequences. Accordingly, certain aspects relate to TCRs with sequences that are not from a TCR gene. In some aspects, the TCR is chimeric, in that it contains sequences normally found in a TCR gene, but contains sequences from at least two TCR genes that are not necessarily found together in nature.
- the engineered TCRs of the disclosure comprise a variable as shown below:
- the following table relates to features of the TCR-a aspects of the RAD51 TCR: [0093] The following table relates to features of the TCR-b aspects of the RAD51 TCR:
- a “protein” “peptide” or “polypeptide” refers to a molecule comprising at least five amino acid residues.
- wild-type refers to the endogenous version of a molecule that occurs naturally in an organism.
- wild- type versions of a protein or polypeptide are employed, however, in many aspects of the disclosure, a modified protein or polypeptide is employed to generate an immune response.
- a “modified protein” or “modified polypeptide” or a “variant” refers to a protein or polypeptide whose chemical structure, particularly its amino acid sequence, is altered with respect to the wild-type protein or polypeptide.
- a modified/variant protein or polypeptide has at least one modified activity or function (recognizing that proteins or polypeptides may have multiple activities or functions). It is specifically contemplated that a modified/variant protein or polypeptide may be altered with respect to one activity or function yet retain a wild-type activity or function in other respects, such as immunogenicity.
- a protein is specifically mentioned herein, it is in general a reference to a native (wild-type) or recombinant (modified) protein or, optionally, a protein in which any signal sequence has been removed.
- the protein may be isolated directly from the organism of which it is native, produced by recombinant DNA/exogenous expression methods, or produced by solid-phase peptide synthesis (SPPS) or other in vitro methods.
- SPPS solid-phase peptide synthesis
- recombinant may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
- the size of a protein or polypeptide may comprise, but is not limited to, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
- polypeptides may be mutated by truncation, rendering them shorter than their corresponding wild-type form, also, they might be altered by fusing or conjugating a heterologous protein or polypeptide sequence with a particular function (e.g., for targeting or localization, for enhanced immunogenicity, for purification purposes, etc.).
- polypeptides, proteins, or polynucleotides encoding such polypeptides or proteins of the disclosure may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 (or any derivable range therein) or more variant amino acids or nucleic acid substitutions or be at least 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% (or any derivable
- the peptide or polypeptide is or is based on a human sequence. In certain aspects, the peptide or polypeptide is not naturally occurring and/or is in a combination of peptides or polypeptides.
- polypeptides of the disclosure may include at least, at most, or exactly 1, 2, 3,
- 504 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522,
- substitution may be at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
- the protein, polypeptide, or nucleic acid may comprise amino acids or nucleotides 1 to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
- the protein, polypeptide, or nucleic acid may comprise amino acids or nucleotides 1 to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
- the protein, polypeptide, or nucleic acid may comprise, comprise at least, or comprise at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
- polypeptide, protein, or nucleic acid may comprise at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
- nucleic acid molecule or polypeptide starting at position 1 there is a nucleic acid molecule or polypeptide starting at position
- nucleotide as well as the protein, polypeptide, and peptide sequences for various genes have been previously disclosed, and may be found in the recognized computerized databases.
- Two commonly used databases are the National Center for Biotechnology Information’s Genbank and GenPept databases (on the World Wide Web at ncbi.nlm.nih.gov/) and The Universal Protein Resource (UniProt; on the World Wide Web at uniprot.org).
- Genbank and GenPept databases on the World Wide Web at ncbi.nlm.nih.gov/
- the Universal Protein Resource UniProt; on the World Wide Web at uniprot.org.
- the coding regions for these genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
- compositions of the disclosure there is between about 0.001 mg and about 10 mg of total polypeptide, peptide, and/or protein per ml.
- concentration of protein in a composition can be about, at least about or at most about 0.001, 0.010, 0.050, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0,
- the term “functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six different codons for arginine. Also considered are “neutral substitutions” or “neutral mutations” which refers to a change in the codon or codons that encode biologically equivalent amino acids.
- Amino acid sequence variants of the disclosure can be substitutional, insertional, or deletion variants.
- a variation in a polypeptide of the disclosure may affect 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
- a variant can comprise an amino acid sequence that is at least 50%, 60%, 70%, 80%, or 90%, including all values and ranges there between, identical to any sequence provided or referenced herein.
- a variant can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more substitute amino acids.
- amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially identical as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned.
- the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non-coding sequences flanking either of the 5' or 3' portions of the coding region.
- Deletion variants typically lack one or more residues of the native or wild type protein. Individual residues can be deleted or a number of contiguous amino acids can be deleted. A stop codon may be introduced (by substitution or insertion) into an encoding nucleic acid sequence to generate a truncated protein.
- Insertional mutants typically involve the addition of amino acid residues at a non terminal point in the polypeptide. This may include the insertion of one or more amino acid residues. Terminal additions may also be generated and can include fusion proteins which are multimers or concatemers of one or more peptides or polypeptides described or referenced herein.
- Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein or polypeptide, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar chemical properties. “Conservative amino acid substitutions” may involve exchange of a member of one amino acid class with another member of the same class.
- Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
- amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics or other reversed or inverted forms of amino acid moieties.
- substitutions may be “non-conservative”, such that a function or activity of the polypeptide is affected. Non-conservative changes typically involve substituting an amino acid residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa. Non-conservative substitutions may involve the exchange of a member of one of the amino acid classes for a member from another class.
- polypeptides as set forth herein using well-known techniques.
- One skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
- the skilled artisan will also be able to identify amino acid residues and portions of the molecules that are conserved among similar proteins or polypeptides.
- areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without significantly altering the biological activity or without adversely affecting the protein or polypeptide structure.
- hydropathy index of amino acids may be considered.
- the hydropathy profile of a protein is calculated by assigning each amino acid a numerical value (“hydropathy index”) and then repetitively averaging these values along the peptide chain.
- Each amino acid has been assigned a value based on its hydrophobicity and charge characteristics.
- hydropathy amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte et al., J. Mol. Biol. 157:105-131 (1982)). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein or polypeptide, which in turn defines the interaction of the protein or polypeptide with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and others. It is also known that certain amino acids may be substituted for other amino acids having a similar hydropathy index or score, and still retain a similar biological activity. In making changes based upon the hydropathy index, in certain aspects, the substitution of amino acids whose hydropathy indices are within +2 is included. In some aspects of the invention, those that are within +1 are included, and in other aspects of the invention, those within +0.5 are included.
- hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0+1); glutamate (+3.0+1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine ( 0.4); proline (-0.5+1); alanine ( 0.5); histidine ( 0.5); cysteine (-1.0); methionine (-1.3); valine ( 1.5); leucine ( 1.8); isoleucine ( 1.8); tyrosine ( 2.3); phenylalanine ( 2.5); and tryptophan (-3.4).
- the substitution of amino acids whose hydrophilicity values are within +2 are included, in other aspects, those which are within +1 are included, and in still other aspects, those within +0.5 are included.
- one skilled in the art can review structure-function studies identifying residues in similar polypeptides or proteins that are important for activity or structure. In view of such a comparison, one can predict the importance of amino acid residues in a protein that correspond to amino acid residues important for activity or structure in similar proteins. One skilled in the art may opt for chemically similar amino acid substitutions for such predicted important amino acid residues.
- One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar proteins or polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three-dimensional structure. One skilled in the art may choose not to make changes to amino acid residues predicted to be on the surface of the protein, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue.
- amino acid substitutions are made that: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter ligand or antigen binding affinities, and/or (5) confer or modify other physicochemical or functional properties on such polypeptides.
- single or multiple amino acid substitutions may be made in the naturally occurring sequence.
- substitutions can be made in that portion of the antibody that lies outside the domain(s) forming intermolecular contacts.
