WO2022271867A1 - A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders - Google Patents

A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders Download PDF

Info

Publication number
WO2022271867A1
WO2022271867A1 PCT/US2022/034588 US2022034588W WO2022271867A1 WO 2022271867 A1 WO2022271867 A1 WO 2022271867A1 US 2022034588 W US2022034588 W US 2022034588W WO 2022271867 A1 WO2022271867 A1 WO 2022271867A1
Authority
WO
WIPO (PCT)
Prior art keywords
myostatin
glp
inhibitor
subject
pathway
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/034588
Other languages
English (en)
French (fr)
Inventor
Kimberly LONG
Yung CHYUNG
George NOMIKOS
Jeffrey S. Flier
Micah T. WEBSTER
Christopher CHAPRON
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Scholar Rock Inc
Original Assignee
Scholar Rock Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=82608742&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2022271867(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DK22744054.2T priority Critical patent/DK4358995T3/da
Priority to FIEP22744054.2T priority patent/FI4358995T3/fi
Priority to MX2023014840A priority patent/MX2023014840A/es
Priority to EP22744054.2A priority patent/EP4358995B1/en
Priority to EP25220159.5A priority patent/EP4714494A3/en
Priority to CA3221555A priority patent/CA3221555A1/en
Priority to PL22744054.2T priority patent/PL4358995T3/pl
Application filed by Scholar Rock Inc filed Critical Scholar Rock Inc
Priority to SI202230232T priority patent/SI4358995T1/sl
Priority to US18/572,397 priority patent/US20240368262A1/en
Priority to AU2022299185A priority patent/AU2022299185A1/en
Priority to IL309078A priority patent/IL309078A/en
Priority to JP2023578073A priority patent/JP2024524159A/ja
Priority to ES22744054T priority patent/ES3062188T3/es
Publication of WO2022271867A1 publication Critical patent/WO2022271867A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/06Anabolic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the instant application relates to use of myostatin pathway inhibitors and GLP-1 pathway activators for treating and maintaining metabolic disorders, including obesity, metabolic syndrome, and type 2 diabetes mellitus.
  • obesity is a chronic condition that affects more than one in three adults and about 17 percent of children and adolescents in the United States alone. More than one in three adults is overweight. Being overweight or obese increases the risk of type 2 diabetes, heart disease, stroke, fatty liver disease, kidney disease, and other health issues.
  • Weight loss efforts often face challenges. For example, extreme dieting such as ultra-low caloric restriction, is impractical, if not unfeasible, for most patients. For example, when a person with obesity syndrome goes on a diet, 10% weight loss can result in about 20-30% decrease in overall energy expenditure, accompanied by reduced basal metabolic rate, reduced leptin concentrations, and reduced lean mass. It is well known that weight loss from dietary/caloric restriction causes not only adipose (fat) tissue mass reduction, but also results in loss of skeletal muscle mass. Coupled with the body’s natural propensity towards maintaining homeostasis by adapting to lower energy supply, reduced skeletal muscle causes a decrease in metabolic rate, lowering energy expenditure. In fact, a 10% loss in overall weight results in a 30-40% reduction in energy expanded during physical activity above resting energy expenditure.
  • weight loss medications have been approved by regulatory authorities (e.g., FDA) to treat overweight and obesity (see, e.g., Williams. Diabetes Ther (2020) 11 :1199-1216). These include orlistat (XENICAL®, ALLI®), phentermine and topiramate (QSYMIA®), naltrexone, HCI/bupropion, HCI (CONTRAVE®), liraglutide (SAXENDA), semaglutide (WEGOVY®, OZEMPIC®, RYBELSUS®), dulaglutide (TRULICITY®), and setmelanotide (IMCIVREE®).
  • FDA weight loss medications
  • Myostatin also known as growth differentiation factor 8 or GDF-8, is a member of the transforming growth factor-b (TGF-b) superfamily.
  • TGF-b transforming growth factor-b
  • Myostatin is a negative regulator of skeletal muscle growth, although there have been suggestions that Activin A may play a more prominent role in regulating muscle mass than myostatin in primates (Latres et al. , 2017, Nature Communications, 8:15153).
  • Garito et al. Diabetes Obes Metab. 2018 Jan; 20(1):94- 102. Epub 2017
  • Heymsfield et al. JAMA Network Open.
  • bimagrumab an antibody that binds Activin Receptor type MB, thereby interfering with ligand binding, showed clinically beneficial effects in improving weight, reducing adiposity and preserving lean mass. Because multiple ligands (including Activins, myostatin, GDF11 and others) signal through this receptor, bimagrumab presumably inhibits activities of all of these growth factors, raising safety concerns. Indeed, clinical studies revealed increased serious adverse events in bimagrumab-treated patients over placebo.
  • the present disclosure provides novel therapy to improve metabolic conditions, in which an inhibitor of the myostatin signaling pathway and an insulin secretion-promoting agent (e.g., an activator of the glucagon-like peptide-1 (GLP-1) signaling pathway in particular) are used in conjunction for the treatment of obesity/overweight or weight management in a subject.
  • an inhibitor of the myostatin signaling pathway and an insulin secretion-promoting agent e.g., an activator of the glucagon-like peptide-1 (GLP-1) signaling pathway in particular
  • GLP-1 glucagon-like peptide-1
  • weight management encompasses not only overall weight loss, but improvements to body composition, e.g., enhanced lean mass (muscle) relative to fat mass (adipose).
  • Combination therapies, as well as add-on/adjunct therapies are contemplated herein.
  • a myostatin inhibitor when used in conjunction with a GLP-1 receptor agonist (e.g., GLP-1 analogs), can enhance overall weight loss.
  • the weight loss is achieved while substantially maintaining or enhancing lean mass (e.g., muscle) in a diet-induced obese rodent model, demonstrating preferential metabolism of adipose tissue over muscle tissue, leading to improved body composition (e.g., increased lean mass-to-fat mass ratios).
  • lean mass e.g., muscle
  • body composition e.g., increased lean mass-to-fat mass ratios.
  • these synergistic effects are attributable to myostatin inhibition alone, due to the selectivity of the myostatin inhibitor used, without contribution from other structurally related growth factors such as GDF11 and Activins, which signal through the same receptors.
  • GLP-1 pathway activators when used in conjunction with myostatin pathway inhibitors, can enhance overall weight loss, alter body composition by increasing the muscle to fat ratio, and/or otherwise improve treatments for the obese or overweight patient.
  • the current disclosure examines the effect of treatment with a myostatin inhibitor on the metabolic changes associated with weight loss in obese or overweight subjects. It is contemplated that treatment with a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) may reverse metabolic changes associated with weight loss and help maintain weight loss in obese or overweight subjects, e.g., after changes to diet and/or exercise regimen alone or in combination with other therapeutic interventions.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the present disclosure provides an inhibitor of the myostatin signaling pathway (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for use in the treatment of obesity or overweight in a subject as a monotherapy.
  • the myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the subject has received or is treated with an activator of the GLP-1 signaling pathway.
  • the myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the present disclosure encompasses use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for treating a subject with obesity.
  • the myostatin signaling pathway inhibitor is a myostatin-selective inhibitor, such as apitegromab, GYM-329, trevogrumab, or an MST1032 variant as described in PCT/JP2015/006323.
  • myostatin-selective inhibitor may provide a safer therapeutic option (e.g., reduced toxicity, an improved safety profile, reduced side effects, and/or improved patient tolerance) as compared to non- selective myostatin inhibitors (e.g., myostatin inhibitors that also inhibit GDF11 and/or Activin A).
  • myostatin-selective inhibitor may provide superior therapeutic efficacy as compared to non- selective myostatin inhibitors (e.g., myostatin inhibitors that also inhibit GDF11 and/or Activin A) (Muramatsu et al. Sci Rep. 2021 Jan 25;11 (1):2160).
  • non- selective myostatin inhibitors e.g., myostatin inhibitors that also inhibit GDF11 and/or Activin A
  • the myostatin signaling pathway inhibitor is administered intravenously or subcutaneously.
  • the subject has obesity with type 2 diabetes.
  • the present disclosure encompasses use of apitegromab for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes.
  • the present disclosure encompasses the use of apitegromab in conjunction with a GLP-1 pathway activator for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes.
  • the present disclosure encompasses the use of GYM-329 for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes.
  • the present disclosure encompasses the use of GYM-329 in conjunction with a GLP-1 pathway activator for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes. In some embodiments, the present disclosure encompasses use of a MST1032 variant for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes. In some embodiments, the present disclosure encompasses use of a MST1032 variant in conjunction with a GLP-1 pathway activator for treating a subject with obesity, wherein the subject optionally has obesity with type 2 diabetes.
  • the subject being given the inhibitor of the myostatin signaling pathway previously received a GLP-1 pathway activator (such as a GLP-1 analog) but failed to achieve weight loss of at least 5% of baseline body weight after 24 weeks of treatment comprising the GLP-1 pathway activator and/or was unable to tolerate a therapeutic dose of the GLP-1 pathway activator.
  • the subject received a GLP-1 pathway activator (such as a GLP-1 analog) but failed to achieve weight loss of at least 10% of baseline body weight after 24 weeks of treatment comprising the GLP-1 pathway activator.
  • the “baseline body weight” refers to the subject’s body weight measured just prior to or at the time of the initiation of the treatment (e.g., before a 24- week treatment), against which changes in body weight in response to the treatment are assessed.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor used in conjunction with a GLP-1 pathway activator.
  • myostatin pathway inhibitor in conjunction, either as a combination therapy or an adjunct therapy.
  • the expression “patients who respond poorly to a GLP-1 activation therapy” refers to those who fail to meet an intended weight management goal following the treatment that includes a GLP-1 pathway activator (such as 3 months, 6 months, 9 months and 12 months treatment), such as at least 5% or at least 10% body weight loss or who are unable to tolerate the treatment regimen required to attain an intended weight management goal.
  • the myostatin pathway inhibitor is a myostatin-selective inhibitor such as an antibody or antigen-binding fragment that selectively binds to myostatin, e.g., apitegromab, GYM329 (also known as RO7204239), trevogrumab, or any variants thereof.
  • the myostatin pathway inhibitor is a MST1032 variant as disclosed in PCT/JP2015/006323.
  • the GLP-1 pathway activator is a GLP-1 analog such as semaglutide, exenatide ER, liraglutide, lixisenatide, tirzepatide, dulaglutide, XW003, noisyiglutide, MEDI0382, and albiglutide.
  • the GLP-1 pathway activator is an agent that affects the GLP-1 pathway among other activities, e.g., an agent such as metformin.
  • the treatment comprising the GLP-1 pathway activator further includes a caloric restriction regimen (e.g., reduced calorie diet) and/or an exercise regimen (e.g., increased physical activity) as part of the treatment.
  • a caloric restriction regimen e.g., reduced calorie diet
  • an exercise regimen e.g., increased physical activity
  • the subject who has received or is on the GLP-1 pathway activator treatment is unable to perform or adhere to the caloric restriction regimen and/or the exercise regimen as part of the GLP-1 pathway activator treatment.
  • the myostatin pathway inhibitor used in conjunction, may enhance the effect of the GLP-1 pathway activator even in the absence of or incomplete adherence to the caloric restriction regimen and/or the exercise regimen.
  • the myostatin pathway inhibitor is a myostatin- selective inhibitor such as an antibody or antigen-binding fragment that selectively binds to myostatin, e.g., apitegromab, GYM329, trevogrumab, MST1032, or any variants thereof.
  • the GLP-1 pathway activator is a GLP-1 analog such as semaglutide, exenatide ER, liraglutide, tirzepatide, lixisenatide, dulaglutide, XW003, noisyiglutide, MEDI0382, and albiglutide.
  • the GLP-1 pathway activator is a small molecule GLP-1 receptor agonist.
  • the GLP-1 pathway activator is a long-acting small molecule GLP-1 receptor agonist.
  • the present disclosure also provides an activator of the GLP-1 signaling pathway for use in the treatment of obesity or overweight in a subject as an adjunct therapy, wherein the subject is treated with an inhibitor of the myostatin signaling pathway.
  • the present disclosure further provides an inhibitor of the myostatin signaling pathway and an activator of the GLP-1 signaling pathway as a combination therapy for use in the treatment of obesity or overweight in the subject.
  • the present disclosure also provides an inhibitor of the myostatin signaling pathway in conjunction with an activator of the GLP-1 signaling pathway for use in the treatment of obesity or overweight in the subject.
  • the myostatin signaling inhibitor and the GLP-1 signaling activator can be formulated in a single pharmaceutical composition or can be formulated in separate pharmaceutical compositions and are used in amounts sufficient to treat obesity or overweight as weight management.
  • use of inhibitors of the myostatin signaling pathway and activators of the GLP-1 signaling pathway may be optionally coupled with calorie restriction (e.g., diet) and/or moderate exercise to further enhance the effects.
  • calorie restriction e.g., diet
  • the calorie restriction and/or the physical activity requirements for the approved GLP-1 agonists (such as semaglutide) for the treatment of obesity or overweight may be replaced with a myostatin pathway inhibitor (e.g., a myostatin inhibitor), used in conjunction with the approved GLP-1 agonists.
  • the degree (amount) of the calorie restriction and physical activity requirements for the approved GLP-1 agonists may be reduced with the use of a myostatin pathway inhibitor, such that less stringent caloric restriction and/or less stringent physical activity may be required to achieve equivalent weight loss benefits.
  • overall weight loss is achieved with the use of an inhibitor of the myostatin signaling pathway (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and an activator of the GLP-1 signaling pathway, while lean mass is increased during the same duration of use.
  • an inhibitor of the myostatin signaling pathway e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • an activator of the GLP-1 signaling pathway e.g., lean mass is increased during the same duration of use.
  • lean mass e.g., % change in lean mass
  • suitable techniques such as ultrasound, quantitative nuclear magnetic resonance (qNMR), dual-energy X-ray absorptiometry (DXA), magnetic resonance imaging (MRI)- derived hepatic fat fraction, hydrodensitometry, air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), bioimpedance spectroscopy (BIS), electrical impedance myography (EIM), 3D body scanners, and multi-compartment models (e.g., 3-compartment and 4-compartment models).
  • the myostatin pathway inhibitor may be used in conjunction with the GLP-1 pathway activators to prevent muscle loss while achieving overall weight loss.
  • the use of an inhibitor of the myostatin signaling pathway e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • an activator of the GLP-1 signaling pathway can reduce or slow fat mass gain, as compared to the latter alone.
  • the use of an inhibitor of the myostatin signaling pathway e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • fat mass e.g., % change in fat mass
  • suitable techniques such as ultrasound, quantitative nuclear magnetic resonance (qNMR), dualenergy X-ray absorptiometry (DXA), magnetic resonance imaging (MRI)-derived hepatic fat fraction, hydrodensitometry, air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), bioimpedance spectroscopy (BIS), electrical impedance myography (EIM), 3D body scanners, and multicompartment models (e.g., 3-compartment and 4-compartment models).
  • qNMR quantitative nuclear magnetic resonance
  • DXA dualenergy X-ray absorptiometry
  • MRI magnetic resonance imaging
  • hydrodensitometry hydrodensitometry
  • ADP air displacement plethysmography
  • BIOA bioelectrical impedance analysis
  • BIOS bioimpedance spectroscopy
  • EIM electrical impedance myography
  • 3D body scanners and multicompart
  • the current disclosure encompasses the use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for maintaining weight loss in an obese or overweight subject.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the myostatin inhibition can lead to a reversal of certain metabolic changes associated with weight loss in a subject that otherwise favor weight regain.
  • Such metabolic changes include but are not limited to decreased energy expenditure, decreased lean muscle mass, decreased mechanical efficiency of skeletal muscles, decreased insulin sensitivity, decreased circulating leptin levels, and/or decreased circulating adiponectin levels relative to the level(s) seen in the subject prior to treatment, i.e. , in the absence of a myostatin inhibitor.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin- selective inhibitor
  • metabolic changes include but are not limited to decreased energy expenditure, decreased lean muscle mass, decreased mechanical efficiency of skeletal muscles, decreased insulin sensitivity, decreased circulating leptin levels, and/or decreased circulating adiponectin levels relative to the level(s) seen in the subject prior to treatment, i.e. , in the absence of a myostatin inhibitor.
  • the current disclosure encompasses the use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor,
  • the effects of such a use may include increasing energy expenditure, increasing lean muscle mass, increasing overall skeletal muscle function, increasing insulin sensitivity, increasing circulating leptin levels, and/or increasing circulating adiponectin levels as compared to baseline, i.e., in the absence of a myostatin inhibitor.
  • the current disclosure encompasses use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for maintaining weight loss in an obese or overweight subject.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the myostatin signaling pathway inhibitor is a myostatin-selective inhibitor, such as an antibody or antigen-binding fragment that selectively binds to myostatin, e.g., apitegromab, GYM-329, travogrumab, or a MST1032 variant.
  • the myostatin signaling pathway inhibitor is administered intravenously or subcutaneously.
  • the subject has previously received at least one dose of a GLP-1 pathway activator.