- conservative amino acid substitutions can be used that do not substantially change the structural characteristics of the protein or polypeptide (e.g., one or more replacement amino acids that do not disrupt the secondary structure that characterizes the native antibody).
- nucleic acid sequences can exist in a variety of instances such as: isolated segments and recombinant vectors of incorporated sequences or recombinant polynucleotides encoding one or both chains of an antibody, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing described herein.
- Nucleic acids that encode the epitope to which certain of the antibodies provided herein are also provided.
- Nucleic acids encoding fusion proteins that include these peptides are also provided.
- the nucleic acids can be single- stranded or double-stranded and can comprise RNA and/or DNA nucleotides and artificial variants thereof (e.g., peptide nucleic acids).
- polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated from total genomic nucleic acid. Included within the term “polynucleotide” are oligonucleotides (nucleic acids 100 residues or less in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
- Polynucleotides may be single- stranded (coding or antisense) or double- stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non coding sequences may, but need not, be present within a polynucleotide.
- the term “gene,” “polynucleotide,” or “nucleic acid” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization). As will be understood by those in the art, this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants.
- a nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein.
- polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters).
- the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90%, preferably 95% and above, identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
- nucleic acid segments regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably.
- the nucleic acids can be any length.
- nucleic acid fragments of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
- a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic benefits such as targeting or efficacy.
- a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein “heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
- nucleic acids that hybridize to other nucleic acids under particular hybridization conditions are well known in the art. See, e.g., Current Protocols in Molecular Biology, John Wiley and Sons, N.Y. (1989), 6.3.1-6.3.6. As defined herein, a moderately stringent hybridization condition uses a prewashing solution containing 5x sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6xSSC, and a hybridization temperature of 55° C.
- SSC sodium chloride/sodium citrate
- pH 8.0 0.5%
- hybridization buffer of about 50% formamide
- 6xSSC 6xSSC
- hybridization temperature 55° C.
- a stringent hybridization condition hybridizes in 6xSSC at 45° C., followed by one or more washes in O.lxSSC, 0.2% SDS at 68° C.
- nucleic acids comprising nucleotide sequence that are at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to each other typically remain hybridized to each other.
- Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antibody or antibody derivative) that it encodes. Mutations can be introduced using any technique known in the art. In one aspect, one or more particular amino acid residues are changed using, for example, a site- directed mutagenesis protocol. In another aspect, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property.
- a polypeptide e.g., an antibody or antibody derivative
- Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues.
- one or more mutations can be introduced into a nucleic acid that selectively changes the biological activity of a polypeptide that it encodes. See, eg., Romain Studer et ah, Biochem. J. 449:581-594 (2013).
- the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include altering the antigen specificity of an antibody.
- nucleic acid molecules are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences.
- a nucleic acid molecule can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion of a given polypeptide.
- the nucleic acid molecules may be used as probes or PCR primers for specific antibody sequences.
- nucleic acid molecule probe may be used in diagnostic methods or a nucleic acid molecule PCR primer may be used to amplify regions of DNA that could be used, inter alia, to isolate nucleic acid sequences for use in producing variable domains of antibodies. See, eg., Gaily Kivi et al., BMC Biotechnol. 16:2 (2016).
- the nucleic acid molecules are oligonucleotides.
- the oligonucleotides are from highly variable regions of the heavy and light or alpha and beta chains of the antibody or TCR of interest.
- the oligonucleotides encode all or part of one or more of the CDRs or TCRs.
- Probes based on the desired sequence of a nucleic acid can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of interest.
- the probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses the polypeptide.
- nucleic acid molecule encoding polypeptides or peptides of the disclosure e.g TCR genes. These may be generated by methods known in the art, e.g., isolated from B cells of mice that have been immunized and isolated, phage display, expressed in any suitable recombinant expression system and allowed to assemble to form antibody molecules or by recombinant methods.
- the nucleic acid molecules may be used to express large quantities of polypeptides. If the nucleic acid molecules are derived from a non-human, non-transgenic animal, the nucleic acid molecules may be used for humanization of the TCR genes.
- contemplated are expression vectors comprising a nucleic acid molecule encoding a polypeptide of the desired sequence or a portion thereof (e.g., a fragment containing one or more CDRs or one or more variable region domains).
- Expression vectors comprising the nucleic acid molecules may encode the heavy chain, light chain, alpha chain, beta chain, or the antigen-binding portion thereof.
- expression vectors comprising nucleic acid molecules may encode fusion proteins, modified antibodies, antibody fragments, and probes thereof.
- vectors and expression vectors may contain nucleic acid sequences that serve other functions as well.
- DNAs encoding the polypeptides or peptides are inserted into expression vectors such that the gene area is operatively linked to transcriptional and translational control sequences.
- expression vectors used in any of the host cells contain sequences for plasmid or vims maintenance and for cloning and expression of exogenous nucleotide sequences.
- sequences collectively referred to as “flanking sequences” typically include one or more of the following operatively linked nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a poly linker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
- a promoter one or more enhancer sequences
- an origin of replication a transcriptional termination sequence
- a complete intron sequence containing a donor and acceptor splice site a sequence encoding a leader sequence for polypeptide
- Prokaryote- and/or eukaryote-based systems can be employed for use with an aspect to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides.
- Commercially and widely available systems include in but are not limited to bacterial, mammalian, yeast, and insect cell systems.
- Different host cells have characteristic and specific mechanisms for the post- translational processing and modification of proteins. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
- Those skilled in the art are able to express a vector to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide using an appropriate expression system.
- nucleic acid delivery to effect expression of compositions are anticipated to include virtually any method by which a nucleic acid (e.g., DNA, including viral and nonviral vectors) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art.
- a nucleic acid e.g., DNA, including viral and nonviral vectors
- Such methods include, but are not limited to, direct delivery of DNA such as by injection (U.S. Patents 5,994,624,5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, 1985; U.S.
- Patent 5,789,215 incorporated herein by reference
- electroporation U.S. Patent No. 5,384,253, incorporated herein by reference
- calcium phosphate precipitation Graham and Van Der Eb, 1973; Chen and Okayama, 1987; Rippe et ah, 1990
- DEAE dextran followed by polyethylene glycol
- direct sonic loading Fechheimer et ah, 1987
- liposome mediated transfection Nicolau and Sene, 1982; Fraley et ah, 1979; Nicolau et ah, 1987; Wong et ah, 1980; Kaneda et ah, 1989; Kato et ah, 1991
- microprojectile bombardment PCT Application Nos.
- Other methods include viral transduction, such as gene transfer by lentiviral or retroviral transduction.
- contemplated are the use of host cells into which a recombinant expression vector has been introduced.
- Antibodies can be expressed in a variety of cell types.
- An expression construct encoding an antibody can be transfected into cells according to a variety of methods known in the art.
- Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
- the antibody expression construct can be placed under control of a promoter that is linked to T-cell activation, such as one that is controlled by NFAT- 1 or NF-KB, both of which are transcription factors that can be activated upon T-cell activation.
- Control of antibody expression allows T cells, such as tumor- targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
- T cells such as tumor- targeting T cells, to sense their surroundings and perform real-time modulation of cytokine signaling, both in the T cells themselves and in surrounding endogenous immune cells.
- T cells such as tumor- targeting T cells
- cytokine signaling both in the T cells themselves and in surrounding endogenous immune cells.
- One of skill in the art would understand the conditions under which to incubate host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids
- a selectable marker e.g., for resistance to antibiotics
- Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods known in the arts.
- nucleic acid molecule encoding either or both of the entire heavy, light, alpha, and beta chains of an antibody or TCR, or the variable regions thereof may be obtained from any source that produces antibodies.
- Methods of isolating mRNA encoding an antibody are well known in the art. See e.g., Sambrook et ak, supra.
- sequences of human heavy and light chain constant region genes are also known in the art. See, e.g., Rabat et ak, 1991, supra.
- Nucleic acid molecules encoding the full-length heavy and/or light chains may then be expressed in a cell into which they have been introduced and the antibody isolated.
- the methods comprise administration of an additional therapy.
- the additional therapy comprises a cancer immunotherapy.
- Cancer immunotherapy (sometimes called immuno-oncology, abbreviated IO) is the use of the immune system to treat cancer.
- Immunotherapies can be categorized as active, passive or hybrid (active and passive). These approaches exploit the fact that cancer cells often have molecules on their surface that can be detected by the immune system, known as tumor- associated antigens (TAAs); they are often proteins or other macromolecules (e.g. carbohydrates).
- TAAs tumor- associated antigens
- Passive immunotherapies enhance existing anti-tumor responses and include the use of monoclonal antibodies, lymphocytes and cytokines. Immunotherapies are known in the art, and some are described below.
- aspects of the disclosure may include administration of immune checkpoint inhibitors, which are further described below. a. PD- 1, PDL1, and PDL2 inhibitors
- PD-1 can act in the tumor microenvironment where T cells encounter an infection or tumor. Activated T cells upregulate PD-1 and continue to express it in the peripheral tissues. Cytokines such as IFN-gamma induce the expression of PDL1 on epithelial cells and tumor cells. PDL2 is expressed on macrophages and dendritic cells. The main role of PD-1 is to limit the activity of effector T cells in the periphery and prevent excessive damage to the tissues during an immune response. Inhibitors of the disclosure may block one or more functions of PD-1 and/or PDL1 activity.
- Alternative names for “PD-1” include CD279 and SLEB2.
- Alternative names for “PDL1” include B7-H1, B7-4, CD274, and B7-H.
- Alternative names for “PDL2” include B7- DC, Btdc, and CD273.
- PD-1, PDL1, and PDL2 are human PD-1, PDL1 and PDL2.
- the PD-1 inhibitor is a molecule that inhibits the binding of PD-1 to its ligand binding partners.
- the PD-1 ligand binding partners are PDL1 and/or PDL2.
- a PDL1 inhibitor is a molecule that inhibits the binding of PDL1 to its binding partners.
- PDL1 binding partners are PD-1 and/or B7- 1.
- the PDL2 inhibitor is a molecule that inhibits the binding of PDL2 to its binding partners.
- a PDL2 binding partner is PD-1.
- the inhibitor may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
- Exemplary antibodies are described in U.S. Patent Nos. 8,735,553, 8,354,509, and 8,008,449, all incorporated herein by reference.
- Other PD-1 inhibitors for use in the methods and compositions provided herein are known in the art such as described in U.S. Patent Application Nos. US2014/0294898, US 2014/022021, and US2011/0008369, all incorporated herein by reference.
- the PD- 1 inhibitor is an anti-PD- 1 antibody (e.g., a human antibody, a humanized antibody, or a chimeric antibody).
- the anti-PD-1 antibody is selected from the group consisting of nivolumab, pembrolizumab, and pidilizumab.
- the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PDL1 or PDL2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
- the PDL1 inhibitor comprises AMP- 224.
- Nivolumab also known as MDX- 1106-04, MDX-1106, ONO-4538, BMS-936558, and OPDIVO®, is an anti-PD-1 antibody described in W02006/121168.
- Pembrolizumab also known as MK-3475, Merck 3475, lambrolizumab, KEYTRUDA®, and SCH-900475, is an anti-PD-1 antibody described in W02009/114335.
- Pidilizumab also known as CT-011, hBAT, or hBAT-1, is an anti-PD-1 antibody described in W02009/101611.
- AMP-224 also known as B7-DCIg, is a PDL2-Fc fusion soluble receptor described in W02010/027827 and WO201 1/066342.
- Additional PD-1 inhibitors include MED 10680, also known as AMP-514, and REGN2810.
- the immune checkpoint inhibitor is a PDL1 inhibitor such as Durvalumab, also known as MEDI4736, atezolizumab, also known as MPDL3280A, avelumab, also known as MSB00010118C, MDX-1105, BMS-936559, or combinations thereof.
- the immune checkpoint inhibitor is a PDL2 inhibitor such as rHIgM12B7.
- the inhibitor comprises the heavy and light chain CDRs or VRs of nivolumab, pembrolizumab, or pidilizumab. Accordingly, in one aspect, the inhibitor comprises the CDR1, CDR2, and CDR3 domains of the VH region of nivolumab, pembrolizumab, or pidilizumab, and the CDR1, CDR2 and CDR3 domains of the VL region of nivolumab, pembrolizumab, or pidilizumab. In another aspect, the antibody competes for binding with and/or binds to the same epitope on PD-1, PDL1, or PDL2 as the above- mentioned antibodies.
- the antibody has at least about 70, 75, 80, 85, 90, 95, 97, or 99% (or any derivable range therein) variable region amino acid sequence identity with the above-mentioned antibodies.
- CTLA-4 cytotoxic T-lymphocyte-associated protein 4
- CD152 cytotoxic T-lymphocyte-associated protein 4
- the complete cDNA sequence of human CTLA-4 has the Genbank accession number L15006.
- CTLA-4 is found on the surface of T cells and acts as an “off’ switch when bound to B7-1 (CD80) or B7-2 (CD86) on the surface of antigen-presenting cells.
- CTLA4 is a member of the immunoglobulin superfamily that is expressed on the surface of Helper T cells and transmits an inhibitory signal to T cells.
- CTLA4 is similar to the T-cell co- stimulatory protein, CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells.
- CTLA-4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.
- Intracellular CTLA- 4 is also found in regulatory T cells and may be important to their function. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA-4, an inhibitory receptor for B7 molecules.
- Inhibitors of the disclosure may block one or more functions of CTLA-4, B7-1, and/or B7-2 activity. In some aspects, the inhibitor blocks the CTLA-4 and B7-1 interaction. In some aspects, the inhibitor blocks the CTLA-4 and B7-2 interaction.
- the immune checkpoint inhibitor is an anti-CTLA-4 antibody (e.g., a human antibody, a humanized antibody, or a chimeric antibody), an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
- an anti-CTLA-4 antibody e.g., a human antibody, a humanized antibody, or a chimeric antibody
- an antigen binding fragment thereof e.g., an immunoadhesin, a fusion protein, or oligopeptide.
- Anti-human-CTLA-4 antibodies (or VH and/or VL domains derived therefrom) suitable for use in the present methods can be generated using methods well known in the art.
- art recognized anti-CTLA-4 antibodies can be used.
- the anti- CTLA-4 antibodies disclosed in: US 8,119,129, WO 01/14424, WO 98/42752; WO 00/37504 (CP675,206, also known as tremelimumab; formerly ticilimumab), U.S. Patent No. 6,207,156; Hurwitz et ah, 1998; can be used in the methods disclosed herein.
- the teachings of each of the aforementioned publications are hereby incorporated by reference.
- CTLA-4 antibodies that compete with any of these art-recognized antibodies for binding to CTLA-4 also can be used.
- a humanized CTLA-4 antibody is described in International Patent Application No. WO200 1/014424, W02000/037504, and U.S. Patent No. 8,017,114; all incorporated herein by reference.
- a further anti-CTLA-4 antibody useful as a checkpoint inhibitor in the methods and compositions of the disclosure is ipilimumab (also known as 10D1, MDX- 010, MDX- 101, and Yervoy®) or antigen binding fragments and variants thereof (see, e.g., WOO 1/14424).