  • the subject is receiving a GLP-1 pathway activator.
  • the myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin- selective inhibitor
  • the myostatin signaling pathway inhibitor is used in conjunction with a GLP-1 pathway activator.
  • the current disclosure encompasses the use of apitegromab for maintaining weight loss in an obese or overweight subject, wherein the obese or overweight subject optionally has type 2 diabetes.
  • the apitegromab is administered in conjunction with or complementary to a GLP-1 pathway activator.
  • the current disclosure encompasses the use of GYM-329 for maintaining weight loss in an obese or overweight subject, wherein the obese or overweight subject optionally has type 2 diabetes.
  • the GYM-329 is administered in conjunction with or complementary to a GLP-1 pathway activator.
  • the current disclosure encompasses the use of trevogrumab for maintaining weight loss in an obese or overweight subject, wherein the obese or overweight subject optionally has type 2 diabetes.
  • the trevogrumab is administered in conjunction with a GLP-1 pathway activator.
  • the current disclosure encompasses the use of a MST1032 variant for maintaining weight loss in an obese or overweight subject, wherein the obese or overweight subject optionally has type 2 diabetes.
  • the MST1032 variant is administered in conjunction with a GLP-1 pathway activator.
  • the current disclosure encompasses the use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for treating certain metabolic phenotypes in a leptin deficient subject.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • Such a subject may exhibit a metabolic phenotype that includes but is not limited to, low energy expenditure, low lean muscle mass, low mechanical efficiency of skeletal muscles, low insulin sensitivity, low circulating le
  • the current disclosure encompasses the use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for reversing metabolic changes associated with leptin deficiency in a subject.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the effects of such a use may include increasing energy expenditure, increasing lean muscle mass, increasing overall skeletal muscle function, increasing insulin sensitivity, and/or increasing circulating adiponectin levels as compared to baseline.
  • the leptin deficient subject is obese or overweight.
  • the current disclosure encompasses use of a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) for weight loss in the obese or overweight subject who is leptin deficient.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the use of the myostatin signaling pathway inhibitor maintains weight loss in the leptin deficient subject.
  • the subject has previously received at least one dose of a GLP-1 pathway activator.
  • the subject is receiving a GLP-1 pathway activator.
  • the myostatin signaling pathway inhibitor a myostatin signaling pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) is used in conjunction with a GLP-1 pathway activator.
  • a myostatin signaling pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • an inhibitor of the myostatin signaling pathway is used as a monotherapy or in conjunction with an activator of the GLP-1 signaling pathway to treat obesity (e.g., excess adiposity, overweight) in a subject.
  • the inhibitor of the myostatin signaling pathway may be any agent capable of suppressing myostatin signaling.
  • the inhibitors of the myostatin signaling pathway useful for carrying out the present invention may be myostatin-selective inhibitors.
  • the inhibitors of the myostatin signaling pathway useful for carrying out the present invention may be myostatin non-selective inhibitors.
  • inhibitors of the myostatin signaling pathway useful for carrying out the present invention may include low molecular weight compounds (i.e., small molecules) that inhibit the pathway, as well as biologies, such as antibodies or antigen-binding fragments thereof, and engineered protein constructs that comprise ligand-binding domains (such as soluble receptor ligand traps, follistatin-based engineered constructs, and adnectins).
  • the myostatin pathway inhibitors are antibodies (e.g., antigen-binding fragments thereof or engineered constructs that comprise such fragments) that bind mature myostatin (also known as GDF-8 or GDF8).
  • Such antibodies are typically referred to as neutralizing antibodies because they bind the growth factor thereby blocking its ability to bind endogenous receptors for activating the signaling pathway.
  • a myostatin pathway inhibitor binds a myostatin receptor thereby interfering with ligand binding.
  • These include antibodies that bind the extracellular portion(s) of the receptor.
  • Non-limiting examples of such antibodies include bimagrumab (BYM338) which binds ActRIIB.
  • the inhibitors of the myostatin signaling pathway useful for carrying out the invention are myostatin-selective inhibitors.
  • the myostatin-selective inhibitors are neutralizing antibodies that selectively bind mature myostatin (but not other growth factors such as GDF11 or Activin A).
  • myostatin-selective antibody is trevogrumab, also known as REGN1033.
  • the myostatin-selective inhibitors are antibodies or antigen-binding fragments thereof that bind the pro/latent myostatin complex, thereby inhibiting activation (e.g., release) of mature myostatin.
  • activation inhibitors of myostatin.
  • Non-limiting examples of myostatin-selective activation inhibitors include apitegromab (also known as SRK-015) and variants thereof, GYM329 and variants thereof, or a MST1032 variant as described in PCT/JP2015/006323.
  • an activator of the GLP-1 signaling pathway is used in conjunction with an inhibitor of the myostatin signaling pathway to treat obesity (e.g., excess adiposity, overweight) in a subject.
  • the activator of the GLP-1 signaling pathway may include any agent capable of enhancing the GLP-1 signaling.
  • the activators of the GLP-1 signaling pathway useful for carrying out the invention are GLP- 1 receptor agonists, such as GLP-1 analogs. Endogenous GLP-1 is susceptible to degradation by peptidases and has a short half-life. Therefore, certain modifications can be introduced to the peptide hormone to generate GLP- 1 analogs, aimed to prolong or stabilize its activity.
  • the GLP-1 analog may comprise the amino acid sequence EGTFTSD (SEQ ID NO: 116). In some embodiments, GLP-1 analogs comprise the amino acid sequence HXXGXFTXD (SEQ ID NO: 117), wherein X is any amino acid residue.
  • GLP-1 analogs include semaglutide, exenatide ER, liraglutide, lixisenatide, tirzepatide, dulaglutide, XW003, noisyiglutide, MEDI0382, and albiglutide.
  • the activators of the GLP-1 signaling pathway useful for carrying out the invention are inhibitors of peptidases responsible for the degradation of GLP-1 .
  • the peptidase inhibitor inhibits dipeptidyl peptidase 4 (DPP-4) and/or neutral endopeptidase (NEP).
  • the activators of the GLP-1 signaling pathway useful for carrying out the invention are agents capable of modulating GLP-1 receptor trafficking (e.g., agents that cause slower internalization of the receptor); agents that increase expression of cell-surface GLP-1 receptors; agents that enhance ligand-induced activation of the GLP-1 receptor; agents that enhance pathways such as cAMP signaling that are downstream of the GLP-1 receptor, and/or agents that antagonize the phosphatase responsible for de-phosphorylating the GLP- 1 receptor.
  • BMI body mass index
  • BMI of the adult subject to be treated with the combination or adjunct therapy according to the present disclosure is 25 kg/m 2 or above (overweight).
  • the adult subject has a BMI between 25-29.9 kg/m 2 (overweight).
  • BMI of the adult subject to be treated with the combination or adjunct therapy of the present disclosure is 30 kg/m 2 or above (obesity). In some embodiments, BMI of the adult subject to be treated with the combination or adjunct therapy of the present disclosure is between 30 and 40. In some embodiments, BMI of the adult subject to be treated with the combination or adjunct therapy of the present disclosure is 40 or above (extreme obesity). In some embodiments, BMI of a child or adolescent subject aged 2- 19 years to be treated with the combination or adjunct therapy according to the present disclosure is at or above the 85th percentile of children or young adults of the same sex and age (e.g., BMI at or above 85th percentile on the CDC growth charts).
  • BMI of a subject aged 2-19 years to be treated with the combination or adjunct therapy according to the present disclosure is at or above the 95th percentile of children or young adults of the same sex and age (e.g., BMI at or above 95th percentile on the CDC growth charts). In some embodiments, BMI of a subject aged 2-19 years to be treated with the combination or adjunct therapy according to the present disclosure is at or above 120 percent of the 95th percentile of children or young adults of the same sex and age (e.g., BMI at or above 120 percent of the 95th percentile on the CDC growth charts).
  • the subject also suffers from or is at risk of developing one or more weight-related condition(s) (such as high blood pressure, type 2 diabetes, heart disease, stroke, fatty liver disease, kidney disease or high cholesterol).
  • the subject is an adult subject.
  • the subject is a child or adolescent subject aged 2-19 years.
  • the adult subject has a body mass index (BMI) of 27 kg/m 2 or greater with at least one weight-related ailment, or, the adult subject has a BMI of 30 kg/m 2 or greater.
  • the adult subject has BMI ranging from 28-40 kg/m 2 , and optionally the subject has HbA1 c of 6.5-10%.
  • the subject aged 2-19 years has a BMI that is at or above the 85th percentile of children or young adults of the same sex and age (e.g., BMI at or above 85th percentile on the CDC growth charts). In some embodiments, the subject aged 2-19 years has a BMI that is at or above the 95th percentile of children or young adults of the same sex and age (e.g., BMI at or above 95th percentile on the CDC growth charts). In some embodiments, the subject aged 2-19 years has a BMI that is at or above 120 percent of the 95th percentile of children or young adults of the same sex and age (e.g., BMI at or above 120 percent of the 95th percentile on the CDC growth charts). In some embodiments, the subject is on a diet (e.g., calorie restriction). In some embodiments, the subject is on an exercise regimen.
  • a diet e.g., calorie restriction
  • the subject is on an exercise regimen.
  • the therapeutic methods disclosed herein may be useful for chronic weight management aimed to treat excess adiposity and metabolic disturbances of subjects with obesity, wherein optionally the subject has or is at risk of developing type 2 diabetes associated with obesity, while maintaining or improving the body composition (e.g., lean-to-fat mass ratios) of the subject.
  • body composition e.g., lean-to-fat mass ratios
  • the present disclosure also encompasses various embodiments of therapeutic use in which an inhibitor of the myostatin signaling pathway is administered as a monotherapy or in conjunction with an activator of the GLP- 1 signaling pathway for improving body composition in a subject.
  • the subject may be obese or overweight.
  • the subject may have or is at risk of developing metabolic condition(s) such as type 2 diabetes or metabolic syndrome.
  • the therapeutic use disclosed herein can improve body composition even if there is no overall weight loss (e.g., neutral effects on body weight) or even if there is overall weight gain in the subject.
  • the therapeutic use increases lean mass.
  • the therapeutic use decreases fat mass.
  • the therapeutic use increases lean- to-fat mass ratios. In some embodiments, the therapeutic use has a neutral effect on body weight. In some embodiments, the therapeutic use achieves overall weight loss in a subject. In some embodiments, therapeutic use maintains weight loss in a subject that has previously achieved weight loss.
  • Body composition may be assessed or measured using suitable techniques, such as qNMR, dual energy x-ray absorptiometry (DXA), magnetic resonance imaging (MRI)-derived hepatic fat fraction, hydrodensitometry, air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), bioimpedance spectroscopy (BIS), electrical impedance myography (EIM), 3D body scanners, and multi-compartment models (e.g., 3-compartment and 4- compartment models).
  • suitable techniques such as qNMR, dual energy x-ray absorptiometry (DXA), magnetic resonance imaging (MRI)-derived hepatic fat fraction, hydrodensitometry, air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), bioimpedance spectroscopy (BIS), electrical impedance myography (EIM), 3D body scanners, and multi-compartment models (e.g., 3-compartment
  • a myostatin-selective inhibitor is used, which provides improved safety profiles, as compared to a non-selective inhibitor of myostatin.
  • FIG. 1 A shows overall (whole body) weight loss in groups on a 20% or 30% calorie restriction (CR) treated with either the myostatin-selective inhibitor Ab2 or a control antibody.
  • the left panel shows the body weight of the animals over the course of the study and the right panel shows the percent change in body weight.
  • FIG. 1 B shows the percent change in lean muscle weight in groups on a 20% or 30% calorie restriction (CR) treated with either the myostatin-selective inhibitor Ab2 or a control antibody as measured by qNMR.
  • FIG. 1C shows a comparison of the percent change of lean mass weight during the study, measured on day 44, compared to baseline.
  • FIG. 1 D shows the weight in milligrams of the average of left and right gastrocnemius muscle samples collected at the end of the study.
  • FIG. 1 E shows the percentage difference in weight from the gastrocnemius muscles shown in FIG. 1 D compared to the gastrocnemius muscle weight of the control mice receiving the high fat diet ad lib.
  • FIG. 1 F shows the percentage of fat mass lost compared to the percentage of fat mass lost by the control mice receiving the high fat diet ad lib.
  • FIG. 1 G shows that Ab2 significantly increased the percent loss of fat mass in the animals that were calorie restricted by 20%.
  • FIG. 1 H shows the weight of the inguinal fat pads (average of both left & right fat pads) gathered at the end of the study. Ab2 significantly decreased the inguinal fat pad weight in animals that were calorie restricted by 20%.
  • FIG. 11 shows serum leptin levels in mice that were calorie restricted by 20% compared to mice receiving the high fat diet ad lib.
  • FIG. 11 shows the leptin level normalized to the percentage of fat.
  • FIG. 2A shows the results of an initial dose-determining study for liraglutide in the C57BL/6NTac DIO mouse model.
  • FIG. 2B shows the % body weight change from baseline at the end of a 30-day study in mice receiving the control lgG1 alone, Ab2 alone, or IgG 1 or Ab2 in conjunction with liraglutide at 0.03, 0.06, or 0.10 mg/kg.
  • Liraglutide induced a dose proportional decrease in body weight and Ab2 enhanced body weight loss in the 0.1 mg/kg liraglutide group relative to the IgG control.
  • FIG. 2C shows the percentage of change in lean mass compared to baseline as measured by qNMR.
  • FIG. 2D shows the percent change in mass of the gastrocnemius muscle.
  • FIG. 2E shows the full body percentage change in fat mass compared to baseline, as measured by qNMR.
  • FIG. 2F shows the percent change in weight of the inguinal fat pad.
  • FIG. 2G shows the overall lipid count in livers from the mice at the end of the study, as measured by histology.
  • FIG. 3A shows that the myostatin inhibiting antibody Ab2 increased VO in animals that were calorie restricted by 30%.
  • FIG. 3B shows that the myostatin inhibiting antibody Ab2 increased VO in animals that were calorie restricted by 30%, when normalized to weight loss.
  • FIG. 3C shows that the myostatin inhibiting antibody Ab2 had no effect on VO in animals that were calorie restricted by 30%, when normalized to lean mass.
  • FIG. 3D shows that the myostatin inhibiting antibody Ab2 increased energy expenditure in animals that were calorie restricted by 30%.
  • FIG. 3E shows that the myostatin inhibiting antibody Ab2 did not affect the respiratory exchange ratio (RER) in animals that were calorie restricted by 30%.
  • FIG. 4 shows body weight of mice undergoing 20% calorie restriction over time and treated with antibody Ab2.
  • the left panel shows the whole body weight over the 44 days of the study and the right panel shows the percent change.
  • FIG. 5A shows that the myostatin inhibiting antibody Ab2 preserved lean body mass in animals that were calorie restricted by 20%.
  • FIG. 5B shows that animals treated with the anti-myostatin antibody Ab2 lost significantly less lean body mass than animals treated with a control antibody.
  • FIG. 5C shows that the myostatin inhibitor Ab2 increased gastrocnemius muscle weight in animals that were calorie restricted by 20%.
  • FIG. 5D shows that calorie restricted animals treated with a control antibody lost gastrocnemius muscle weight while the calorie restricted animals treated with Ab2 gained a significant amount of gastrocnemius muscle weight.
  • FIG. 5E shows that the myostatin inhibitor Ab2 decreased both O consumption and CO output compared to mice treated with control antibody in the animals that were calorie restricted by 20%.
  • FIG. 5F shows the average respiratory exchange ratio as a function of time over the course of the 72 hours that the mice spent in the metabolic cage
  • FIG. 5G shows the physical activity levels of mice that were calorie restricted by 20% and treated with antibody Ab2
  • FIG. 6 shows the reduction in fat mass in mice treated with Ab2 and/or 20% calorie restriction.
  • FIG. 7 shows oxygen and energy consumption in mice treated with Ab2 and/or 20% calorie restriction.
  • the present invention is based, at least in part, on the discovery that administration of a myostatin pathway inhibitor, e.g., a myostatin inhibitor such as a myostatin-selective inhibitor, in subjects having a metabolic disease, e.g., obesity and/ortype 2 diabetes mellitus (T2DM) significantly improves both the physiological and the functional characteristics (e.g., improvements in body composition, glucose tolerance, etc.) of the affected subjects (e.g., a mammalian subject).
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor such as a myostatin-selective inhibitor
  • a metabolic disease e.g., obesity and/ortype 2 diabetes mellitus (T2DM)
  • T2DM type 2 diabetes mellitus
  • the present inventors have surprisingly discovered that administration of a combination of a myostatin pathway inhibitor and a GLP-1 pathway activator can help preserve lean mass in such subjects, can prevent or reduce gain of fat mass, improve body composition by increasing the muscle to fat ratio, and/or obviate or reduce the need, or provide additional benefit in conjunction with calorie restriction and/or increased exercise.
  • Activator of the GLP-1 signaling pathway The terms “activator of the GLP-1 signaling pathway” and “GLP- 1 pathway activator” are used interchangeably herein and encompass any agent that increases or enhances the activity of the GLP-1 signaling pathway, irrespective of the mechanism of action. Increased or enhanced activity of the GLP-1 signaling pathway may be a result of, for example, a greater degree of activity, longer duration of activity, increased availability of one or more components of the signaling pathway, etc.
  • Adjunct therapy The terms “adjunct therapy” and “add-on” therapy are used interchangeably herein and are intended to refer to a therapeutic regimen in which a second agent (used as an adjunct therapy) is administered to a subject who is on, has received, or to be treated with, a first agent (e.g., background therapy).
  • a second agent used as an adjunct therapy
  • a first agent e.g., background therapy
  • Administer/administration include any method or act of delivery of a pharmacological agent (e.g., medicament) to an intended subject, e.g., patient.
  • a pharmacological agent e.g., medicament
  • the pharmacological agent can be biologic, such as an antibody or an antigen-binding fragment thereof (e.g., a pharmaceutical composition comprising such an antibody or antigen-binding fragment, peptide agents, such as hormones and modified or synthetic analogs thereof, or low molecular weight agents (i.e. , structurally-defined small molecules or chemical entities), into a subject’s system or to a particular region in or on a subject (systemic and local administration, respectively).
  • an “adult” patient refers to an individual who is older than 19 years of age (i.e., 20 or older) unless otherwise specified.
  • Antibody encompasses full-length immunoglobulins, antigen-binding portion(s)/fragment(s) thereof, and any variants thereof that retain the ability to bind a target antigen.
  • Antibodies include human antibodies and humanized antibodies.
  • Background therapy refers to approved treatment available to a patient or patient population, for a particular indication, or a condition associated with the indication, which the patient has received or is receiving prior to a second therapy to be added on as adjunct therapy for the same indication (e.g., prior to adjunct administration of a myostatin pathway inhibitor).
  • background therapies are standard-on-care for the condition.
  • patients with type 2 diabetes may be on a biguanide, such as metformin (e.g., Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor) or metformin-containing medications that include one or more additional active agents (e.g., thiazolidinediones (glitazones) and rosiglitazone), as a background therapy.
  • metformin e.g., Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor
  • metformin-containing medications that include one or more additional active agents (e.g., thiazolidinediones (glitazone
  • patients with type 2 diabetes may be on a sulfonylurea (e.g., glimepiride, glipizide, glyburide, glipalamide, or chlorpropamide.
  • patients with type 2 diabetes may be on a thiazolidinedione, e.g., pioglitazone.
  • Baseline refers to measurement of a particular metric in a subject or a population of subjects before an action occurs to modify that metric, e.g., at the beginning of a study (prior to dosing).
  • a baseline or baseline measurement may refer to measurement of leptin levels, ghrelin levels, adiponectin levels, body weight, fat mass (e.g., total fat mass or visceral fat mass), lean mass (e.g., muscle mass), insulin levels (fasted or non-fasted), insulin sensitivity, glucose levels (fasted or non-fasted), rate of gastric emptying, metabolic rate (e.g., as measured by oxygen consumed and carbon dioxide expelled during a defined period of time), HbA1 c levels, blood pressure and pulse, lipoprotein lipids, and/or measurement of waist circumference, among other measurements.
  • fat mass e.g., total fat mass or visceral fat mass
  • lean mass e.g., muscle mass
  • insulin levels fasted or non-fasted
  • insulin sensitivity e.g., glucose levels (fasted or non-fasted)
  • glucose levels fasted or non-fasted
  • rate of gastric emptying e.
  • Body composition refers to relative components that make up a body, including fat mass, muscle (lean) mass, bone and water etc.
  • body composition refers to ratios of lean vs fat mass in the body. Unless explicitly stated, as used herein the term refers to the body composition of the whole body (total body).
  • Body composition can be measured by various suitable methods and techniques, including, body density, dual energy X-ray absorptiometry (DEXA), air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), body volume indicator (BVI), skin folds (with measuring caliper), Ultrasound, quantitative magnetic resonance (QMR), circumferences (e.g., as measured at waistline), and other measurements.
  • DEXA dual energy X-ray absorptiometry
  • ADP air displacement plethysmography
  • BIOA bioelectrical impedance analysis
  • BVI body volume indicator
  • QMR quantitative magnetic resonance
  • circumferences e.g., as measured at waistline
  • Body mass index (BMI): The term “body mass index” or “BMI” is a numerical value derived from the mass and height of a person and is defined as weight in kilograms divided by height in meters squared (expressed in units of kg/m 2 ). BMI provides general body weight-height relationships which can be used to categorize a person as underweight, normal weight, overweight, obese or extreme obese, based on tissue mass (muscle, fat and bone) relative to height.
  • Calorie restriction/caloric restriction The term refers to a form of dieting that requires a reduced overall calorie intake.
  • Combination therapy refers to a therapeutic regimen involving administration of two or more active agents (e.g., two or more pharmacological agents) intended to treat a predetermined indication and/or conditions associated therewith.
  • the two or more agents may be formulated as separate compositions (e.g., formulations) or may be formulated as a single composition (formulation).
  • Combination therapy encompasses therapies used in conjunction with each other and complementary to each other.
  • the term “decrease” or “reduce”, as used herein, in the context of a disease symptom refers to a statistically significant decrease in such level.
  • the decrease can be, for example, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or below the level of detection for the detection method.
  • the decrease can also be, for example, about 1-10%, 10-20%, 1-30%, 20-50%, 30-60%, 40-70%, 50-80%, or 60-90%.
  • the reduction in an individual with a disorder may achieve a level accepted as within the normal range for an individual without such disorder.
  • Dieting/diet regimen In the context of the present disclosure, certain dieting may be incorporated as part of weight management, e.g., obesity treatment which includes a pharmacological intervention. Dieting may include caloric/calorie restriction (i.e. , reduced calorie intake or reduced absorption of calories) as well as alterations in choices about the type of food consumed (e.g., high protein, lower fat or lower carbohydrate regimens). Thus, a patient is on a “diet or reduced calorie regimen” when the patient incorporates or is instructed by a physician or equivalent to incorporate dieting into overall therapeutic regimen, e.g., as part of weight management,
  • Effective amount refers to any amount or dose of a compound or composition that is sufficient to fulfill its intended purpose(s), i.e., a desired biological or medicinal response in a tissue or subject at an acceptable benefit/risk ratio.
  • the intended purpose may be to inhibit activation of myostatin in vivo, to achieve a clinically meaningful outcome associated with the myostatin inhibition.
  • an effective amount is an amount that, when administered according to a particular regimen, produces a positive clinical outcome with a reasonably acceptable level of adverse effects (e.g., toxicity), such that the adverse effects, if present, are tolerable enough for a patient to continue with the therapeutic regimen, and the benefit of the therapy overweighs risk of toxicity.
  • a unit dosage may be considered to contain an effective amount if it contains an amount appropriate for administration in the context of a dosage regimen correlated with a positive outcome.
  • a therapeutically effective amount is commonly administered in a dosing regimen that may comprise multiple unit doses.
  • a therapeutically effective amount (and/or an appropriate unit dose within an effective dosing regimen) may vary, for example, depending on route of administration, on combination with other pharmaceutical agents.
  • the specific therapeutically effective amount (and/or unit dose) for any particular patient may depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific pharmaceutical agent employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and/or rate of excretion or metabolism of the specific pharmaceutical agent employed; the duration of the treatment; and like factors as is well known in the medical arts.
  • an effective amount may also refer to the amount of each active agent required to confer a therapeutic effect on the subject, either alone or in combination with one or more other active agents.
  • an effective amount refers to the amount of a myostatin inhibitor, e.g., an antibody, or antigen-binding fragment thereof, of the present disclosure which is sufficient to achieve a biological effect, e.g., an increase in muscle mass or muscle fiber diameter, a switch in muscle fiber type, an increase in the amount of force generated by the muscle, an increase in mass and/or function of a muscle tissue in the subject; an increase in the metabolic rate of the subject; an increase in insulin sensitivity of the subject; an increase in a level of brown adipose tissue in the subject; an increase in a level of beige adipose tissue in the subject; a decrease in a level of white adipose tissue in the subject; a decrease in a level of visceral adipose tissue in the subject; a decrease
  • Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation.
  • Efficacy refers to a measurable biological or medicinal response in a subject as the result of administering a therapy in an amount that is sufficient to fulfill its intended purpose(s).
  • the efficacy of a myostatin pathway inhibitor may refer to any desired clinically meaningful outcome that is associated with use of the inhibitor.
  • the efficacy of a GLP-1 pathway activator may refer to any desired clinically meaningful outcome that is associated with use of the GLP-1 pathway activator.
  • efficacy of a myostatin pathway inhibitor used in conjunction with a GLP-1 pathway activator is measured in a patient or patient population.
  • efficacy of a combination therapy comprising a myostatin pathway inhibitor and a GLP-1 pathway activator is measured in a patient or patient population who is treated with the combination.
  • efficacy of an adjunct therapy comprising a myostatin pathway inhibitor is measured in a patient or patient population who is treated with a GLP-1 pathway activator.
  • efficacy of an adjunct therapy comprising a GLP-1 pathway activator is measured in a patient or patient population who is treated with a myostatin pathway inhibitor.
  • the measured efficacy is preferably greater (more clinically meaningful) than monotherapy of either.
  • therapeutic efficacy refers to a clinically meaningful outcome for a subject (e.g., a mammalian subject) having a metabolic disorder, such as alleviation, reduction, delay, or prevention of one or more symptoms of a metabolic disorder in a subject receiving a myostatin pathway inhibitor in conjunction with a GLP-1 pathway activator.
  • a subject e.g., a mammalian subject
  • a metabolic disorder such as alleviation, reduction, delay, or prevention of one or more symptoms of a metabolic disorder in a subject receiving a myostatin pathway inhibitor in conjunction with a GLP-1 pathway activator.
  • such efficacy is evaluated by a measuring a change in body composition (e.g., a change in the muscle to fat ratio) at the end of a study or a treatment regimen, e.g., by DXA, qNMR, etc.
  • therapeutic efficacy is assessed by measuring glycemic control/insulin sensitivity (e.g., HbA1 c measurements, fasting glucose and insulin, etc.), anthropometric measurements (body weight, BMI, waist circumference, weight to hip ratio, loss, stabilization, or gain of fat or muscle), each as compared to baseline.
  • PK/PD markers can be used as a measurement of efficacy, e.g., measurements of serum latent myostatin.
  • a therapeutically effective outcome of treatment with a myostatin pathway inhibitor and a GLP-1 pathway activator is an increase in the muscle to fat ratio, regardless of change in other properties such as body weight relative to baseline.
  • a therapeutically effective outcome comprises a decrease in body weight, a reduction or stabilization in fat mass, and/or an increase in muscle mass, relative to baseline.
  • exercise/exercise regimen includes any physical activities.
  • a patient is on an “exercise regimen” when the patient incorporates or is instructed by a physician or equivalent to incorporate increased physical activity into overall therapeutic regimen, e.g., as part of weight management.
  • Fc variant refers to an antibody (immunoglobulins) comprising one or more mutations within the Fc region thereof, typically having the same CDR sequences as the parental (reference) antibody from which it is derived.
  • Fc variants can be generated to have altered (e.g., increased) affinities to the FcR, such as FcRn.
  • altered affinities to FcRn result in altered biological activities in vivo, such as a longer serum half-life of the Fc variant, as compared to its parental antibody without the Fc mutation(s).
  • gastric emptying refers to the process by which the contents of the stomach are moved into the small intestine (i.e. , the duodenum).
  • postprandial gastric emptying refers to the rate at which gastric emptying takes place after a meal. Gastric emptying may be measured by any known method in the art, such as scintigraphy, magnetic resonance imaging (MRI), and real-time ultrasonography.
  • GLP-1 analog refers to a peptide or modified peptide bearing structural and functional similarities to the naturally-occurring GLP-1 and is capable of binding to and activating the GLP-1 receptor.
  • GLP-1 analogs include, semaglutide, exenatide ER, liraglutide, lixisenatide, tirzepatide, dulaglutide, XW003, noisyiglutide, MEDI0382, and albiglutide.
  • GLP-1 analogs shall include peptides or modified peptides comprising an amino acid sequence EGTFTSD (SEQ ID NO: 116).
  • GLP-1 analogs shall include peptides or modified peptides comprising an amino acid sequence HXXGXFTXD (SEQ ID NO: 117), wherein X is any amino acid residue.
  • GLP-1 receptor agonist means an agent capable of binding to and activating the GLP-1 receptor.
  • GLP-1 is a naturally-occurring agonist of the GLP-1 receptor.
  • GLP-1 receptor agonists encompass GLP-1 analogs.
  • a GLP-1 receptor agonist may be a small molecule GLP-1 receptor agonist.
  • the GLP-1 receptor agonist is a long-acting small molecule GLP-1 receptor agonist.
  • GLP-1 pathway activator and “activator of the GLP-1 signaling pathway” are used interchangeably herein and encompass any agent that increases or enhances the activity of the GLP-1 signaling pathway, irrespective of the mechanism of action. Increased or enhanced activity of the GLP-1 signaling pathway may be a result of, for example, a greater degree of activity, longer duration of activity, increased availability of one or more components of the signaling pathway, etc.
  • GLP-1 pathway activators include agents that modulate upstream regulators of GLP-1 (e.g., dipeptididyl peptidase (DPP-IV) inhibitors).
  • DPP-IV dipeptididyl peptidase
  • GLP-1 pathway activators include agents that regulate the amount or activity of GLP-1 (e.g., agents that increase production of or secretion of GLP-1 ; GLP-1 stabilizers).
  • GLP-1 pathway activators include agents that increase activation of the GLP-1 receptor (GLP-1 R).
  • agents that increase activation of the GLP-1 R include GLP-1 agonists, which include GLP-1 analogs.
  • GLP-1 pathway activators include agents that activate signaling downstream of the GLP-1 R (e.g., activators of PI3K, PKC, cAMP, etc.).
  • GLP-1 pathway activators may include agents that modulate receptor GLP-1 R expression and/or trafficking (e.g., inhibitors of GLP-1 R internalization; see, e.g., Jones et al. , Nat. Comm. (2016)9:1602).
  • GLP-1 pathway activators encompass activators of the GLP-1 R.
  • the GLP-1 pathway activator is a GLP-1 receptor agonist.
  • GLP-1 pathway activators include, but are not limited to, antibodies and antigen binding fragments thereof, engineered protein constructs (such as Fc conjugates and multi-functional molecules comprising a GLP-1 analog), peptides, and small molecules.
  • Therapeutic regimen that comprises a GLP-1 pathway activator may further include dieting (e.g., reduced calorie diet or calorie restriction) and/or exercising (e.g., increased physical activity) as part of the treatment.
  • dieting e.g., reduced calorie diet or calorie restriction
  • exercising e.g., increased physical activity
  • patients are provided with dieting and/or exercising counseling.
  • Human antibody/humanized antibody is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences and fragments thereof.
  • the human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
  • humanized antibody refers to antibodies from non-human species whose protein sequences have been modified to increase their similarity to antibodies produced in humans.
  • “Humanized antibodies” may refer to antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
  • the term “increase” in the context, e.g., of a disease in which a symptom can be a loss of function or loss of mass, e.g., muscle mass associated with a disease refers to a statistically significant increase in such level.
  • the increase can be, for example, at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95%, or above the level of detection for the detection method.
  • the increase can also be, for example, about 1-10%, 10-20%, 1-30%, 20-50%, 30-60%, 40-70%, 50-80%, or 60-90%.
  • the increase is up to a level accepted as within the range of normal for an individual without such disorder which can also be referred to as a normalization of a level.
  • the increase is the normalization of the level of a sign or symptom of a disease, an increase in the difference between the subject level of a sign of the disease and the normal level of the sign for the disease.
  • the methods include an increase in the mass and/or function of the muscle tissue after treatment of a subject with an antibody that specifically binds pro/latent myostatin.
  • the methods include an increase in a level of pro-myostatin in a target muscle, as compared to a control level of pro-myostatin.
  • Inhibitor of the myostatin signaling pathway The terms “inhibitor of the myostatin signaling pathway” and “myostatin pathway inhibitor” are used interchangeably herein and encompass any agent that decreases (reduces) or suppresses the activity of the myostatin signaling pathway, irrespective of the mechanism of action. Decreased or suppressed activity of the myostatin signaling pathway may be a result of, for example, a reduced degree of activity, shorter duration of activity, reduced availability of one or more components of the signaling pathway, etc.
  • Insulin sensitivity refers to the metabolic actions of insulin to promote glucose disposal in a subject’s body.
  • a subject is said to have increased insulin sensitivity if the subject requires smaller amounts of insulin to lower blood glucose levels as compared to the average in a human population.
  • a subject is said to have decreased insulin sensitivity if the subject requires higher amounts of insulin to lower blood glucose levels.
  • a subject is said to have “insulin resistance” if the quantity of exogenous or endogenous insulin required to increase glucose uptake and utilization in a subject is significantly higher than that in a healthy subject.