- the inhibitor comprises the heavy and light chain CDRs or VRs of tremelimumab or ipilimumab.
- the inhibitor comprises the CDR1, CDR2, and CDR3 domains of the VH region of tremelimumab or ipilimumab, and the CDR1, CDR2 and CDR3 domains of the VL region of tremelimumab or ipilimumab.
- the antibody competes for binding with and/or binds to the same epitope on PD-1, B7-1, or B7- 2 as the above- mentioned antibodies.
- the antibody has at least about 70, 75, 80, 85, 90, 95, 97, or 99% (or any derivable range therein) variable region amino acid sequence identity with the above-mentioned antibodies. 2. Inhibition of co-stimulatory molecules
- the immunotherapy comprises an inhibitor of a co-stimulatory molecule.
- the inhibitor comprises an inhibitor of B7- 1 (CD80), B7-2 (CD86), CD28, ICOS, 0X40 (TNFRSF4), 4-1BB (CD137; TNFRSF9), CD40L (CD40LG), GITR (TNFRSF18), and combinations thereof.
- Inhibitors include inhibitory antibodies, polypeptides, compounds, and nucleic acids.
- Dendritic cell therapy provokes anti-tumor responses by causing dendritic cells to present tumor antigens to lymphocytes, which activates them, priming them to kill other cells that present the antigen.
- Dendritic cells are antigen presenting cells (APCs) in the mammalian immune system. In cancer treatment they aid cancer antigen targeting.
- APCs antigen presenting cells
- One example of cellular cancer therapy based on dendritic cells is sipuleucel-T.
- One method of inducing dendritic cells to present tumor antigens is by vaccination with autologous tumor lysates or short peptides (small parts of protein that correspond to the protein antigens on cancer cells). These peptides are often given in combination with adjuvants (highly immunogenic substances) to increase the immune and anti-tumor responses.
- adjuvants include proteins or other chemicals that attract and/or activate dendritic cells, such as granulocyte macrophage colony- stimulating factor (GM-CSF).
- Dendritic cells can also be activated in vivo by making tumor cells express GM- CSF. This can be achieved by either genetically engineering tumor cells to produce GM-CSF or by infecting tumor cells with an oncolytic virus that expresses GM-CSF.
- Another strategy is to remove dendritic cells from the blood of a patient and activate them outside the body.
- the dendritic cells are activated in the presence of tumor antigens, which may be a single tumor- specific peptide/protein or a tumor cell lysate (a solution of broken down tumor cells). These cells (with optional adjuvants) are infused and provoke an immune response.
- Dendritic cell therapies include the use of antibodies that bind to receptors on the surface of dendritic cells. Antigens can be added to the antibody and can induce the dendritic cells to mature and provide immunity to the tumor. Dendritic cell receptors such as TLR3, TLR7, TLR8 or CD40 have been used as antibody targets.
- Chimeric antigen receptors are engineered receptors that combine a new specificity with an immune cell to target cancer cells. Typically, these receptors graft the specificity of a monoclonal antibody onto a T cell. The receptors are called chimeric because they are fused of parts from different sources.
- CAR-T cell therapy refers to a treatment that uses such transformed cells for cancer therapy.
- CAR-T cell design involves recombinant receptors that combine antigen-binding and T-cell activating functions.
- the general premise of CAR-T cells is to artificially generate T-cells targeted to markers found on cancer cells.
- scientists can remove T-cells from a person, genetically alter them, and put them back into the patient for them to attack the cancer cells.
- CAR-T cells create a link between an extracellular ligand recognition domain to an intracellular signaling molecule which in turn activates T cells.
- the extracellular ligand recognition domain is usually a single-chain variable fragment (scFv).
- scFv single-chain variable fragment
- Exemplary CAR-T therapies include Tisagenlecleucel (Kymriah) and Axicabtagene ciloleucel (Yescarta).
- the CAR-T therapy targets CD19.
- Cytokines are proteins produced by many types of cells present within a tumor. They can modulate immune responses. The tumor often employs them to allow it to grow and reduce the immune response. These immune-modulating effects allow them to be used as drugs to provoke an immune response. Two commonly used cytokines are interferons and interleukins. [0167] Interferons are produced by the immune system. They are usually involved in anti viral response, but also have use for cancer. They fall in three groups: type I (IFNa and IFNP), type II (IFNy) and type III (IRNl).
- Interleukins have an array of immune system effects.
- IL-2 is an exemplary interleukin cytokine therapy.
- Adoptive T cell therapy is a form of passive immunization by the transfusion of T- cells (adoptive cell transfer). They are found in blood and tissue and usually activate when they find foreign pathogens. Specifically they activate when the T-cell's surface receptors encounter cells that display parts of foreign proteins on their surface antigens. These can be either infected cells, or antigen presenting cells (APCs). They are found in normal tissue and in tumor tissue, where they are known as tumor infiltrating lymphocytes (TILs). They are activated by the presence of APCs such as dendritic cells that present tumor antigens. Although these cells can attack the tumor, the environment within the tumor is highly immunosuppressive, preventing immune-mediated tumor death.
- APCs antigen presenting cells
- T-cells specific to a tumor antigen can be removed from a tumor sample (TILs) or filtered from blood. Subsequent activation and culturing is performed ex vivo, with the results reinfused. Activation can take place through gene therapy, or by exposing the T cells to tumor antigens.
- TILs tumor sample
- Activation can take place through gene therapy, or by exposing the T cells to tumor antigens.
- the additional therapy comprises a chemotherapy.
- chemotherapeutic agents include (a) Alkylating Agents, such as nitrogen mustards (e.g., mechlorethamine, cylophosphamide, ifosfamide, melphalan, chlorambucil), ethylenimines and methylmelamines (e.g., hexamethylmelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomustine, chlorozoticin, streptozocin) and triazines (e.g., dicarbazine), (b) Antimetabolites, such as folic acid analogs (e.g., methotrexate), pyrimidine analogs (e.g., 5-fluorouracil, floxuridine, cytarabine, azauridine) and purine analogs and related
- Cisplatin has been widely used to treat cancers such as, for example, metastatic testicular or ovarian carcinoma, advanced bladder cancer, head or neck cancer, cervical cancer, lung cancer or other tumors. Cisplatin is not absorbed orally and must therefore be delivered via other routes such as, for example, intravenous, subcutaneous, intratumoral or intraperitoneal injection. Cisplatin can be used alone or in combination with other agents, with efficacious doses used in clinical applications including about 15 mg/m2 to about 20 mg/m2 for 5 days every three weeks for a total of three courses being contemplated in certain aspects.
- the amount of cisplatin delivered to the cell and/or subject in conjunction with the construct comprising an Egr-1 promoter operably linked to a polynucleotide encoding the therapeutic polypeptide is less than the amount that would be delivered when using cisplatin alone.
- chemotherapeutic agents include antimicrotubule agents, e.g., Paclitaxel (“Taxol”) and doxorubicin hydrochloride (“doxorubicin”).
- Paclitaxel e.g., Paclitaxel
- doxorubicin hydrochloride doxorubicin hydrochloride
- Doxorubicin is absorbed poorly and is preferably administered intravenously.
- appropriate intravenous doses for an adult include about 60 mg/m2 to about 75 mg/m2 at about 21 -day intervals or about 25 mg/m2 to about 30 mg/m2 on each of 2 or 3 successive days repeated at about 3 week to about 4 week intervals or about 20 mg/m2 once a week.
- the lowest dose should be used in elderly patients, when there is prior bone-marrow depression caused by prior chemotherapy or neoplastic marrow invasion, or when the drug is combined with other myelopoietic suppressant drugs.
- Nitrogen mustards are another suitable chemotherapeutic agent useful in the methods of the disclosure.