  • a subject is said to have “insulin resistance” if the quantity of exogenous or endogenous insulin required to increase glucose uptake and utilization in a subject is 10%, 20%, 30%, 40% 50%, 60%, 70%, 80%, 90%, 100%, or higher as compared to that in a healthy subject.
  • Lean/lean mass As used herein, “lean” mass or tissue generally corresponds to muscle mass or muscle tissue, as opposed to fat mass or fat tissue (e.g., adipose). Typically, greater ratios of lean mass relative to fat mass in the body indicate more desirable body composition.
  • Ligand trap refers to a molecule or class of molecules comprising a ligand-binding fragment/moiety that serves as a “trap” to sequester ligands (such as growth factors), so as to prevent the ligand from binding to and activating endogenous receptors.
  • Ligand traps may be derived from the naturally-occurring receptors of the ligand by incorporating the ligand-binding portion thereof. Examples of myostatin ligand traps include, without limitation, soluble receptor-based ligand traps, follistatin-based ligand traps, etc. Myostatin ligand traps may not be selective for myostatin but may also bind and inhibit additional ligands such as GDF11 and Activin A.
  • Mature myostatin refers to the dimeric growth factor, which is also known as GDF8, and is released from the latent myostatin complex. Mature myostatin is the soluble and biologically active ligand capable of binding to and activating its receptors. Unless explicitly stated otherwise, the term “mature myostatin” refers to a fully processed, biologically active form of myostatin. A wildtype sequence of mature myostatin is provided as SEQ ID NO: 56. In some cases, mature myostatin may contain one or more mutations, which may exhibit altered structure/function or stability.
  • Metabolic disorder may also be referred to as metabolic disease or metabolic condition and encompasses any conditions involving dysregulation of the body’s metabolic function, resulting in perturbation of the normal physiological state of homeostasis due to an alteration in metabolism (anabolism and/or catabolism). Metabolic disorders may be inherited or acquired. Non-limiting examples of metabolic disorders include obesity/overweight, type 2 diabetes mellitus, type 2 diabetes mellitus associated with obesity, and metabolic syndrome.
  • Metabolic rate refers to the amount of energy expended over a specific period of time. It is typically measured in calories, kilocalories, or joules. Metabolic rate may be expressed as oxygen consumed or carbon dioxide produced per unit time.
  • Metabolism refers to the processes involved in the biosynthesis and breakdown of components that make up a body, such as fats (e.g., adipose tissue), muscle and bones. “Fat metabolism” therefore means the process of biosynthesis and breakdown of fats.
  • myostatin in the context of the present disclosure, unless explicitly defined otherwise, the term “myostatin” can referto any forms of the myostatin protein, such as pro-myostatin, latent myostatin and mature myostatin, each of which exists in dimers in vivo.
  • Myostatin inhibitor refers to any agent that inhibits one or more forms of myostatin (e.g., pro-myostatin, latent myostatin and/or mature myostatin) and encompasses both selective inhibitors of myostatin and non-selective inhibitors of myostatin.
  • Selective inhibitors of myostatin i.e. , myostatin-selective inhibitors
  • myostatin-selective inhibitors are substantially specific to and potent towards myostatin over other structurally related members of the TQRb superfamily at given concentrations.
  • a myostatin inhibitor is selective if it binds to myostatin with 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1 ,000-fold, or greater affinity as compared to another member of the TQRb superfamily (e.g., GDF11 or Activin A).
  • myostatin-selective inhibitors include apitegromab, trevogrumab, and GYM329.
  • non- selective inhibitors of myostatin inhibit myostatin, as well as one or more additional members of the TQRb superfamily, such as GDF11 , Activin A, Activin B, BMPs, etc.
  • myostatin inhibitor encompasses any molecular modalities such as large molecules (biologies, such as antibodies and engineered protein constructs) and small molecules (such as structurally-defined low molecular weight chemical entities).
  • a myostatin inhibitor may be an anti-myostatin antibody, or antigen binding fragment thereof, that binds pro- and/or latent myostatin and/or mature myostatin.
  • the myostatin inhibitor may be an anti-pro/latent myostatin antibody, or antigen binding fragment thereof, that preferentially (e.g., selectively) binds pro- and/or latent myostatin over mature myostatin.
  • the myostatin inhibitor may be an antibody (such as a neutralizing antibody), an activation inhibitor (e.g., an antibody that inhibits activation of pro- and/or latent-myostatin), an adnectin, a peptibody, a receptor trap, or a ligand trap.
  • the myostatin inhibitor is a small molecule inhibitor.
  • the myostatin inhibitor refers to a gene therapy.
  • Myostatin pathway inhibitor The terms “myostatin pathway inhibitor” and “inhibitor of the myostatin signaling pathway” are used interchangeably herein and encompass any agent that decreases (reduces) or suppresses the activity of the myostatin signaling pathway, irrespective of the mechanism of action. Decreased or suppressed activity of the myostatin signaling pathway may be a result of, for example, a reduced degree of activity, shorter duration of activity, reduced availability of one or more components of the signaling pathway, etc. Such inhibitors may be selective to myostatin per se, or may be non-selective such that they also inhibit at least one additional growth factor, such as GDF11 and Activin A.
  • myostatin pathway inhibitors encompass inhibitors that act on molecules upstream of myostatin, e.g., to prevent activation of proteases that cleave pro- and/or latent-myostatin to its active form.
  • myostatin pathway inhibitors encompass myostatin inhibitors that act on myostatin to prevent its activation or to prevent its interaction with receptors, including myostatin-selective inhibitors.
  • myostatin pathway inhibitors encompass antibodies and other inhibitors that act on myostatin receptors or downstream to prevent one or more effects of the myostatin signaling cascade.
  • the myostatin pathway inhibitors include, but are not limited, antibodies or antigen-binding fragments thereof, small molecules, receptor traps, adnectins, affibodies, DARPins, Anticalins, Avimers, Versabodies, receptor inhibitors (such as a receptor antibody or a receptor kinase inhibitor), or gene therapies.
  • myostatin-selective inhibitor refers to an inhibitor of the myostatin signaling pathway (i.e., myostatin pathway inhibitor) which is selective to myostatin, but not GDF11 , Activin A, or other TQRb family members.
  • myostatin inhibitor is selective if it binds to myostatin with a 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1 ,000-fold, or greater affinity toward as compared to another member of the TQRb superfamily (e.g., GDF11 or Activin A).
  • a selective myostatin inhibitor exhibits no detectable binding or potency towards other TQRb family members.
  • myostatin-selective inhibitors are neutralizing antibodies that bind mature myostatin thereby inhibiting its activity.
  • myostatin-selective inhibitors are antibodies that bind pro- and/or latent myostatin, thereby inhibiting the activation step of myostatin.
  • the myostatin-selective inhibitor is Ab2, apitegromab, trevogrumab, GYM329, or a variant of the any one of the foregoing.
  • Overweight/obesity A person whose weight is higher than what is considered as a normal weight adjusted for height is described as being overweight or having obesity.
  • BMI-based classification for human adults (ages 20 and older), BMI of 18.5 to 24.9 is considered normal weight, BMI of 25 to 29.9 is considered overweight, BMI of 30+ is considered obese (including extreme obesity); and BMI of 40+ is considered extremely obese.
  • BMI at or above the 85 th percentile on the CDC growth chart is considered overweight or obese;
  • BMI at or above the 95 th percentile on the CDC growth charts is considered obese (including extreme obesity); and, BMI at or above 120 percent of the 95 th percentile on the CDC growth chart is considered extremely obese.
  • Pro/latent myostatin refers to pro-myostatin, latent myostatin, or both (i.e. , pro-forms or precursors of myostatin), but excludes mature myostatin.
  • the pro- and latent forms of myostatin remain associated with a prodomain (e.g., LAP) and are inactive in that they are incapable of binding to the cellular myostatin receptors.
  • ‘‘Specific” and ‘‘specificity” in the context of an interaction between members of a specific binding pair refer to the selective reactivity of the interaction.
  • the phrase ‘‘specifically binds to” and analogous phrases, in the context of antibodies, refer to the ability of antibodies (or antigenically reactive fragments thereof) to bind specifically to an antigen (or a fragment thereof) and not bind specifically to other entities.
  • Specific binding is understood as a preference for binding a certain antigen, epitope, receptor ligand, or binding partner with, for example, at least 2-fold, 5-fold, 10-fold, 50- fold, 100-fold, 200-fold, 500-fold, or 1 ,000-fold preference over a control non-specific antigen, epitope, receptor ligand, or binding partner.
  • ‘‘Specific binding” as used herein can also referto binding pairs based on binding kinetics such as Kon, Koff, and KD.
  • a ligand can be understood to bind specifically to its target site if it has a Ko ff of 10 2 sec 1 or less, 10 3 sec 1 or less, 10 4 sec 1 or less, 10 5 sec 1 or less, or 10 6 sec -1 or less; and / or a KD of 10 8 M or less, 10 9 M or less, 10- 10 M or less, or 10- 11 M or less, or 10- 12 M or less, e.g., as measured by ELISA and Octet. It is understood that various proteins can share common epitopes or other binding sites (e.g., kinase reactive sites).
  • binding sites may bind more than one ligand, but still can be considered to have specificity based on binding preference as compared to a non-specific antigen and / or by having certain binding kinetic parameters. Methods of selecting appropriate non-specific controls are within the ability of those of skill in the art. Binding assays are typically performed under physiological conditions.
  • an antibody may also ‘‘selectively” (i.e., ‘‘preferentially”) bind a target antigen if it binds that target with a comparatively greater strength than the strength of binding shown to other antigens, e.g., a 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200- fold, 500-fold, 1000-fold, or greater comparative affinity for a target antigen (e.g., pro/latent myostatin) than for a non-target antigen (e.g., GDF11 , Activin A, or other TQBb superfamily members).
  • a selective myostatin inhibitor exhibits no detectable binding or potency towards other TQBb family members.
  • a subject is a target to whom the therapy or therapies described herein may be administered.
  • the terms ‘‘subject” (e.g., human subjects) and ‘‘patient” may be used interchangeably.
  • a subject is a vertebrate, in particular a mammal, in need of treatment, e.g., companion animals (e.g., dogs, cats and the like), farm animals (e.g., cows, pigs, horses, sheep, goats, poultry and the like) and laboratory animals (e.g., rats, mice, guinea pigs and the like).
  • the subject is a human who will benefit from or in need of treatment.
  • a subject is a human subject. In some embodiments, the subject is a child or adolescent subject aged 2-19 years. In some embodiments, the subject, is a subject aged 12 years or older. In some embodiments, the subject is a subject aged 12-17. In some embodiments, the subject is an adult subject aged 20 years or older. In some embodiments, the subject is an overweight, obese, or extremely obese human. In some embodiments, the subject has metabolic syndrome, type 2 diabetes, or type 2 diabetes associated with obesity.
  • Total fat mass refers to the cumulative fat content in a subject’s body.
  • Total fat mass includes fat made up of various types of fat cells, such as white fat, brown fat, and beige fat, and includes fat storage in different body compartments, such as essential fat, subcutaneous fat, and visceral fat.
  • Total fat mass may be measured or estimated by any method known in the art, including by skinfold measurements using calipers, measuring the circumference of certain body parts, dual-energy X-ray absorptiometry (DXA), hydrostatic weighing, air displacement plethysmography, bioelectric impedance analysis, bioimpedance spectroscopy, electrical impedance myography, 3-dimensional body scanners, multi-compartment models, or magnetic resonance imaging.
  • DXA dual-energy X-ray absorptiometry
  • hydrostatic weighing air displacement plethysmography
  • bioelectric impedance analysis bioimpedance spectroscopy
  • electrical impedance myography 3-dimensional body scanners
  • fat mass gain or “fat mass loss” refers to a change in the amount of fat mass measured as compared to a baseline measurement.
  • a subject having a metabolic disorder may exhibit fat mass loss or visceral fat mass loss after a treatment for the metabolic disorder (e.g., treatment with a myostatin pathway inhibitor, e.g., in conjunction with a GLP-1 pathway activator).
  • visceral fat refers to fat content that is predominantly made up of white fat cells and is mainly found in the abdominal area of a subject’s body and around the subject’s major organs, such as the liver, kidneys, pancreas, intestines, and heart.
  • TreatAreatingAreatment Treatment of a condition or disease in a subject refers to the act of providing a therapeutic regimen aimed to alleviate, prevent, or improve a medical condition. Thus, the terms treating or treatment do not necessarily require a complete treatment or prevention of the disease or disorder. In one embodiment, the symptoms of a disease or disorder are alleviated by at least 5%, at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%.
  • Weight loss refers to a reduction of body weight, irrespective of particular tissue(s) being lost. For example, weight loss per se does not distinguish between loss in fat mass vs muscle mass. Overall loss of total body weight does not necessarily reflect improved body composition,
  • Weight management encompasses measures taken to lose weight, sustain weight, as well as to reduce adipose tissue, increase lean mass, or otherwise to improve or sustain body composition, Successful weight management that is clinically meaningful may or may not accompany overall weight loss.
  • weight management can include diet (e.g., a calorie restriction diet, e.g., reduced calorie intake or reduced absorption of calories), an exercise regimen, and/or medication (e.g., a myostatin pathway inhibitor and/or a GLP-1 pathway activator) in order to reduce the amount of total body weight, reduce the amount of total fat mass, reduce the amount of visceral fat mass, increase the metabolic rate, increase the amount of lean mass, and/or increase the ratio of muscle to fat, or otherwise to improve body composition, in a subject.
  • diet e.g., a calorie restriction diet, e.g., reduced calorie intake or reduced absorption of calories
  • an exercise regimen e.g., a myostatin pathway inhibitor and/or a GLP-1 pathway activator
  • medication e.g., a myostatin pathway inhibitor and/or a GLP-1 pathway activator
  • Weight-related condition refers to one or more medical condition(s) associated with excess fat mass (i.e. , in addition to being overweight or obese), where the excess fat mass of the subject is a contributing factor.
  • weight-related conditions include type 2 diabetes mellitus, high blood pressure, high triglyceride or cholesterol level, heart disease, stroke, kidney disease, fatty liver (e.g., NAFLD and NASH) and sleep apnea.
  • GLP-1R Glucagon Like Peptide 1 Receptor
  • agents useful for carrying out the present invention include agents that enhance the GLP-1 signaling pathway.
  • GLP-1 signals through its endogenous receptor, GLP-1 receptor (GLP-1 R).
  • GLP-1 R GLP-1 receptor
  • Human GLP-1 R (UniProt Accession No. P43220) is a 463-amino acid, G protein-coupled receptor formed by eight hydrophobic domains, mainly expressed in pancreatic islets. This receptor, which functions at the cell surface, becomes internalized in response to binding by peptide hormone glucagon-like peptide 1 (GLP-1) and GLP-1 analogs, and it plays an important role in the signaling cascades leading to insulin secretion.
  • GLP-1 R GLP-1 receptor
  • GLP-1 Rs are particularly abundant in pancreatic b-cells, where they drive glucose-dependent insulin secretion, but are also present in pancreatic a-cells, where they mediate the inhibition of glucagon secretion, and in the intestine, lung, kidney, heart, blood vessels, lymphocytes, and peripheral and central nervous systems.
  • GLP-1 R is abundant in the vasculature, mainly in arteries and arterioles where GLP-1 exerts vasodilatory effects, whereas, in the heart, GLP-1 R expression is about sixfold greater in atrial than ventricular myocytes.
  • Wild-type glucagon-like peptide-1 (7-36)amide (GLP-1) is a secreted peptide that acts as a key determinant of blood glucose homeostasis by virtue of its abilities to slow gastric emptying, to enhance pancreatic insulin secretion, and to suppress pancreatic glucagon secretion (see, e.g., Prog Mol Biol Transl Sci. 2014; 121 : 23-65.).
  • GLP-1 is secreted from L cells of the gastrointestinal mucosa in response to food consumption and acts to lower blood glucose. Wild-type GLP-1 is quickly inactivated due to its enzymatic degradation by dipeptidyl-peptidase-IV (DPP-IV).
  • GLP-1 activates enteric and autonomic reflexes while also circulating as an incretin hormone to control endocrine pancreas function.
  • GLP-1 R Upon ligand (GLP-1) binding, GLP-1 R initiates a cascade that involves activation of membrane bound adenyl cyclase and consequent production of cyclic adenosine monophosphate (cAMP). Downstream of cAMP formation, several signal transduction pathways can be initiated, which generally require activation of either one or both of the cellular cAMP effectors, protein kinase A (PKA) and exchange protein directly activated by cAMP (EPAC).
  • PKA protein kinase A
  • EPAC exchange protein directly activated by cAMP
  • the downstream signaling cascade can induce glucose stimulated insulin secretion (GSIS) in b-cells, as well as inhibition of a-cell glucagon release.
  • GSIS glucose stimulated insulin secretion
  • binding of GLP-1 R by GLP- 1 and its analogs also initiates a variety of anti-diabetic effects, including, but not limited to, reduction in gastric emptying, increase in satiety and inhibition of food motivated behavior, replenishment of insulin stores, as well as cytoprotective and anti-inflammatory actions on b-cells.
  • the present disclosure provides use of agents that activate or enhance the GLP-1 signaling pathway, in conjunction with myostatin pathway inhibitors, for weight management and improved body composition. Use in conjunction may involve combination therapy or adjunct therapy. Because of the potential beneficial effects on glucose homeostasis, primarily through its regulation of beta cell mass, function, and viability, the GLP-1 signaling pathway is an attractive therapeutic target for development of treatments of metabolic disorders, such as treatments including (but not limited to) activators of GLP-1/GLP-1 R and the associated signaling pathway.
  • GLP-1 pathway activators may provide a number of benefits for a subject (e.g., a mammal) having type 2 diabetes mellitus (T2DM), such as enhanced appropriate pancreatic beta cell (insulin and amylin) secretion, pancreatic alpha cell (glucagon) suppression, decreased liver glucose production, increased satiety through the central nervous system, slowed gastric emptying time, and increased insulin uptake in peripheral tissue via weight loss, limitations include requirements for concurrent dieting and increased physical activity, as well as safety concerns. Novel weight management approach disclosed herein combines the benefit of GLP-1 pathway activators with myostatin pathway inhibitors in order to enhance clinical benefit.
  • T2DM type 2 diabetes mellitus
  • activators of the GLP-1 pathway include (but are not limited to) insulin production pathway activators (e.g., activators of cAMP, EPAC, CREB, or EGFR signaling pathways) and agents that act on multiple pathways that include an effect on insulin production, such as metformin.
  • insulin production pathway activators e.g., activators of cAMP, EPAC, CREB, or EGFR signaling pathways
  • agents that act on multiple pathways that include an effect on insulin production such as metformin.
  • GLP-1 enhancers e.g., agents that increase production of or secretion of GLP-1 , GLP-1 stabilizers
  • modulators of GLP-1 R trafficking e.g., enhancers of receptor membrane localization, inhibitors of receptor internalization
  • GLP-1 degradation inhibitors e.g., DPP-IV inhibitors
  • GLP-1 secretagogues e.g., GLP-1 receptor agonists.
  • Insulin secretion refers to the level of insulin released by the pancreas. Levels of insulin secretion in a subject may be estimated by proxy using measurements of fasting and/or non-fasting blood glucose concentrations. For example, the normal fasting blood glucose concentration in humans is between 80 mg/100 mL and 90 mg/100 mL, which is linked to very low levels of insulin secretion. Serum insulin levels may also be measured using any known method in the art, such as by enzyme-linked immunoassay (ELISA). Agents that enhance the GLP-1 signaling pathway, including GLP-1 (and GLP-1 analogs) and gastroinhibitory intestinal polypeptide (GIP), may promote/stimulate insulin secretion.
  • GLP-1 and GLP-1 analogs
  • GIP gastroinhibitory intestinal polypeptide
  • useful activators of the GLP-1 signaling pathway include GLP-1 receptor agonists, such as GLP-1 analogs.
  • GLP-1 analogs share certain structural similarities with the GLP-1 peptide and include modified peptides that retain the ability to bind to and activate the GLP-1 receptors.
  • GLP- 1 analogs comprise the amino acid sequence EGTFTSD (SEQ ID NO: 116).
  • GLP-1 analogs comprise the amino acid sequence HXXGXFTXD, wherein X is any amino acid residue (SEQ ID NO: 117).
  • GLP-1 signaling pathway activators may be used in conjunction with a myostatin pathway inhibitor.
  • the GLP-1 pathway activator and the myostatin pathway inhibitor may be used as a combination therapy or adjunct (or add-on) therapy in the treatment of a metabolic disorder such as obesity in a subject.
  • the GLP-1 pathway activator and the myostatin pathway inhibitor may be used as a combination therapy or adjunct (or add-on) therapy or in conjunction with or complementary to in a weight management regimen in a subject.
  • the GLP-1 pathway activator and the myostatin pathway inhibitor may be used as a combination therapy or adjunct (or add-on) therapy or in conjunction with or complementary to, in the treatment of a metabolic disorder to improve body composition in a subject.
  • GLP-1 analogs include albiglutide, taspoglutide, semaglutide, exenatide, BPI- 3016, GW002, glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, XW003, noisyiglutide, MEDI0382, and dulaglutide.
  • the GLP-1 analog is liraglutide, which is currently approved for type 2 diabetes and obesity.
  • Liraglutide (Victoza®, Saxenda®, CAS Number 204656-20-2) is an acylated GLP-1 agonist derived from GLP-1 (7-37). While wild-type GLP-1 has a plasma half-life of 1.5-2 minutes due to degradation by the enzyme dipeptidyl peptidase-4 (DPP-IV) and/or neutral endopeptidases, liraglutide is an acylated form of GLP-1 engineered to bind albumin when administered to a subject, thus greatly extending its half-life compared to GLP-1 (7-37), with a plasma half-life of 13 hours.
  • DPP-IV dipeptidyl peptidase-4
  • liraglutide is an acylated form of GLP-1 engineered to bind albumin when administered to a subject, thus greatly extending its half-life compared to GLP-1 (7-37), with a plasma half-life of 13 hours.
  • Liraglutide is also available in combination with insulin degludec under the name Xultophy®, Semaglutide (Ozempic®, Rybelsus®, Wegovy®, CAS Number 910463-68-2) is a modified GLP-1 peptide comprising two amino acid replacements: 2-aminoisobutyric acid replaces the alanine moiety at position 8 and arginine replaces the lysine moiety at position 34. The substitution at position 8 prevents breakdown by the enzyme DPP-IV. Semaglutide was approved by the USFDA in 2017. See, e.g., Novo Nordisk A/S. Ozempic (semaglutide) injection, for subcutaneous use; prescribing information; 2020.
  • Dulaglutide (Trulicity®, CAS Number 923950-08-7) comprises GLP-1 (7-37) covalently linked to an Fc fragment of human lgG4. Dulaglutide is approved for adults with type 2 diabetes mellitus (combined with diet and exercise). See, e.g., Meece J., Adv Ther. 2017;34:638-657.
  • Exenatide (Byetta®, Bydureon®, CAS Number 141758-74-9) is a synthetic form of the GLP-1 mimetic exendin-4 (a Gila monster saliva hormone) approved by the USFDA in 2005 for treatment of diabetes mellitus type 2 combined with diet and exercise.
  • Glutazumab is an antibody fusion protein engineered by linking the human GLP-1 derivative to a humanized GLP-1 R antibody via a peptide linker. Li et al . , Biochem Pharmacol. 2018 Apr;150:46-53.
  • Lixisenatide (Lyxumia®, Adlyxin®, CAS Number 320367-13-3) is a GLP-1 mimetic approved for treatment of diabetes mellitus type 2 in conjunction with diet and exercise. See, e.g., Sanofi-Aventis US. Adlyxin (lixisenatide), prescribing information, 2016. Lixisenatide is also available in combination with insulin glargine under the name Soliqua®/Suliqua®.
  • Everestmab is a long-acting GLP-1/anti-GLP1 R fusion protein comprising a mutated GLP-1 (A8G) fused to tandem bispecific humanized GLP-1 R targeting and albumin-binding nanobodies designed for treatment of diabetes mellitus type 2.
  • A8G mutated GLP-1
  • Albiglutide (Eperzan®, Tanzeum®, CAS Number 782500-75-8) is a GLP-1 R agonist that was approved for type 2 diabetes mellitus. Its manufacture was discontinued in 2018 due to lack of sales. See, e.g., GlaxoSmithKline LLC. Tanzeum® (albiglutide) for injection, for subcutaneous use prescribing information; 2017.
  • Taspoglutide is a GLP-1 R agonist that was previously under clinical investigation for treatment of diabetes mellitus type 2.
  • Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide, GIP and GLP-1 receptor agonist that is under clinical investigation for the treatment of type 2 diabetes. It was made by engineering GLP-1 activity into the GIP sequence and has been shown to improve glycemic control and to reduce body weight (Rosenstock et al., Lancet (2020) 398:143-155).
  • BP3016 is a long-acting hGLP-1 analog comprising human GLP-1 (7-37) with engineered resistance to DPP- IV cleavage. See, e.g., Pharmacol Res. 2017 Aug;122:130-139.
  • XW003 is an acylated human glucagon-like peptide-1 (GLP-1) analog that has been shown to induce dose- dependent weight reductions in early clinical trials.
  • the drug is currently in phase 2 stage of development for the treatment of obesity. See, e.g., ClinicalTrials.gov identifier NCT05111912.
  • noisyiglutide is a 40-mer exenatide analog, which acts as a glucagon-like peptide-1 (GLP-1) agonist.
  • GLP-1 glucagon-like peptide-1
  • the drug is being developed by Jiangsu Hansoh Pharmaceutical for the treatment of obesity. It is currently in phase 2 clinical development. See, e.g., Cabri et al. Front Mol Biosci. 2021 ; 8: 697586.
  • MEDI0382 is an oxyntomodulin-like peptide with targeted GLP-1 and glucagon receptor activity. It is currently in phase 2 stage of clinical development for the treatment of obesity. See, e.g., Ambery et al. Lancet. 2018 Jun 30;391 (10140):2607-2618.
  • GLP-1 pathway activators include danuglipron (Pfizer), GLP-1 receptor agonist/GIP receptor antagonist combination such as AMG 133 (Amgen), mas receptor activators, e.g., Sarconeos, GLP-1/GIP combination such as tirzepatide (Eli Lilly), amylin/GLP-1 combination such as cagrilintide/semaglutide combination (Novo Nordisk), GLP-1/glucagon combination such as DD01 (Neuraly), GLP-1/glucagon combination such as ALT-801 (Altimmune), GLP-1/GIP such as CT-388 (Carmot), GLP-1/glucagon dual agonist such as IBI362 (mazdutide) (LY-330567 (Innovent/Eli Lilly), danuglipron (PF-06882961) (Pfizer), setmelanotide (Rhythm), GLP- 1/GIP/Glucagon triple receptor agonist such as LY34
  • GLP-1 pathway activators further encompass agents that act on multiple pathways, including the GLP-1 pathway, such as metformin and derivatives thereof. Rena et al., Diabetologia 60:1577-85 (2017).
  • metaformin include Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor.
  • GLP-1 pathway activators also include metformin-containing medications that include additional active agents. Examples include, but are not limited to, thiazolidinediones (glitazones) and rosiglitazone.
  • the GLP-1 pathway activator is FGF-2 or a peptide derived therefrom
  • Myostatin also known as GDF8 (or GDF-8), is a member of the TQRb superfamily and belongs to a subfamily including two members: myostatin and GDF11 . Like other members of the TQRb superfamily, myostatin and GDF11 are both initially expressed as inactive precursor polypeptides (termed pro-myostatin and proGDF11 , respectively). In the overall structure of pro-myostatin, the mature growth factor is held locked in a cage comprised of two alpha helices connected by a loop termed the “latency lasso”. Human myostatin corresponds to UniProt Accession No. 014793; murine myostatin corresponds to UniProt Accession No. 008689.
  • Myostatin is a well-characterized negative regulator of skeletal muscle mass that is released from an autoinhibitory N-terminal prodomain by two separate protease cleavage steps. These cleavage events, within the muscle fiber microenvironment, for example, may be referred to as supracellular activation. Following activation, mature myostatin signals by binding to a complex of Type I and II cell surface receptors (Alk4/5 and ActRIIB) whose downstream signaling induces muscle breakdown and atrophy. There has long been interest in myostatin as a potential target for the treatment of muscle wasting; however, almost all clinical programs have failed and discontinued to date, casting doubt as to its potential.
  • Type I and II cell surface receptors Alk4/5 and ActRIIB
  • the present disclosure includes the use of any agents that inhibit or suppress the myostatin signaling pathway, used in conjunction with activators of the GLP-1 signaling pathway as described herein.
  • Activation and release of mature myostatin is accomplished by several discrete protease cleavage events.
  • the first cleavage step of pro-myostatin and proGDF11 is carried out by a proprotein convertase, which cuts at a conserved RXXR site between the prodomain and mature growth factor. This cleavage produces a “latent- myostatin,” in which the mature myostatin is shielded from binding to its receptors by the prodomain.
  • Activation and release of the mature, active myostatin growth factor is accomplished after cleavage of latent-myostatin by an additional protease from the BMP/tolloid family, such as mTLL-2.
  • additional protease from the BMP/tolloid family, such as mTLL-2.
  • mature myostatin can refer to both full-length mature myostatin, as well as fragments of the full-length mature myostatin which retain biological activity.
  • pro-myostatin also known as “proGDF8,” refers to an inactive precursor of mature myostatin which comprises a disulfide-linked homodimer, each molecule of the homodimer comprising the amino terminal prodomain covalently bound to the carboxyl terminal mature myostatin domain.
  • pro- myostatin has not been cleaved by either a proprotein convertase, or a protease from the BMP/tolloid family.
  • Exemplary pro-myostatin sequences, variants thereof, and methods of generating pro-myostatin are well known in the art and described in more detail herein.
  • latent-myostatin refers to an inactive precursor of mature myostatin which comprises a disulfide-linked homodimer, each molecule of the homodimer comprising the amino terminal prodomain non-covalently bound to the carboxyl terminal mature myostatin domain.
  • “latent- myostatin” is generated from a pro-myostatin that has been cleaved by a proprotein convertase, but which has not been cleaved by a protease from the BMP/tolloid family.
  • latent-myostatin can be generated by combining the prodomain and the carboxy terminal mature myostatin domain in vitro and allowing them to fold properly. See, for example, Sengle et al. , J. Biol. Chem., 286(7):5087-5099, 2011. Exemplary latent- myostatin sequences, variants thereof, and methods of generating latent-myostatin are well known in the art and described in more detail herein.
  • proGDF8 human
  • proGDF8 (mouse):
  • proGDF8 (cynomolgus):
  • proGDF8 sequences in the human, rat, mouse and cynomolgus are provided above.
  • a proprotein convertase cleavage site is indicated in bold and a tolloid protease site is indicated by underlining.
  • the proprotein convertase cleavage site comprises amino acid residues 240 to 243 of SEQ ID NOs: 52-55.
  • the tolloid protease site comprises amino acid residues 74-75 of SEQ ID NOs: 52-55.
  • the exemplary proGDF8 sequences provided herein are not intended to be limiting and additional proGDF8 sequences from other species, including any isoforms thereof, are within the scope of this disclosure.
  • the prodomain of the myostatin polypeptide is comprised of several structural domains as described previously (WO 2014/182676). These include, for example, Straight Jacket region, Fastner region, Arm region, Fingers region 1 , Fingers region 2, Latency Loop, Alpha-1 Helical region, and Bowtie region.
  • preferred antibodies or fragments thereof bind an epitope within the Arm region of the myostatin prodomain.
  • the epitope includes at least one amino acid residue from the “KALDEN” (SEQ ID NO: 118) polypeptide stretch within the Arm region of the prodomain.
  • the amino acid residue within the Arm region of the prodomain making contact with the antibody when bound to the antigen is a residue that is not conserved between myostatin and GDF11 .
  • such residue(s) is/are K, E, and/or N of the polypeptide stretch (shown in bold type above).
  • the epitope includes at least one amino acid residue from the “FVQILRLIKPMKDGTRYTGIRSLK” (SEQ ID NO: 57) polypeptide stretch within the Arm region of the prodomain.
  • such residue(s) is/are F, Q, L, Y, R, S and/or K of the polypeptide stretch (shown in bold type above).
  • an antibody or antigen-binding fragment thereof that binds such epitope is apitegromab or a variant thereof, wherein optionally the variant is an Fc variant. In other embodiments, an antibody or antigen-binding fragment thereof that binds such epitope is not apitegromab or its variant.
  • myostatin pathway inhibitors such as small molecules, antibodies, or antigen-binding portions thereof, and gene therapies, in various stages of clinical development towards the treatment of muscle- related conditions.
  • Such inhibitors of the signaling pathway target either the mature growth factor or its type II receptor.
  • most of these antagonists are not myostatin-specific, such that they antagonize the signaling of multiple TQBb family members.
  • Activin A, GDF11 , and BMPs 9 and 10 which are regulators of reproductive biology, wound healing, erythropoiesis and blood vessel formation, respectively.
  • myostatin pathway inhibitors such as anti-myostatin antibodies, or antigen binding fragments thereof, bind, e.g., selectively bind, to pro-myostatin and/or latent myostatin, thereby inhibiting myostatin activation
  • myostatin pathway inhibitors such as anti-myostatin antibodies, or antigen binding fragments thereof, bind, e.g., selectively bind, to pro-myostatin and/or latent myostatin, thereby inhibiting myostatin activation
  • treatments are provided herein that specifically target more abundant and longer-lived myostatin precursors e.g., pro-myostatin and latent myostatin, rather than the mature growth factor.