- a nitrogen mustard may include, but is not limited to, mechlorethamine (HN2), cyclophosphamide and/or ifosfamide, melphalan (F-sarcolysin), and chlorambucil.
- Cyclophosphamide (CYTOXAN®) is available from Mead Johnson and NEOSTAR® is available from Adria), is another suitable chemotherapeutic agent.
- Suitable oral doses for adults include, for example, about 1 mg/kg/day to about 5 mg/kg/day
- intravenous doses include, for example, initially about 40 mg/kg to about 50 mg/kg in divided doses over a period of about 2 days to about 5 days or about 10 mg/kg to about 15 mg/kg about every 7 days to about 10 days or about 3 mg/kg to about 5 mg/kg twice a week or about 1.5 mg/kg/day to about 3 mg/kg/day.
- the intravenous route is preferred.
- the drug also sometimes is administered intramuscularly, by infiltration or into body cavities.
- Additional suitable chemotherapeutic agents include pyrimidine analogs, such as cytarabine (cytosine arabinoside), 5-fluorouracil (fluouracil; 5-FU) and floxuridine (fluorode- oxyuridine; FudR).
- 5-FU may be administered to a subject in a dosage of anywhere between about 7.5 to about 1000 mg/m2. Further, 5-FU dosing schedules may be for a variety of time periods, for example up to six weeks, or as determined by one of ordinary skill in the art to which this disclosure pertains.
- Gemcitabine diphosphate (GEMZAR®, Eli Lilly & Co., “gemcitabine”), another suitable chemotherapeutic agent, is recommended for treatment of advanced and metastatic pancreatic cancer, and will therefore be useful in the present disclosure for these cancers as well.
- the amount of the chemotherapeutic agent delivered to the patient may be variable.
- the chemotherapeutic agent may be administered in an amount effective to cause arrest or regression of the cancer in a host, when the chemotherapy is administered with the construct.
- the chemotherapeutic agent may be administered in an amount that is anywhere between 2 to 10,000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent.
- the chemotherapeutic agent may be administered in an amount that is about 20 fold less, about 500 fold less or even about 5000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent.
- chemotherapeutics of the disclosure can be tested in vivo for the desired therapeutic activity in combination with the construct, as well as for determination of effective dosages.
- suitable animal model systems prior to testing in humans, including, but not limited to, rats, mice, chicken, cows, monkeys, rabbits, etc.
- In vitro testing may also be used to determine suitable combinations and dosages, as described in the examples.
- the additional therapy or prior therapy comprises radiation, such as ionizing radiation.
- ionizing radiation means radiation comprising particles or photons that have sufficient energy or can produce sufficient energy via nuclear interactions to produce ionization (gain or loss of electrons).
- An exemplary and preferred ionizing radiation is an x-radiation. Means for delivering x-radiation to a target tissue or cell are well known in the art.
- the additional therapy comprises surgery.
- surgery Approximately 60% of persons with cancer will undergo surgery of some type, which includes preventative, diagnostic or staging, curative, and palliative surgery.
- Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed and may be used in conjunction with other therapies, such as the treatment of the present aspects, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy, and/or alternative therapies.
- Tumor resection refers to physical removal of at least part of a tumor.
- treatment by surgery includes laser surgery, cryosurgery, electro surgery, and microscopically-controlled surgery (Mohs’ surgery).
- a cavity may be formed in the body.
- Treatment may be accomplished by perfusion, direct injection, or local application of the area with an additional anti-cancer therapy. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months (or any range derivable therein). These treatments may be of varying dosages as well.
- polypeptides can be labeled with a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- Such labeled polypeptides can be used for diagnostic techniques, either in vivo, or in an isolated test sample or in methods described herein.
- label intends a directly or indirectly detectable compound or composition that is conjugated directly or indirectly to the composition to be detected, e.g., polynucleotide or protein such as an antibody so as to generate a "labeled" composition.
- the term also includes sequences conjugated to the polynucleotide that will provide a signal upon expression of the inserted sequences, such as green fluorescent protein (GFP) and the like.
- the label may be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition that is detectable.
- the labels can be suitable for small scale detection or more suitable for high-throughput screening.
- suitable labels include, but are not limited to radioisotopes, fluorochromes, chemiluminescent compounds, dyes, and proteins, including enzymes.
- the label may be simply detected or it may be quantified.
- a response that is simply detected generally comprises a response whose existence merely is confirmed, whereas a response that is quantified generally comprises a response having a quantifiable (e.g., numerically reportable) value such as an intensity, polarization, and/or other property.
- the detectable response may be generated directly using a luminophore or fluorophore associated with an assay component actually involved in binding, or indirectly using a luminophore or fluorophore associated with another (e.g., reporter or indicator) component.
- luminescent labels that produce signals include, but are not limited to bioluminescence and chemiluminescence. Detectable luminescence response generally comprises a change in, or an occurrence of, a luminescence signal. Suitable methods and luminophores for luminescently labeling assay components are known in the art and described for example in Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6.sup.th ed.). Examples of luminescent probes include, but are not limited to, aequorin and luciferases.
- fluorescent labels include, but are not limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green, stilbene, Lucifer Yellow, Cascade Blue.TM., and Texas Red.
- suitable optical dyes are described in the Haugland, Richard P. (1996) Handbook of Fluorescent Probes and Research Chemicals (6.sup.th ed.).
- the fluorescent label is functionalized to facilitate covalent attachment to a cellular component present in or on the surface of the cell or tissue such as a cell surface marker.
- Suitable functional groups including, but not are limited to, isothiocyanate groups, amino groups, haloacetyl groups, maleimides, succinimidyl esters, and sulfonyl halides, all of which may be used to attach the fluorescent label to a second molecule.
- the choice of the functional group of the fluorescent label will depend on the site of attachment to either a linker, the agent, the marker, or the second labeling agent.
- Attachment of the fluorescent label may be either directly to the cellular component or compound or alternatively, can by via a linker.
- Suitable binding pairs for use in indirectly linking the fluorescent label to the intermediate include, but are not limited to, antigens/polypeptides, e.g., rhodamine/anti-rhodamine, biotin/avidin and biotin/strepavidin.
- the coupling of polypeptides to low molecular weight haptens can increase the sensitivity of the antibody in an assay. The haptens can then be specifically detected by means of a second reaction.
- haptens such as biotin, which reacts avidin, or dinitrophenol, pyridoxal, and fluorescein, which can react with specific anti-hapten polypeptides. See, Harlow and Lane (1988) supra.
- the conjugated agents can be linked to the polypeptide directly or indirectly, using any of a large number of available methods.
- an agent can be attached at the hinge region of the reduced antibody component via disulfide bond formation, using cross-linkers such as N-succinyl 3-(2-pyridyldithio)proprionate (SPDP), or via a carbohydrate moiety in the Fc region of the antibody (Yu et ah, 1994; Upeslacis et ah, 1995; Price, 1995).
- SPDP N-succinyl 3-(2-pyridyldithio)proprionate
- polypeptides of the disclosure or antigen-binding regions thereof can be linked to another functional molecule such as ligands, cytotoxic molecules, chemotherapeutic agents, or other agents described as additional therapeutics.
- the cells of the disclosure may be specifically formulated and/or they may be cultured in a particular medium.
- the cells may be formulated in such a manner as to be suitable for delivery to a recipient without deleterious effects.
- the medium in certain aspects can be prepared using a medium used for culturing animal cells as their basal medium, such as any of AIM V, X-VIVO-15, NeuroBasal, EGM2, TeSR, BME, BGJb, CMRL 1066, Glasgow MEM, Improved MEM Zinc Option, IMDM, Medium 199, Eagle MEM, aMEM, DMEM, Ham, RPMI-1640, and Fischer's media, as well as any combinations thereof, but the medium may not be particularly limited thereto as far as it can be used for culturing animal cells. Particularly, the medium may be xeno-free or chemically defined.
- a medium used for culturing animal cells as their basal medium, such as any of AIM V, X-VIVO-15, NeuroBasal, EGM2, TeSR, BME, BGJb, CMRL 1066, Glasgow MEM, Improved MEM Zinc Option, IMDM, Medium 199, Eagle MEM, aMEM, DMEM, Ham
- the medium can be a serum-containing or serum-free medium, or xeno-free medium. From the aspect of preventing contamination with heterogeneous animal-derived components, serum can be derived from the same animal as that of the stem cell(s).
- the serum- free medium refers to medium with no unprocessed or unpurified serum and accordingly, can include medium with purified blood-derived components or animal tissue-derived components (such as growth factors).
- the medium may contain or may not contain any alternatives to serum.
- the alternatives to serum can include materials which appropriately contain albumin (such as lipid- rich albumin, bovine albumin, albumin substitutes such as recombinant albumin or a humanized albumin, plant starch, dextrans and protein hydrolysates), transferrin (or other iron transporters), fatty acids, insulin, collagen precursors, trace elements, 2-mercaptoethanol, 3'- thiolgiycerol, or equivalents thereto.
- the alternatives to serum can be prepared by the method disclosed in International Publication No. 98/30679, for example (incorporated herein in its entirety). Alternatively, any commercially available materials can be used for more convenience.
- the commercially available materials include knockout Serum Replacement (KSR), Chemically-defined Lipid concentrated (Gibco), and Glutamax (Gibco).
- the medium may comprise one, two, three, four, five, six, seven, eight, nine, ten, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more of the following: Vitamins such as biotin; DL Alpha Tocopherol Acetate; DL Alpha-Tocopherol; Vitamin A (acetate); proteins such as BSA (bovine serum albumin) or human albumin, fatty acid free Fraction V; Catalase; Human Recombinant Insulin; Human Transferrin; Superoxide Dismutase; Other Components such as Corticosterone; D-Galactose; Ethanolamine HC1; Glutathione (reduced); L-Carnitine HC1; Linoleic Acid; Linolenic Acid; Progesterone; Putrescine 2HC1; Sodium Selenite; and/or T3 (triodo-I-thyronine).
- Vitamins such as biotin; DL Alpha Tocopherol Acetate; DL Alpha-Tocopherol; Vitamin
- the medium further comprises vitamins.
- the medium comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of the following (and any range derivable therein): biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, choline chloride, calcium pantothenate, pantothenic acid, folic acid nicotinamide, pyridoxine, riboflavin, thiamine, inositol, vitamin B12, or the medium includes combinations thereof or salts thereof.
- the medium comprises or consists essentially of biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, choline chloride, calcium pantothenate, pantothenic acid, folic acid nicotinamide, pyridoxine, riboflavin, thiamine, inositol, and vitamin B12.
- the vitamins include or consist essentially of biotin, DL alpha tocopherol acetate, DL alpha-tocopherol, vitamin A, or combinations or salts thereof.
- the medium further comprises proteins.
- the proteins comprise albumin or bovine serum albumin, a fraction of BSA, catalase, insulin, transferrin, superoxide dismutase, or combinations thereof.
- the medium further comprises one or more of the following: corticosterone, D-Galactose, ethanolamine, glutathione, L-camitine, linoleic acid, linolenic acid, progesterone, putrescine, sodium selenite, or triodo-I-thyronine, or combinations thereof.
- the medium comprises one or more of the following: a B-27® supplement, xeno-free B-27® supplement, GS21TM supplement, or combinations thereof.
- the medium comprises or futher comprises amino acids, monosaccharides, inorganic ions.
- the amino acids comprise arginine, cystine, isoleucine, leucine, lysine, methionine, glutamine, phenylalanine, threonine, tryptophan, histidine, tyrosine, or valine, or combinations thereof.
- the inorganic ions comprise sodium, potassium, calcium, magnesium, nitrogen, or phosphorus, or combinations or salts thereof.
- the medium further comprises one or more of the following: molybdenum, vanadium, iron, zinc, selenium, copper, or manganese, or combinations thereof.
- the medium comprises or consists essentially of one or more vitamins discussed herein and/or one or more proteins discussed herein, and/or one or more of the following: corticosterone, D-Galactose, ethanolamine, glutathione, L-carnitine, linoleic acid, linolenic acid, progesterone, putrescine, sodium selenite, or triodo-I- thyronine, a B-27® supplement, xeno-free B-27® supplement, GS21TM supplement, an amino acid (such as arginine, cystine, isoleucine, leucine, lysine, methionine, glutamine, phenylalanine, threonine, tryptophan, histidine, tyrosine, or valine), monosaccharide, inorganic ion (such as sodium, potassium, calcium, magnesium, nitrogen, and/or phosphorus) or salts thereof, and/or molyb
- the medium can also contain one or more externally added fatty acids or lipids, amino acids (such as non-essential amino acids), vitamin(s), growth factors, cytokines, antioxidant substances, 2-mercaptoethanol, pyruvic acid, buffering agents, and/or inorganic salts. . In specific aspects, one or more of these may be explicitly excluded.
- One or more of the medium components may be added at a concentration of at least, at most, or about 0.1, 0.5, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 180, 200, 250 ng/L, ng/ml, pg/ml, mg/ml, or any range derivable therein.
- the cells of the disclosure are specifically formulated. They may or may not be formulated as a cell suspension. In specific cases they are formulated in a single dose form. They may be formulated for systemic or local administration.
- the cells are formulated for storage prior to use, and the cell formulation may comprise one or more cryopreservation agents, such as DMSO (for example, in 5% DMSO).
- the cell formulation may comprise albumin, including human albumin, with a specific formulation comprising 2.5% human albumin.
- the cells may be formulated specifically for intravenous administration; for example, they are formulated for intravenous administration over less than one hour. In particular aspects the cells are in a formulated cell suspension that is stable at room temperature for 1, 2, 3, or 4 hours or more from time of thawing.
- the cells of the disclosure comprise an exogenous TCR, which may be of a defined antigen specificity.
- the TCR can be selected based on absent or reduced alloreactivity to the intended recipient (examples include certain virus- specific TCRs, xeno-specific TCRs, or cancer-testis antigen- specific TCRs).
- the exogenous TCR is non-alloreactive, during T cell differentiation the exogenous TCR suppresses rearrangement and/or expression of endogenous TCR loci through a developmental process called allelic exclusion, resulting in T cells that express only the non-alloreactive exogenous TCR and are thus non-alloreactive.
- the choice of exogenous TCR may not necessarily be defined based on lack of alloreactivity.
- the endogenous TCR genes have been modified by genome editing so that they do not express a protein. Methods of gene editing such as methods using the CRISPR/Cas9 system are known in the art and described herein.
- the cells of the disclosure further comprise one or more chimeric antigen receptors (CARs).
- CARs chimeric antigen receptors
- tumor cell antigens to which a CAR may be directed include at least 5T4, 8H9, anb ⁇ integrin, BCMA, B7-H3, B7-H6, CAIX, CA9, CD19, CD20, CD22, CD30, CD33, CD38, CD44, CD44v6, CD44v7/8, CD70, CD123, CD138, CD171, CEA, CSPG4, EGFR, EGFR family including ErbB2 (HER2), EGFRvIII, EGP2, EGP40, ERBB3, ERBB4, ErbB3/4, EPCAM, EphA2, EpCAM, folate receptor-a, FAP, FBP, fetal AchR, FRcc, GD2, G250/CAIX, GD3, Glypican-3 (GPC3), Her2, IL-13Rcc2, Lambda, Lewis- Y,
- the CAR may be a first, second, third, or more generation CAR.