  • myostatin inhibitors such as antibodies, or antigen binding fragments thereof, provided herein may prevent the proteolytic activation of pro-myostatin and/or latent myostatin into mature myostatin which is considered the “active” form of myostatin, capable of activating the myostatin pathway, e.g., by binding Type I (ALK4/5) and Type II (ACTRIIA/B) receptors.
  • the myostatin pathway inhibitor is a myostatin inhibitor.
  • myostatin inhibitors used herein may be an antibody (including fragments thereof, such as Domain Antibodies (dAbs) as described in, for example, U.S. Patent 6,291 ,158; 6,582,915; 6,593,081 ; 6,172,197; and 6,696,245), a small molecule inhibitor, an Adnectin, an Affibody, a DARPin, an Anticalin, an Avimer, a Versabody or a gene therapy.
  • dAbs Domain Antibodies
  • the myostatin pathway inhibitor is a non-selective myostatin inhibitor, e.g., an inhibitor that also inhibits Activin A and/or GDF11 .
  • the non-selective myostatin inhibitor is a ligand trap (e.g., ACE-031 , ACE-083, and BIIB-110/ALG-801); an anti-ActRllb antibody (e.g., bimagrumab); a neutralizing antibody that binds mature myostatin (e.g., stamulumab (MYO-029), domagrozumab (PF-06252616), landogrozumab (LY2495655), AMG-745/PINTA-745 (Myostatin peptibody), RG6206 (an antimyostatin adnectin, which is a single-strand fusion protein containing domains of fibronectin), BMS-986089 (an
  • the myostatin pathway inhibitor comprises stamulumab, trevogrumab, LY2495655, AMG 745, bimagrumab, BIIB-110, domagrozumab (PF-06252616), apitegromab, GYM329, taldefgrobep alfa (also known as BMS-986089), or efmitermant alfa.
  • the myostatin pathway inhibitor comprises a pH-dependent anti-latent myostatin antibody, such as GYM329 or another MST1032 variant as disclosed in International Publication No. WO2016/098357, herein incorporated by reference.
  • the myostatin pathway inhibitor comprises a MST1032 variant as disclosed in International Patent Application No. PCT/JP2015/006323, the content of which is hereby incorporated in its entirety.
  • the myostatin pathway inhibitor comprises an antibody or antigen-binding fragment comprising additional sequences found in, e.g., in International Patent Publication Nos. WO 2018/129395; WO 2017/218592; WO 2017/120523; WO 2017/049011 ; WO 2016073853; or WO 2014182676, the contents of which are hereby incorporated by reference in their entirety.
  • a “MST1032 variant”, as used herein, refers to an antibody or antigen-binding fragment comprising any of the sequences disclosed in PCT/JP2015/006323, including but not limited to sequences of MS1032L001-SG1 , MS1032L006-SG1 , MS1032LO11-SG1 , MS1032LO18-SG1 , MS1032LO19-SG1 , MS1032LO21-SG1 ,
  • a MST1032 variant comprises an antibody or antigen-binding fragment comprising a heavy chain variable domain comprising three CDR sequences of HCDR1 , HCDR2, and HCDR3, and a light chain variable domain comprising three CDR sequences of LCDR1 , LCDR2, and LCDR3, wherein the heavy chain CDRs comprise the amino acid sequences of: X1X2DIS (HCDR1 ; SEQ ID NO: 17);
  • HCDR2 I ISYAGSTYYASWAKG (HCDR2; SEQ ID NO: 18); GVPAYSX3GGDL (HCDR3; SEQ ID NO: 19), respectively; and the light chain CDRs comprise amino acid sequences of: X4X5SQSVYX6X7NWLS (LCDR1 ; SEQ ID NO: 20); WASTLAX8 (LCDR2; SEQ ID NO: 21); and AGGYGGGX9YA (LCDR3; SEQ ID NO: 22), respectively, wherein each of X1-X9 is any amino acid residue.
  • a MST1032 variant comprises the six CDR sequences of SEQ ID NOs: 18, 66, 67, 68-70; SEQ ID Nos: 119, 18, 120, 68, 121 , 122; or SEQ ID Nos: 123, 18, 120, 124, 121 , 122.
  • a MST1032 variant comprises a heavy chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 125-128. In certain embodiments, a MST1032 variant comprises a light chain variable domain comprising the amino acid sequence of any one of SEQ ID NOs: 129, 126, 127 and 130. In certain embodiments, a MST1032 variant comprises a set of six CDRs (e.g., from the same MST1032 variant antibody) ora paired VH/VL (e.g., from the same MST1032 variant antibody) from those listed in the tables below.
  • a myostatin antibody or antigen binding fragment thereof may include or may be engineered to include a mutation or modification that causes an extended half-life of the antibody.
  • mutations or modifications may be within the Fc domain of the antibodies (e.g., Fc-modified antibodies), e.g., to promote circulating half life or other PK properties.
  • the mutation is the YTE mutation (see, e.g., Saunders, KO (2019) “Conceptual Approaches to Modulating Antibody Effector Functions and Circulation Half-Life,” Frontiers in Immunology 10:1296 and U.S. Patent No. 7,083,784, each of which is herein incorporated by reference).
  • an anti-pro/latent myostatin antibody, or antigen binding fragment thereof binds specifically to latent myostatin. In some embodiments, an anti-pro/latent myostatin antibody, or antigen binding fragment thereof, binds specifically to both latent myostatin and pro-myostatin. In preferred embodiments, the anti- pro/latent myostatin antibody, or antigen binding fragment thereof, that binds specifically to pro-myostatin and/or latent myostatin does not bind mature myostatin.
  • the anti-pro/latent myostatin antibody, or antigen binding fragment thereof, that binds specifically to pro-myostatin and/or latent myostatin does not bind pro/latent GDF11 or mature GDF11 .
  • antibodies, or antigen binding fragments thereof, described herein are capable of binding to a pro/latent-myostatin, thereby inhibiting the proteolytic activation of pro/latent-myostatin into mature myostatin.
  • antibodies, or antigen binding fragments thereof, described herein can inhibit the proteolytic activation of pro/latent-myostatin by at least 20%, e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or higher.
  • antibodies described herein can inhibit the proteolytic cleavage of pro-myostatin by a proprotein convertase (e.g., furin) by at least 20%, e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or higher.
  • a proprotein convertase e.g., furin
  • antibodies, or antigen binding fragments thereof, described herein can inhibit the proteolytic cleavage of pro-myostatin or latent myostatin by a tolloid protease (e.g., mTLL2) by at least 20%, e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or higher.
  • antibodies, or antigen binding fragments thereof, described herein are capable of binding to a pro/latent-myostatin, thereby inhibiting myostatin activity.
  • the antibodies, or antigen binding fragments thereof, described herein can inhibit myostatin signaling by at least 20%, e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or higher.
  • inhibition of myostatin signaling can be measured by routine methods, for example, using a myostatin activation assay as described in Example 1 disclosed in WO 2016/073853, the entire contents of which are expressly incorporated herein by reference.
  • additional methods may be used for measuring myostatin signaling activity.
  • the extent of proteolytic cleavage of myostatin can be measured and/or quantified using any suitable method.
  • the extent of proteolytic cleavage of myostatin is measured and/or quantified using an enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • an ELISA may be used to measure the level of released growth factor (e.g., mature myostatin).
  • an antibody, or antigen binding fragment thereof, that specifically binds to pro-myostatin, latent myostatin and/or mature myostatin can be used in an ELISA to measure the level of a specific form of myostatin (e.g., pro/latent/mature-myostatin), to quantify the extent of proteolytic cleavage of myostatin.
  • a specific form of myostatin e.g., pro/latent/mature-myostatin
  • the extent of proteolytic cleavage of myostatin is measured and/or quantified using immunoprecipitation followed by SDS-PAGE or mass spectrometry of tryptic peptides, fluorescence anisotropy-based techniques, FRET assays, hydrogen-deuterium-exchange mass spectrometry, and/or NMR spectroscopy.
  • Anti-pro/latent-myostatin antibodies, or antigen binding fragments thereof, suitable for use in the methods of the present invention include those described in International Patent Application Nos. PCT/US 15/59468 and PCT/US16/52014. The entire contents of each of the foregoing applications are incorporated herein by reference in their entireties.
  • an antibody or antigen-binding fragment that binds human pro/latent myostatin may be used to carry out various embodiments disclosed herein.
  • such antibody and antigen-binding fragment binds an epitope within the prodomain, wherein the epitope comprises one or more amino acid residues F147, Q149, L151 , Y186, S168, K170, K205, and/or L207, as numbered according to SEQ ID NO: 52 (Dagbay et al. J Biol Chem. 2020 Apr 17;295(16) :5404-5418) .
  • anti-pro/latent-myostatin antibodies, or antigen binding fragments thereof, of the present disclosure and the nucleic acid molecules of the present disclosure that encode the antibodies, or antigen binding fragments thereof include the CDR amino acid sequences shown in Tables 1G-1 to 1G-3.
  • anti-pro/latent-myostatin antibody, or antigen-binding portion thereof, of the disclosure include any antibody, or antigen binding fragment thereof, that includes a CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3, or combinations thereof, as provided for any one of the antibodies shown in Tables 1 G-1 to 1 G-3.
  • anti-pro/latent-myostatin antibodies, or antigen-binding portions thereof comprise the CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, and CDRL3 of any one of the antibodies shown in Tables 1 G-1 to 1 G-3.
  • the disclosure also includes any nucleic acid sequence that encodes a molecule comprising a CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, or CDRL3 as provided for any one of the antibodies shown in Tables 1 G-1 to 1 G-3.
  • Antibody heavy and light chain CDR3 domains may play a particularly important role in the binding specificity/affinity of an antibody for an antigen.
  • the anti-pro/latent myostatin antibodies, or antigenbinding portions thereof, of the disclosure, or the nucleic acid molecules thereof may include at least the heavy and/or light chain CDR3s of antibodies as shown in Tables 1 G-1 to 1 G-3.
  • aspects of the disclosure relate to a monoclonal antibody, or antigen binding fragment, that binds to pro/latent-myostatin protein and that comprises six complementarity determining regions (CDRs): CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, and CDRL3.
  • CDRs complementarity determining regions
  • CDRH1 comprises a sequence as set forth in any one of SEQ ID NOs: 1-3.
  • CDRH2 comprises a sequence as set forth in any one of SEQ ID NOs: 4-9.
  • CDRH3 comprises a sequence as set forth in any one of SEQ ID NOs: 10-11 , 66, 71 , 76, 81 , 86, 91 , 96, 101 , 106 and 111.
  • CDRL1 comprises a sequence as set forth in any one of SEQ ID NOs: 12-16 and 59.
  • CDRL2 comprises a sequence as set forth in any one of SEQ ID NOs: 60, 61 , 131 and 64.
  • CDRL3 comprises a sequence as set forth in any one of SEQ ID NOs: 65, 23, 67, 72, 77, 82, 87, 92, 97, 102, 107 and 112.
  • CDRH1 comprises a sequence as set forth in SEQ ID NO: 1 or 2
  • CDRH2 comprises a sequence as set forth in SEQ ID NO: 4 or 5
  • CDRH3 comprises a sequence as set forth in SEQ ID NO: 10
  • CDRL1 comprises a sequence as set forth in SEQ ID NO: 12
  • CDRL2 comprises a sequence as set forth in SEQ ID NO: 60 or 61
  • CDRL3 comprises a sequence as set forth in SEQ ID NO: 65, and the antibody, or an antigenbinding portion thereof, binds to pro/latent-myostatin.
  • CDRH1 comprises a sequence as set forth in SEQ ID NO: 1 or 2
  • CDRH2 comprises a sequence as set forth in SEQ ID NO: 4 or 5
  • CDRH3 comprises a sequence as set forth in SEQ ID NO: 66
  • CDRL1 comprises a sequence as set forth in SEQ ID NO: 12 or 13
  • CDRL2 comprises a sequence as set forth in SEQ ID NO: 60 or 61
  • CDRL3 comprises a sequence as set forth in SEQ ID NO: 67
  • the antibody, or an antigenbinding portion thereof binds to pro/latent-myostatin.
  • CDRH1 comprises a sequence as set forth in SEQ ID NO: 1 or 3
  • CDRH2 comprises a sequence as set forth in SEQ ID NO: 6 or 7
  • CDRH3 comprises a sequence as set forth in SEQ ID NO: 11
  • CDRL1 comprises a sequence as set forth in SEQ ID NO: 14, or 15
  • CDRL2 comprises a sequence as set forth in SEQ ID NO: 131 or 64
  • CDRL3 comprises a sequence as set forth in SEQ ID NO: 23, and the antibody, or an antigenbinding portion thereof, binds to pro/latent-myostatin.
  • CDRH1 comprises a sequence as set forth in SEQ ID NO: 1 or 3
  • CDRH2 comprises a sequence as set forth in SEQ ID NO: 8 or 9
  • CDRH3 comprises a sequence as set forth in SEQ ID NO: 11
  • CDRL1 comprises a sequence as set forth in SEQ ID NO: 16, or 59
  • CDRL2 comprises a sequence as set forth in SEQ ID NO: 131 or 64
  • CDRL3 comprises a sequence as set forth in SEQ ID NO: 23, and the antibody, or an antigenbinding portion thereof, binds to pro/latent-myostatin.
  • any of the anti-pro/latent-myostatin antibodies, or antigen-binding portions thereof, of the disclosure include any antibody or antigen binding fragment having one or more CDR (e.g., CDRH or CDRL) sequences substantially similar to CDRH1 , CDRH2, CDRH3, CDRL1 , CDRL2, and/or CDRL3.
  • CDR e.g., CDRH or CDRL
  • the antibodies may include one or more CDR sequences as shown in Tables 1A to 1G-3 (SEQ ID NOs: 1-16, 18, 23, 59-61 , 64-72, 76, 77, 81 , 82, 86, 87, 91 , 92, 96, 97, 101 , 102, 106, 107, 111 , 112, and 119-124) containing up to 5, 4, 3, 2, or 1 amino acid residue variations as compared to the corresponding CDR region in any one of the SEQ ID NOs: shown in Tables 1A to 1 G3 (1-16, 18, 23, 59-61 , 64-72, 76, 77, 81 , 82, 86, 87, 91 , 92, 96, 97, 101 , 102, 106, 107, 111 , 112, and 119-124).
  • Tables 1A to 1G-3 SEQ ID NOs: 1-16, 18, 23, 59-61 , 64-72, 76, 77, 81
  • an anti-pro/latent myostatin antibody or antigen-binding portion thereof described herein comprises three heavy chain complementarity determining regions (HCDRs) comprising amino acid sequences of SEQ ID NO: 1 (HCDR1), SEQ ID NO: 4 (HCDR2), and SEQ ID NO: 10 (HCDR3); and three light chain complementarity determining regions (LCDRs) comprising amino acid sequences of SEQ ID NO: 12 (LCDR1), SEQ ID NO: 60 (LCDR2), and SEQ ID NO: 65 (LCDR3), as defined by the Kabat numbering system.
  • HCDRs heavy chain complementarity determining regions
  • LCDRs light chain complementarity determining regions
  • an anti-pro/latent myostatin antibody or antigen-binding portion thereof described herein comprises three heavy chain complementarity determining regions (HCDRs) comprising amino acid sequences of SEQ ID NO: 2 (HCDR1), SEQ ID NO: 5 (HCDR2), and SEQ ID NO: 10 (HCDR3); and three light chain complementarity determining regions (LCDRs) comprising amino acid sequences of SEQ ID NO: 13 (LCDR1), SEQ ID NO: 61 (LCDR2), and SEQ ID NO: 65 (LCDR3), as defined by the IMGT numbering system.
  • HCDRs heavy chain complementarity determining regions
  • LCDRs light chain complementarity determining regions
  • the anti-pro/latent myostatin antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 25, and/or a light chain variable region comprising an amino acid sequence of SEQ ID NO: 31 .
  • the anti-pro/latent myostatin antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence of SEQ ID NO: 50, and/or a light chain region comprising an amino acid sequence of SEQ ID NO: 51 .
  • anti-pro/latent-myostatin antibodies, or antigen-binding portions thereof, of the disclosure include any antibody that includes a heavy chain variable domain of any one of SEQ ID NOs: 24-29, 73,
  • anti-pro/latent-myostatin antibodies, or antigen-binding portions thereof, of the disclosure include any antibody that includes the heavy chain variable and light chain variable pairs of SEQ ID NOs: 24 and 30; 25 and 31 ; 26 and 32; 27 and 33; 28 and 34; 29 and 35; 125 and 129; 126 and 132; 127 and 133; 128 and 130).
  • the anti-pro/latent-myostatin antibody, or antigen-binding portions thereof comprises a heavy chain variable sequence or a light chain variable sequence that is at least 75% (e.g., 80%, 85%, 90%, 95%, 98%, or 99%) identical to the heavy chain variable sequence of any of SEQ ID NOs: 24-29, 73, 78, 83, 88, 93, 98, 103, 108, 113, 125-128 or a light chain variable sequence of any one of SEQ ID NOs: 30- 35, 74, 79, 84, 89, 94, 99, 104, 109, 114, 129-130, 132, 133.
  • the homologous heavy chain variable and/or a light chain variable amino acid sequences do not vary within any of the CDR sequences provided herein.
  • the degree of sequence variation e.g., 75%, 80%, 85%, 90%, 95%, 98%, or 99%
  • Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997.
  • the default parameters of the respective programs e.g., XBLAST and NBLAST.
  • conservative mutations can be introduced into the CDRs or framework sequences at positions where the residues are not likely to be involved in interacting with pro/latent-myostatin as determined based on the crystal structure.
  • a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
  • Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J.
  • Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
  • the antibodies, or antigen binding fragments thereof, provided herein comprise mutations that confer desirable properties to the antibodies, or antigen binding fragments thereof.
  • the antibodies, or antigen binding fragments thereof, provided herein may comprise a stabilizing ‘Adair’ mutation (Angal S., et al., “A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (lgG4) antibody,” Mol Immunol 30, 105-108; 1993), where serine 228 (EU numbering; residue 241 Kabat numbering) is converted to proline resulting in an lgG1 -like (CPPCP (SEQ ID NO: 58)) hinge sequence.
  • any of the antibodies may include a stabilizing ‘Adair’ mutation or the amino acid sequence CPPCP (SEQ ID NO: 58).
  • Anti-pro/latent-myostatin antibodies, or antigen-binding portions thereof, of this disclosure may optionally comprise antibody constant regions or parts thereof.
  • a VL domain may be attached at its C-terminal end to a light chain constant domain like CK or CK.
  • a VH domain or portion thereof may be attached to all or part of a heavy chain like IgA, IgD, IgE, IgG, and IgM, and any isotype subclass.
  • Antibodies may include suitable constant regions (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, No. 91- 3242, National Institutes of Health Publications, Bethesda, Md. (1991)). Therefore, antibodies within the scope of this may disclosure include VH and VL domains, or an antigen binding portion thereof, combined with any suitable constant regions.
  • the VH and/or VL domains may be reverted to germline sequence, e.g., the FR of these domains are mutated using conventional molecular biology techniques to match those produced by the germline cells.
  • the VH and/or VL domains may be reverted to germline sequence of lgHV3-30 (SEQ ID NO: 36) and/or lgLV1-44 (SEQ ID NO: 37), respectively. It should be appreciated that any of the VH and/or VL domains may be reverted to any suitable germline sequence.
  • the FR sequences remain diverged from the consensus germline sequences.
  • anti-pro/latent-myostatin antibodies or antigen binding fragments may or may not include the framework region of the antibodies shown in SEQ ID NOs: 24-35.
  • anti-pro- latent-myostatin antibodies are murine antibodies and include murine framework region sequences.
  • an anti-pro/latent-myostatin antibodies, or antigen binding fragments thereof can bind to pro/latent-myostatin with relatively high affinity, e.g., with a KD less than 10 -8 M, 10 -9 M, 10 1 ° M, 10 11 M or lower.
  • anti-pro/latent-myostatin antibodies, or antigen binding fragments thereof can bind to pro/latent-myostatin with an affinity between 5 pM and 500 nM, e.g., between 50 pM and 100 nM, e.g., between 500 pM and 50 nM.
  • the invention also includes antibodies or antigen binding fragments that compete with any of the antibodies described herein for binding to pro/latent-myostatin and that have an affinity of 50 nM or lower (e.g., 20 nM or lower, 10 nM or lower, 500 pM or lower, 50 pM or lower, or 5 pM or lower).
  • the affinity and binding kinetics of the anti-pro/latent-myostatin antibody can be tested using any suitable method including but not limited to biosensor technology (e.g., OCTET or BIACORE). When such binding profiles are measured with the use of OCTET or BIACORE, the assay is performed typically in accordance with the manufacturer’s instructions, unless otherwise specified.
  • antibodies, or antigen binding fragments thereof are disclosed herein that specifically bind pro/latent-myostatin.
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind at or near a tolloid cleavage site or at or near a tolloid docking site of pro/latent- myostatin.
  • an antibody binds near a tolloid cleavage site or near a tolloid docking site if it binds within 15 or fewer amino acid residues of the tolloid cleavage site or tolloid docking site.
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind within 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acid residues of a tolloid cleavage site or tolloid docking site.
  • an antibody binds at or near a tolloid cleavage site of GDF8.
  • an antibody may bind an amino acid sequence as set forth in SEQ ID NO: 62 PKAPPLRELIDQYDVQRDDSSDGSLEDDDYHAT (SEQ ID NO: 62).
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind at or near a proprotein convertase cleavage site or at or near a proprotein convertase docking site of pro/latent- myostatin.
  • an antibody binds near a proprotein convertase cleavage site or near a proprotein convertase docking site if it binds within 15 or fewer amino acid residues of the proprotein convertase cleavage site or proprotein convertase docking site.
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind within 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acid residues of a proprotein convertase cleavage site or proprotein convertase docking site.
  • an antibody binds at or near a proprotein convertase cleavage site of GDF8.
  • an antibody may bind an amino acid sequence as set forth in SEQ ID NO: 63 (GLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRC).
  • the myostatin-selective inhibitor according to the present disclosure is an antibody or antigen-binding fragment thereof, which is optionally a myostatin-selective inhibitor, that binds an epitope that includes at least one amino acid residue of “KALDEN” (SEQ ID NO: 118) and/or “FVQILRLIKPMKDGTRYTGIRSLK” (SEQ ID NO: 57).
  • the antibody is apitegromab or a variant thereof, wherein optionally the variant is an Fc variant. In some embodiments, the antibody is not apitegromab or its variant.
  • the myostatin-selective inhibitor according to the present disclosure is an antibody or antigen-binding fragment thereof, which is optionally a myostatin-selective inhibitor, that binds an epitope that includes one or more amino acid residues of F147, Q149, L151 , Y163, R167, S168, K170, K205, L207, E209 and N210, based on the numbering of the human proGDF8 sequence as set forth in SEQ ID NO; 52, which correspond to: F170, Q172, L174, Y186, R190, S191 , K193, K228, L230, E232, and N233, respectively, based on the numbering of Dagbay et al.
  • such antibody binds an epitope that includes 10 or more, 9 or more, 8 or more, 7 or more, 6 or more, 5 or more, 4 or more, or 3 or more of the amino acid residues shown above.
  • the antibody is apitegromab or a variant thereof, wherein optionally the variant is an Fc variant. In some embodiments, the antibody is not apitegromab or its variant.
  • the anti-pro/latent-myostatin antibodies, or antigen binding fragments thereof, described herein specifically bind pro/latent-myostatin as compared to other forms of Myostatin and/or other members of the TQBb family of growth factors.
  • TQBb family of growth factors include, without limitation AMH, ARTN, BMP10, BMP15, BMP2, BMP3, BMP4, BMP5, BMP6, BMP7, BMP8A, BMP8B, GDF1 , GDF10, GDF11 , GDF15, GDF2, GDF3, GDF3A, GDF5, GDF6, GDF7, GDF8, GDF9, GDNF, INHA, INHBA, INHBB, INHBC, INHBE, LEFTY1 , LEFTY2, NODAL, NRTN, PSPN, TQBbI , TOBb2, and TQBb3 protein.
  • Such antibodies, or antigen binding fragments thereof may bind pro/latent-myostatin at a much higher affinity as compared to other members of the TQBb family of growth factors (e.g., at least 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, or 1 ,000-fold higher).
  • such antibodies, or antigen binding fragments thereof may bind pro/latent-myostatin with an affinity of at least 1000-fold higher as compared to other members of the TQBb family of growth factors.
  • antibodies, or antigen binding fragments thereof, provided herein may bind to pro/latent-myostatin at a much higher affinity as compared to one or more forms of GDF11 or mature myostatin (e.g., at least 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, or 1 ,000-fold higher).
  • antibodies, or antigen binding fragments thereof, provided herein may bind to pro/latent-myostatin with an affinity of at least 1 ,000-fold higher as compared to one or more forms of GDF11 (e.g., proGDF11 , latent GDF11 or mature GDF11) or mature myostatin.
  • antibodies, or antigen binding fragments thereof may exhibit a much higher inhibitory activity against proteolytic cleavage of pro/latent-myostatin (e.g., by a proprotein convertase or tolloid protease) as compared with other members of the TQBb family, such as pro/latent GDF11 (e.g., at least 2-fold, 5-fold, 10-fold, 50-fold, 100-fold, 200-fold, 500-fold, 1 ,000-fold higher).
  • the antibodies, or antigen binding fragments thereof, disclosed herein do not bind to GDF11 . This avoids potential toxicity issues associated with antibodies that cross-react with both myostatin and GDF11 . An example of one such potential toxicity relates to impaired bone strength associated with GDF11 inhibition as recently reported in Suh et al. Proceedings of the National Academy of Sciences Mar 2020, 117 (9) 4910-4920, the content of which is hereby incorporated in its entirety.
  • antibodies bind an antigen but cannot effectively eliminate the antigen from the plasma.
  • the concentration of the antigen in the plasma may be increased by reducing the clearance of the antigen.
  • antibodies e.g., sweeping antibodies provided herein have an affinity to an antigen that is sensitive to pH. Such pH sensitive antibodies may bind to the antigen in plasma at neutral pH and dissociate from the antigen in an acidic endosome, thus reducing antibody-mediated antigen accumulation and/or promoting antigen clearance from the plasma.
  • sweeping antibodies or antigenbinding fragments thereof refer to antibodies, or antigen-binding fragments thereof, having both pH-sensitive antigen binding and at least a threshold level of binding to cell surface neonatal Fc receptor (FcRn) at neutral or physiological pH.
  • sweeping antibodies, or an antigen-binding portion thereof bind to the neonatal Fc receptor FcRn at neutral pH.
  • sweeping antibodies may bind to the FcRn at a pH ranging from 7.0 to 7.6.
  • sweeping antibodies, or an antigen-binding portion thereof can bind to an antigen at an antigen binding site and bind to a cellular FcRn via an Fc portion of the antibody. In some embodiments, sweeping antibodies, or an antigen-binding portion thereof, may then be internalized, releasing antigen in an acidic endosome, which may be degraded. In some embodiments, a sweeping antibody, or an antigen-binding portion thereof, no longer bound to the antigen, may then be released (e.g., by exocytosis) by the cell back into the serum.
  • FcRn in the vascular endothelia extends the half-life of a sweeping antibody, or an antigen-binding portion thereof.
  • vascular endothelial cells internalize sweeping antibodies, or antigen-binding portions thereof, which in some embodiments are bound to an antigen such as myostatin (e.g., pro-myostatin, latent myostatin or primed myostatin).
  • myostatin e.g., pro-myostatin, latent myostatin or primed myostatin.
  • a sweeping antibody, or an antigen-binding portion thereof is recycled back into the bloodstream.
  • a sweeping antibody, or an antigen-binding portion thereof has an increased half-life (e.g., in the serum of a subject) as compared to its conventional counterpart.
  • a conventional counterpart of a sweeping antibody refers the antibody, or an antigen-binding portion thereof, from which the sweeping antibody, or an antigen-binding portion thereof, was derived (e.g., prior to engineering the Fc portion of the conventional antibody to bind FcRn with greater affinity at pH 7).
  • a sweeping antibody, or an antigen-binding portion thereof has a half-life in the serum of a subject that is at least 1 %, 5%, 10%, 15%, 20%, 25%, 35%, 50%, 75%, 100%, 150%, 200% or 250% longer as compared to its conventional counterpart.
  • an Fc portion of a sweeping antibody binds FcRn.
  • the Fc portion of a sweeping antibody binds to FcRn at a pH of 7.4 with a KD ranging from 10 3 M to 10 8 M.
  • a sweeping antibody binds to FcRn at a pH of 7.4 with a KD ranging from 10 -3 M to 10 7 M, from 10 3 M to 10 6 M, from 10 3 M to 10 5 M, from 10 3 M to 10 4 M, from 10 4 M to 10 8 M, from 10 4 M to 10 7 M, from 10 4 M to 10 6 M, from 10 4 M to 10 5 M, from 10 5 M to 10 8 M, from 10 5 M to 10 7 M, from 10 5 M to 10 6 M, from 10 6 M to 10 8 M, from 10 -6 M to 10 7 M, or from 10 7 M to 10 8 M.
  • FcRn binds to the CH2-CH3 hinge region of a sweeping antibody.
  • FcRn binds to the same region as protein A or protein G. In some embodiments, FcRn binds to a different binding site from FcyRs. In some embodiments, the amino acid residues AA of a sweeping antibody Fc region are required for binding to FcRn. In some embodiments, the amino acid residues AA of a sweeping antibody Fc region affect binding to FcRn.
  • any of the antibodies, or antigen binding fragments thereof, provided herein are engineered to bind FcRn with greater affinity. In some embodiments, any of the antibodies, or antigen binding fragments thereof, provided herein are engineered to bind FcRn with greater affinity at pH 7.4. In some embodiments, the affinity of antibodies, or antigen binding fragments thereof, to FcRn is increased to extend their pharmacokinetic (PK) properties as compared to their conventional counterparts. For example, in some embodiments, sweeping antibodies elicit less adverse reactions due to their efficacy at lower doses. In some embodiments, sweeping antibodies, or an antigen-binding portion thereof, are administered less frequently.
  • PK pharmacokinetic
  • transcytosis of sweeping antibodies, or an antigen-binding portion thereof, to certain tissue types are increased.
  • sweeping antibodies, or antigen-binding portions thereof enhance efficiency of trans-placental delivery.
  • sweeping antibodies, or antigen-binding portions thereof are less costly to produce.
  • any of the antibodies, or antigen binding fragments thereof, provided herein are engineered to bind FcRn with lower affinity.
  • any of the antibodies, or antigen binding fragments thereof, provided herein are engineered to bind FcRn with lower affinity at pH 7.4.
  • the affinity of sweeping antibodies, or an antigen-binding portion thereof, to FcRn is decreased to shorten their pharmacokinetic (PK) properties as compared to their conventional counterparts.
  • sweeping antibodies, or an antigen-binding portion thereof are more rapidly cleared for imaging and/or radioimmunotherapy.
  • sweeping antibodies, or an antigen-binding portion thereof promote clearance of endogenous pathogenic antibodies as a treatment for autoimmune diseases. In some embodiments, sweeping antibodies, or antigen-binding portions thereof, reduce the risk of adverse pregnancy outcome, which may be caused by trans-placental transport of material fetus-specific antibodies.
  • sweeping antibodies, or an antigen-binding portion thereof have decreased affinity to an antigen at low pH as compared to a neutral or physiological pH (e.g., pH 7.4). In some embodiments, sweeping antibodies, or an antigen-binding portion thereof, have a decreased affinity to an antigen at an acidic pH (e.g., a pH ranging from 5.5 to 6.5) as compared to a physiological pH (e.g., pH 7.4).
  • an acidic pH e.g., a pH ranging from 5.5 to 6.5
  • a physiological pH e.g., pH 7.4
  • any of the antibodies, or antigen binding fragments thereof, provided herein can be engineered to dissociate from the antigen depending on changes in pH (e.g., pH-sensitive antibodies).
  • sweeping antibodies, or an antigen-binding portion thereof, provided herein are engineered to bind antigen in a pH-dependent manner.
  • sweeping antibodies, or an antigen-binding portion thereof, provided herein are engineered to bind FcRn in a pH-dependent manner.
  • sweeping antibodies, or an antigen-binding portion thereof, provided herein are internalized by endocytosis.
  • sweeping antibodies, or an antigen-binding portion thereof, provided here are internalized by FcRn binding.
  • endocytosed sweeping antibodies, or antigen-binding portion thereof release antigen in an endosome.
  • sweeping antibodies, or antigen-binding portions thereof are recycled back to the cell surface.
  • sweeping antibodies remain attached to cells.
  • endocytosed sweeping antibodies, or an antigen-binding portion thereof are recycled back to the plasma. It should be appreciated that the Fc portion of any of the antibodies, or antigen binding fragments thereof, provided herein may be engineered to have different FcRn binding activity.
  • FcRn binding activity affects the clearance time of an antigen by a sweeping antibody.
  • sweeping antibodies may be long-acting or rapid-acting sweeping antibodies.
  • converting a conventional therapeutic antibody, or an antigen-binding portion thereof, into a sweeping antibody, or an antigen-binding portion thereof reduces the efficacious dose.
  • converting a conventional therapeutic antibody, or an antigen-binding portion thereof, into a sweeping antibody, or an antigen-binding portion thereof reduces the efficacious dose by at least 1 %, 2%, 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99%.
  • converting a conventional therapeutic antibody, or an antigen-binding portion thereof, into a sweeping antibody, or an antigen-binding portion thereof reduces the efficacious dose by at least 1 .5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 8-fold, 10-fold, 15-fold, 20-fold, 50-fold or 100-fold.
  • selecting an appropriate dose of a sweeping antibody, or an antigen-binding portion thereof, for therapy may be performed empirically.
  • a high dose of a sweeping antibody, or an antigen-binding portion thereof may saturate FcRn, resulting in antibodies which stabilize antigen in serum without being internalized.