- the CAR may be bispecific for any two nonidentical antigens, or it may be specific for more than two nonidentical antigens.
- the therapy provided herein may comprise administration of a combination of therapeutic agents, such as a first cancer therapy and a second cancer therapy.
- the therapies may be administered in any suitable manner known in the art.
- the first and second cancer treatment may be administered sequentially (at different times) or concurrently (at the same time).
- the first and second cancer treatments are administered in a separate composition.
- the first and second cancer treatments are in the same composition.
- Aspects of the disclosure relate to compositions and methods comprising therapeutic compositions.
- the different therapies may be administered in one composition or in more than one composition, such as 2 compositions, 3 compositions, or 4 compositions. Various combinations of the agents may be employed.
- the therapeutic compositions of the disclosure may be administered by the same route of administration or by different routes of administration.
- the cancer therapy is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
- the antibiotic is administered intravenously, intramuscularly, subcutaneously, topically, orally, transdermally, intraperitoneally, intraorbitally, by implantation, by inhalation, intrathecally, intraventricularly, or intranasally.
- the appropriate dosage may be determined based on the type of disease to be treated, severity and course of the disease, the clinical condition of the individual, the individual's clinical history and response to the treatment, and the discretion of the attending physician.
- the treatments may include various “unit doses.”
- Unit dose is defined as containing a predetermined-quantity of the therapeutic composition.
- the quantity to be administered, and the particular route and formulation, is within the skill of determination of those in the clinical arts.
- a unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time.
- a unit dose comprises a single administrable dose.
- Precise amounts of the therapeutic composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the patient, the route of administration, the intended goal of treatment (alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance or other therapies a subject may be undergoing.
- the cancers amenable for treatment include, but are not limited to, tumors of all types, locations, sizes, and characteristics.
- the cancer comprises a solid tumor.
- the methods relate to reducing tumor volume or treating cancers that are recurrent and/or metastatic.
- compositions of the disclosure are suitable for treating, for example, pancreatic cancer, colon cancer, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytoma, childhood cerebellar or cerebral basal cell carcinoma, bile duct cancer, extrahepatic bladder cancer, bone cancer, osteosarcoma/malignant fibrous histiocytoma, brainstem glioma, brain tumor, cerebellar astrocytoma brain tumor, cerebral astrocytoma/malignant glioma brain tumor, ependymoma brain tumor, medulloblastoma brain tumor, supratentorial primitive neuroectodermal tumors brain tumor, visual pathway and hypothalamic glioma, breast cancer, lymphoid cancer, bronchial adenomas/carcinoids, tracheal cancer, lung cancer, Burkitt lymphoma, car
- kits containing compositions of the disclosure or compositions to implement methods of the invention.
- kits can be used to evaluate one or more biomarkers or HLA types.
- a kit contains, contains at least or contains at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43,
- Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.
- kits Individual components may also be provided in a kit in concentrated amounts; in some aspects, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as lx, 2x, 5x, lOx, or 20x or more.
- negative and/or positive control nucleic acids, probes, and inhibitors are included in some kit aspects.
- a kit may include a sample that is a negative or positive control for methylation of one or more biomarkers.
- Example 1 FANCI-16 HLA-A0201 peptide (KLQEFLQTL - SEQ ID NO:43) CTL generation
- FANCI-16 (KLQEFLQTL - SEQ ID NO:43) peptide was pulsed to mature dendritic cells and then co-cultured with autologous PBMC from a HLA-A0201 positive healthy donor. After two rounds of stimulation, part of the T cells from the each well were collected for tetramer detection. Then, the tetramer+/CD8+ population were sorted and expanded with rapid expansion protocol (REP). After REP for two weeks, high purity CTL (tetramer+ population over 90%) were observed (FIG. 1).
- the FANCI-16 peptide specific CTL cell lines were functionally validated. As shown in FIG. 2A, T2 cells were pulsed with various concentrations of FANCI-16 peptide and were used as targets. The lysis ability of FANCI-16 CTL cell line D4 was detected with Cr51 release assay (CRA). The effector to target (E:T) ratio was 20: 1. The lysis ability of the FANCI- 16 CTLs was tested with target cells: glioblastoma cell lines: T98G (FIG. 2B), LN-18 (FIG. 2C), and M095K (FIG. 2D); and pancreatic cancer cell lines PANC-1 (FIG. 2E), Panc02.13 (FIG. 2F), Panc03.27 (FIG. 2G) and CFPAC-1 (FIG. 2H).
- RAD51-254 (RLADEFGVAV - SEQ ID NO:44) peptide was pulsed to mature dendritic cells and then co-cultured with autologous PBMC from a HLA-A0201 positive healthy donor. After two rounds of stimulation, a portion of the T cells from the each well were collected for tetramer detection. Then, the tetramer+/CD8+ population were sorted and expanded with rapid expansion protocol (REP). After REP for two weeks, high purity CTL (tetramer+ population over 90%) were observed. (FIG. 3).
- the RAD51-254 peptide specific CTL cell lines were functionally validated. As shown in FIG. 4A, T2 cells were pulsed with various concentrations of RAD51-254 peptide and were used as targets. The lysis ability of RAD51-254 CTL cell lines was detected with Cr51 release assay (CRA). The effector to target (E:T) ratio was 20:1. The lysis ability of the RAD51-254 CTLs was tested with target cells: glioblastoma cell lines: LN-18 (FIG. 4B) and T98G (FIG. 4C), and pancreatic cancer cell line: PANC-1 (FIG. 4D); (all are RAD51+, HLA- A0201+). Melanoma cell line A375 (RAD51-, HLA-A0201+) was used as control cell line. (FIG. 4E).
- PBK-289 SYQKVIELF - SEQ ID NO:45
- peptide was pulsed to mature dendritic cells and then co-cultured with autologous PBMC from a HLA-A2402 positive healthy donor. After two rounds of stimulation, a portion of the T cells from the each well were collected for tetramer detection. Then, the tetramer+/CD8+ population were sorted and expanded with rapid expansion protocol (REP). After REP for two weeks, high purity CTL (tetramer+ population over 90%) were observed. (FIG. 5).
- the PBK-289 peptide specific CTL cell lines were functionally validated. As shown in FIG. 6A, T2-A24 cells were pulsed with various concentrations of PBK-289 peptide and were used as targets. The lysis ability of PBK-289 CTL cell lines was detected with Cr51 release assay (CRA). The effector to target (E:T) ratio was 20:1. The lysis ability of the PBK- 289 CTLs was tested with target cells: glioblastoma cell lines: LN-18 (FIG. 6B) and U-l 18MG (FIG. 6C), and pancreatic cancer cell lines: Panc03.27 (FIG. 6D) and MIA PaCa-2 (FIG.
- target cells glioblastoma cell lines: LN-18 (FIG. 6B) and U-l 18MG (FIG. 6C)
- pancreatic cancer cell lines Panc03.27 (FIG. 6D) and MIA PaCa-2 (FIG.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Hematology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/580,486 US20250073333A1 (en) | 2021-07-19 | 2022-07-18 | Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use |
| CN202280056678.4A CN117957012A (zh) | 2021-07-19 | 2022-07-18 | 靶向fanci、rad51和pbk抗原的肽和经改造t细胞受体及使用方法 |
| MX2024000941A MX2024000941A (es) | 2021-07-19 | 2022-07-18 | Péptidos y receptores manipulados de linfocitos t dirigidos a antígenos fanci, rad51 y pbk y métodos de uso. |
| CA3226965A CA3226965A1 (en) | 2021-07-19 | 2022-07-18 | Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use |
| JP2024503352A JP2024526836A (ja) | 2021-07-19 | 2022-07-18 | Fanci、rad51、およびpbk抗原を標的とするペプチドおよび操作されたt細胞受容体ならびに使用の方法 |
| EP22846774.2A EP4373516A4 (en) | 2021-07-19 | 2022-07-18 | MODIFIED T CELL PEPTIDES AND RECEPTORS TARGETING FANCI, RAD51, AND PBK ANTIGENS AND METHODS OF USE |
| IL310204A IL310204A (en) | 2021-07-19 | 2022-07-18 | Peptides and engineered T cell receptors targeting FANCI, RAD51 and PBK antigens and methods of use |
| AU2022314048A AU2022314048A1 (en) | 2021-07-19 | 2022-07-18 | Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use |
| KR1020247005490A KR20240046834A (ko) | 2021-07-19 | 2022-07-18 | Fanci, rad51, 및 pbk 항원을 표적화하는 펩타이드 및 가공된 t 세포 수용체 및 이의 사용 방법 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163223450P | 2021-07-19 | 2021-07-19 | |
| US63/223,450 | 2021-07-19 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023004289A1 true WO2023004289A1 (en) | 2023-01-26 |
Family
ID=84979747
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/073850 Ceased WO2023004289A1 (en) | 2021-07-19 | 2022-07-18 | Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20250073333A1 (https=) |
| EP (1) | EP4373516A4 (https=) |
| JP (1) | JP2024526836A (https=) |
| KR (1) | KR20240046834A (https=) |
| CN (1) | CN117957012A (https=) |
| AU (1) | AU2022314048A1 (https=) |
| CA (1) | CA3226965A1 (https=) |
| IL (1) | IL310204A (https=) |
| MX (1) | MX2024000941A (https=) |
| WO (1) | WO2023004289A1 (https=) |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130280258A1 (en) * | 2007-03-12 | 2013-10-24 | Miltenyi Biotec Gmbh | Prognostic, diagnostic, and cancer therapeutic uses of fanci and fanci modulating agents |
| US20190055298A1 (en) * | 2013-11-22 | 2019-02-21 | The Board Of Trustees Of The University Of Illinois | Engineered high-affinity human t cell receptors |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102127211B1 (ko) * | 2011-10-28 | 2020-06-29 | 온코세라피 사이언스 가부시키가이샤 | Topk 펩티드 및 이를 포함하는 백신 |
| US10130693B2 (en) * | 2015-08-28 | 2018-11-20 | Immatics Biotechnologies Gmbh | Peptides, combination of peptides and scaffolds for use in immunotherapeutic treatment of various cancers |
| GB201515321D0 (en) * | 2015-08-28 | 2015-10-14 | Immatics Biotechnologies Gmbh | Novel peptides, combination of peptides and scaffolds for use in immunotherapeutic treatment of various cancers |
| GB201522592D0 (en) * | 2015-12-22 | 2016-02-03 | Immunocore Ltd | T cell receptors |
| US20200308279A1 (en) * | 2017-10-06 | 2020-10-01 | Oslo Universitetssykehus Hf | Chimeric antigen receptors |
| WO2019196088A1 (en) * | 2018-04-13 | 2019-10-17 | Syz Cell Therapy Co. | Methods of obtaining tumor-specific t cell receptors |
| US20240024438A1 (en) * | 2020-11-19 | 2024-01-25 | Board Of Regents, The University Of Texas System | Methods and compositions comprising mhc class peptides |
-
2022
- 2022-07-18 CN CN202280056678.4A patent/CN117957012A/zh active Pending
- 2022-07-18 US US18/580,486 patent/US20250073333A1/en active Pending
- 2022-07-18 KR KR1020247005490A patent/KR20240046834A/ko active Pending
- 2022-07-18 AU AU2022314048A patent/AU2022314048A1/en active Pending
- 2022-07-18 MX MX2024000941A patent/MX2024000941A/es unknown
- 2022-07-18 CA CA3226965A patent/CA3226965A1/en active Pending
- 2022-07-18 WO PCT/US2022/073850 patent/WO2023004289A1/en not_active Ceased
- 2022-07-18 JP JP2024503352A patent/JP2024526836A/ja active Pending
- 2022-07-18 EP EP22846774.2A patent/EP4373516A4/en not_active Withdrawn
- 2022-07-18 IL IL310204A patent/IL310204A/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130280258A1 (en) * | 2007-03-12 | 2013-10-24 | Miltenyi Biotec Gmbh | Prognostic, diagnostic, and cancer therapeutic uses of fanci and fanci modulating agents |
| US20190055298A1 (en) * | 2013-11-22 | 2019-02-21 | The Board Of Trustees Of The University Of Illinois | Engineered high-affinity human t cell receptors |
Non-Patent Citations (2)
| Title |
|---|
| DATABASE UNIPROTKB ANONYMOUS : "A0A2T0W0B7 · A0A2T0W0B7_9RHOB", XP093028274, retrieved from UNIPROT * |
| See also references of EP4373516A4 * |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4373516A1 (en) | 2024-05-29 |
| KR20240046834A (ko) | 2024-04-09 |
| US20250073333A1 (en) | 2025-03-06 |
| MX2024000941A (es) | 2024-04-18 |
| IL310204A (en) | 2024-03-01 |
| JP2024526836A (ja) | 2024-07-19 |
| EP4373516A4 (en) | 2025-10-01 |
| AU2022314048A1 (en) | 2024-02-22 |
| CA3226965A1 (en) | 2023-01-26 |
| CN117957012A (zh) | 2024-04-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230190812A1 (en) | Engineered t cell receptors and methods of use | |
| US20240009241A1 (en) | Engineered t cell receptors targeting egfr antigens and methods of use | |
| WO2023076875A1 (en) | Methods and compositions for treating glioblastoma | |
| WO2024123975A2 (en) | A t cell receptor recognizing an unmutated foxm1 epitope presented on hla-a*02:01 | |
| US20230227526A1 (en) | Engineered t cell receptors and methods of use | |
| US20230143031A1 (en) | Engineered t cell receptors and methods of use | |
| US20250073333A1 (en) | Peptides and engineered t cell receptors targeting fanci, rad51, and pbk antigens and methods of use | |
| US20260007698A1 (en) | Peptides and engineered t cell receptors targeting vcy antigen and methods of use | |
| US20250289866A1 (en) | Peptides and engineered t cell receptors targeting ndc80 antigen and methods of use | |
| WO2025096983A1 (en) | Peptides and engineered t cell receptors targeting tpx2 antigen and methods of use | |
| WO2025101705A1 (en) | Peptides and engineered t cell receptors targeting a melanoma antigen preferentially expressed in tumors antigen and methods of use | |
| EP4422651A2 (en) | Peptides and engineered t cell receptors targeting mage-a4 antigen and methods of use | |
| WO2024243227A2 (en) | Peptides and engineered t cell receptors targeting brachyury antigen and methods of use | |
| WO2026019786A1 (en) | Peptides and engineered t cell receptors targeting brachyury antigen and methods of use | |
| US20240009240A1 (en) | Engineered t cell receptors targeting egfr antigens and methods of use | |
| WO2024123794A2 (en) | A t cell receptor recognizing a her2 mutation presented on hla-a*02:01 and methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22846774 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 310204 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2024503352 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2024/000941 Country of ref document: MX Ref document number: 3226965 Country of ref document: CA Ref document number: P6000136/2024 Country of ref document: AE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024001204 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 807949 Country of ref document: NZ Ref document number: AU2022314048 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417009720 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 20247005490 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280056678.4 Country of ref document: CN Ref document number: 2022846774 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022314048 Country of ref document: AU Date of ref document: 20220718 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022846774 Country of ref document: EP Effective date: 20240219 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202400362R Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 112024001204 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240119 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18580486 Country of ref document: US |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2022846774 Country of ref document: EP |