  • a low dose of a sweeping antibody, or an antigen-binding portion thereof may not be therapeutically effective.
  • sweeping antibodies, or antigen-binding portions thereof are administered once a day, once a week, once every two weeks, once every three weeks, once every four weeks, once every 6 weeks, once every 8 weeks, once every 10 weeks, once every 12 weeks, once every 16 weeks, once every 20 weeks, or once every 24 weeks.
  • any of the antibodies, or antigen binding fragments thereof, provided herein may be modified or engineered to be sweeping antibodies.
  • any of the antibodies, or antigen binding fragments thereof, provided herein may be converted into a sweeping antibody using any suitable method.
  • suitable methods for making sweeping antibodies, or antigen-binding portions thereof have been previously described in Igawa et al .
  • the affinity e.g., as expressed as KD
  • the antibodies, or antigen binding fragments thereof, provided herein have an increased KD of binding to pro/latent-myostatin at a relatively low pH (e.g., a pH ranging from 4.0-6.5) as compared to a relatively high pH (e.g., a pH ranging from 7.0-7.4).
  • the antibodies, or antigen binding fragments thereof, provided herein have a KD of binding to pro/latent-myostatin ranging from 10 3 M, 10 4 M, 10 5 M, 10 6 M, 10- 7 M, 10 8 M when the pH is between 4.0 and 6.5. In some embodiments, the antibodies, or antigen binding fragments thereof, provided herein have a KD of binding to pro/latent-myostatin ranging from 10 -6 M, 10 7 M, 10 8 M, 10 9 M, 10 10 M, 10 ⁇ 11 M when the pH is between 7.0 and 7.4.
  • the antibodies, or antigen binding fragments thereof, provided herein have a KD of binding to pro/latent-Myostatin that is at least 2-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1000-fold, at least 5000-fold, or at least 10000-fold greater at a pH between 4.0 and 6.5 as compared to a pH between 7.0 and 7.4.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof are provided herein that specifically bind to the same epitope as an antibody described in Table 2a, 11 a, 11 b, or 13 of International Patent Application Publication No. WO 2016/098357, which was published on June 23, 2016, and which is based on International Patent Application No. PCT/JP2015/006323, which was filed on December 18, 2015.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof are provided herein that compete for binding with such an antibody.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof, provided herein do not specifically bind to the same epitope as an antibody described in Table 2a, 11 a, 11 b, or 13 of International Patent Application Publication No. WO 2016/098357, which was published on June 23, 2016, and which is based on International Patent Application No. PCT/JP2015/006323, which was filed on December 18, 2015.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof, provided herein do not compete or do not cross-compete for binding to the same epitope as an antibody described in Table 2a, 11 a, 11 b, or 13 of International Patent Application Publication No.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof, provided herein do not specifically bind to the same epitope as an antibody comprising a VH and a VL pair described in Table 2a, 11a, 11 b, or 13 of International Patent Application Publication No. WO 2016/098357, which was published on June 23, 2016, and which is based on International Patent Application No. PCT/JP2015/006323, which was filed on December 18, 2015.
  • pro/latent-myostatin antibodies, or antigen binding fragments thereof, provided herein do not compete or do not cross-compete for binding to the same epitope as an antibody comprising a VH and a VL pair described in Table 2a, 11 a, 11 b, or 13 of International Patent Application Publication No. WO 2016/098357, which was published on June 23, 2016, and which is based on International Patent Application No. PCT/JP2015/006323, which was filed on December 18, 2015.
  • aspects of the disclosure relate to antibodies, and antigen-binding fragments thereof, that compete or cross- compete with any of the antibodies, or antigen binding fragments thereof, provided herein.
  • the term “compete”, as used herein with regard to an antibody means that a first antibody binds to an epitope of a protein (e.g., latent myostatin) in a manner sufficiently similar to the binding of a second antibody, such that the result of binding of the first antibody with its epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
  • a protein e.g., latent myostatin
  • the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case.
  • a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
  • each antibody detectably inhibits the binding of the other antibody with its epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to “cross-compete” with each other for binding of their respective epitope(s). Both competing and cross-competing antibodies are within the scope of this disclosure.
  • aspects of the disclosure relate to antibodies, or antigen-binding portions thereof, that compete or cross- compete with any of the antibodies, or antigen binding fragments thereof, provided herein.
  • an antibody, or an antigen-binding portion thereof binds at or near the same epitope as any of the antibodies provided herein.
  • an antibody, or an antigen-binding portion thereof binds near an epitope if it binds within 15 or fewer amino acid residues of the epitope.
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind within 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14 or 15 amino acid residues of an epitope that is bound by any of the antibodies, or antigen binding fragments thereof, provided herein.
  • such antibody or antigen-binding fragment cross-competes with apitegromab for binding to human pro/latent myostatin.
  • such antibody or antigen-binding fragment binds an epitope within the prodomain of human myostatin, wherein the epitope comprises one or more amino acid residues F147, Q149, L151 , Y186, S168, K170, K205, and/or L207, as numbered according to SEQ ID NO: 52 disclosed herein.
  • such antibody or antigen-binding fragment binds an epitope within the prodomain of human myostatin, wherein the epitope comprises one or more amino acid residues F147, Q149, L151 , Y186, R167, S168, K170, K205, L207, E209, and/or N210, as numbered according to SEQ ID NO: 52.
  • such antibody or antigen-binding fragment comprises an HCDR3 paratope that is a variant of SEQ ID NO: 10, wherein the variant contains of up to two amino acid substitutions as compared to SEQ ID NO: 10.
  • such antibody or antigen-binding fragment comprises an HCDR3 sequence comprising a leucine at amino acid position 3 and a tryptophan at amino acid position 9, as numbered according to SEQ ID NO: 10.
  • such antibody or antigen-binding fragment comprises an HCDR3 sequence comprising a leucine at amino acid position 3, a valine at amino acid position 4, a leucine at amino acid position 7, a tyrosine at amino acid position 8, and/or a tryptophan at amino acid position 9, as numbered according to SEQ ID NO: 10.
  • an antibody, or an antigen-binding portion thereof competes or cross-competes for binding to any of the antigens provided herein (e.g., pro/latent-myostatin) with an equilibrium dissociation constant, KD, between the antibody and the protein of less than 10 '8 M.
  • an antibody, or an antigen-binding portion thereof competes or cross-competes for binding to any of the antigens provided herein with a KD in a range from 10 '11 M to 10 '8 M.
  • aspects of the disclosure relate to antibodies, or antigen-binding portions thereof, that compete for binding to pro/latent-myostatin with any of the antibodies, or antigen binding fragments thereof, provided herein.
  • the antibody, or an antigen-binding portion thereof binds to pro/latent-myostatin at the same epitope as any of the antibodies, or antigen-binding portions thereof, provided herein.
  • any of the antibodies provided herein bind at or near a tolloid cleavage site or at or near a tolloid docking site of pro/latent-myostatin.
  • any of the antibodies, or antigen binding fragments thereof, provided herein bind at or near a proprotein convertase cleavage site or at or near a proprotein convertase docking site of pro/latent-myostatin.
  • an antibody, or an antigen-binding portion thereof competes for binding to pro/latent-myostatin with an equilibrium dissociation constant, KD, between the antibody, or antigenbinding portion thereof, and pro/latent-myostatin of less than 10 -6 M.
  • the antibody, or antigen-binding portion thereof, that competes with any of the antibodies, or antigen-binding portions thereof, provided herein binds to pro/latent-myostatin with a KD in ranging from 10 '11 M to 10 -8 M.
  • any of the antibodies, or antigen binding fragments thereof, provided herein can be characterized using any suitable methods.
  • one method is to identify the epitope to which the antigen binds, or “epitope mapping.”
  • epitope mapping There are many suitable methods for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody-antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 11 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
  • epitope mapping can be used to determine the sequence to which an antibody, or an antigen-binding portion thereof, binds.
  • the epitope can be a linear epitope, i.e. , contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch (primary structure linear sequence).
  • Peptides of varying lengths e.g., at least 4-6 amino acids long
  • the epitope to which the antibody, or an antigen-binding portion thereof, binds can be determined in a systematic screen by using overlapping peptides derived from the target antigen sequence and determining binding by the antibody, or an antigen-binding portion thereof.
  • the open reading frame encoding the target antigen is fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of the antigen with the antibody to be tested is determined.
  • the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody, or an antigen-binding portion thereof, to the radioactively labeled antigen fragments is then determined by immunoprecipitation and gel electrophoresis. Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries).
  • a defined library of overlapping peptide fragments can be tested for binding to the test antibody, or an antigen-binding portion thereof, in simple binding assays.
  • mutagenesis of an antigen binding domain can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
  • domain swapping experiments can be performed using a mutant of a target antigen in which various fragments of the pro/latent-myostatin polypeptide have been replaced (swapped) with sequences from a closely related, but antigenically distinct protein, such as another member of the TQRb protein family (e.g., GDF11).
  • competition assays can be performed using other antibodies known to bind to the same antigen to determine whether an antibody, or an antigen-binding portion thereof, binds to the same epitope as the other antibodies, or antigen-binding portions thereof. Competition assays are well known to those of skill in the art.
  • any of the suitable methods e.g., the epitope mapping methods as described herein, can be applied to determine whether an anti-pro/latent-myostatin antibody, or an antigen-binding portion thereof, binds one or more of the specific residues/segments in pro/latent-myostatin as described herein.
  • the interaction of the antibody, or an antigen-binding portion thereof, with one or more of those defined residues in pro/latent-myostatin can be determined by routine technology. For example, a crystal structure can be determined, and the distances between the residues in pro/latent-myostatin and one or more residues in the antibody, or antigen-binding portion thereof, can be determined accordingly.
  • pro/latent-myostatin Based on such distance, whether a specific residue in pro/latent-myostatin interacts with one or more residues in the antibody, or antigen-binding portion thereof, can be determined. Further, suitable methods, such as competition assays and target mutagenesis assays can be applied to determine the preferential binding of a candidate anti-pro/latent-myostatin antibody, or an antigen-binding portion thereof, to pro/latent-myostatin as compared to another target such as a mutant pro/latent-myostatin.
  • suitable methods such as competition assays and target mutagenesis assays can be applied to determine the preferential binding of a candidate anti-pro/latent-myostatin antibody, or an antigen-binding portion thereof, to pro/latent-myostatin as compared to another target such as a mutant pro/latent-myostatin.
  • antibodies, or antigen binding fragments thereof can be produced using recombinant DNA methods.
  • Monoclonal antibodies, and antigen-binding fragments thereof, may also be produced by generation of hybridomas (see e.g., Kohler and Milstein (1975) Nature, 256: 495-499) in accordance with known methods.
  • Hybridomas formed in this manner are then screened using standard methods, such as enzyme-linked immunosorbent assay (ELISA) and surface plasmon resonance (e.g., OCTET or BIACORE) analysis, to identify one or more hybridomas that produce an antibody, or an antigen-binding portion thereof, that specifically binds to a specified antigen.
  • ELISA enzyme-linked immunosorbent assay
  • surface plasmon resonance e.g., OCTET or BIACORE
  • Any form of the specified antigen may be used as the immunogen, e.g., recombinant antigen, naturally occurring forms, any variants or fragments thereof, as well as antigenic peptide thereof (e.g., any of the epitopes described herein as a linear epitope or within a scaffold as a conformational epitope).
  • One exemplary method of making antibodies, and antigen-binding portions thereof includes screening protein expression libraries that express antibodies or fragments thereof (e.g., scFv), e.g., phage or ribosome display libraries.
  • Phage display is described, for example, in Ladner et al . , U.S. Pat. No. 5,223,409; Smith (1985) Science 228:1315-1317; Clackson et al. (1991) Nature, 352: 624-628; Marks et al. (1991) J. Mol.
  • the specified antigen e.g., pro-myostatin
  • a non-human animal e.g., a rodent, e.g., a mouse, hamster, or rat.
  • the non-human animal is a mouse.
  • a monoclonal antibody is obtained from the non-human animal, and then modified, e.g., chimeric, using suitable recombinant DNA techniques.
  • suitable recombinant DNA techniques e.g., Morrison et al., Proc. Natl. Acad. Sci. U.S.A. 81 :6851 , 1985; Takeda et al., Nature 314:452, 1985, Cabilly et al., U.S. Pat. No. 4,816,567; Boss et al., U.S. Pat. No. 4,816,397; Tanaguchi et al. , European Patent Publication EP171496; European Patent Publication 0173494, United Kingdom Patent GB 2177096B.
  • Host cells may be a prokaryotic or eukaryotic cell.
  • the polynucleotide or vector which is present in the host cell may either be integrated into the genome of the host cell or it may be maintained extrachromosomally.
  • the host cell can be any prokaryotic or eukaryotic cell, such as a bacterial, insect, fungal, plant, animal or human cell.
  • fungal cells are, for example, those of the genus Saccharomyces, in particular those of the species S. cerevisiae.
  • prokaryotic includes all bacteria which can be transformed or transfected with a DNA or RNA molecules for the expression of an antibody or the corresponding immunoglobulin chains.
  • Prokaryotic hosts may include gram negative as well as gram positive bacteria such as, for example, E. coli, S. typhimurium, Serratia marcescens and Bacillus subtil is.
  • eukaryotic includes yeast, higher plants, insects and vertebrate cells, e.g., mammalian cells, such as NSO and CHO cells.
  • the antibodies or immunoglobulin chains encoded by the polynucleotide may be glycosylated or may be non-glycosylated.
  • Antibodies or the corresponding immunoglobulin chains may also include an initial methionine amino acid residue.
  • the host may be maintained under conditions suitable for high level expression of the nucleotide sequences, and, as desired, the collection and purification of the immunoglobulin light chains, heavy chains, light/heavy chain dimers or intact antibodies, antigen binding fragments or other immunoglobulin forms may follow; see, Beychok, Cells of Immunoglobulin Synthesis, Academic Press, N.Y. (1979).
  • polynucleotides or vectors are introduced into the cells which in turn produce the antibody or antigen binding fragments.
  • transgenic animals, preferably mammals, comprising the aforementioned host cells may be used for the large-scale production of the antibody or antibody fragments.
  • Bioreactor e.g., cell culture
  • the transformed host cells can be grown in fermenters and cultured using any suitable techniques to achieve optimal cell growth.
  • the whole antibodies, their dimers, individual light and heavy chains, other immunoglobulin forms, or antigen binding fragments can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like; see, Scopes, "Protein Purification", Springer Verlag, N.Y. (1982).
  • the antibody or antigen binding fragments can then be isolated from the growth medium, cellular lysates, or cellular membrane fractions.
  • the isolation and purification of the, e.g., microbially expressed antibodies or antigen binding fragments may be by any conventional means such as, for example, preparative chromatographic separations and immunological separations such as those involving the use of monoclonal or polyclonal antibodies directed, e.g., against the constant region of the antibody.
  • aspects of the disclosure relate to a hybridoma, which provides an indefinitely prolonged source of monoclonal antibodies.
  • immortalized hybridoma cells can be used as a source of rearranged heavy chain and light chain loci for subsequent expression and/or genetic manipulation.
  • Rearranged antibody genes can be reverse transcribed from appropriate mRNAs to produce cDNA.
  • heavy chain constant region can be exchanged for that of a different isotype or eliminated altogether.
  • the variable regions can be linked to encode single chain Fv regions. Multiple Fv regions can be linked to confer binding ability to more than one target or chimeric heavy and light chain combinations can be employed. Any appropriate method may be used for cloning of antibody variable regions and generation of recombinant antibodies, and antigen-binding portions thereof.
  • an appropriate nucleic acid that encodes variable regions of a heavy and/or light chain is obtained and inserted into an expression vectors which can be transfected into standard recombinant host cells.
  • a variety of such host cells may be used.
  • mammalian host cells may be advantageous for efficient processing and production. Typical mammalian cell lines useful for this purpose include CHO cells, 293 cells, or NSO cells.
  • the production of the antibody or antigen binding fragment may be undertaken by culturing a modified recombinant host under culture conditions appropriate for the growth of the host cells and the expression of the coding sequences.
  • the antibodies or antigen binding fragments may be recovered by isolating them from the culture.
  • the expression systems may be designed to include signal peptides so that the resulting antibodies are secreted into the medium; however, intracellular production is also possible.
  • the disclosure also includes a polynucleotide encoding at least a variable region of an immunoglobulin chain of the antibodies described herein.
  • the variable region encoded by the polynucleotide comprises at least one complementarity determining region (CDR) of the VH and/or VL of the variable region of the antibody produced by any one of the above described hybridomas.
  • CDR complementarity determining region
  • Polynucleotides encoding antibody or antigen binding fragments may be, e.g., DNA, cDNA, RNA or synthetically produced DNA or RNA or a recombinantly produced chimeric nucleic acid molecule comprising any of those polynucleotides either alone or in combination.
  • a polynucleotide is part of a vector. Such vectors may comprise further genes such as marker genes which allow for the selection of the vector in a suitable host cell and under suitable conditions.
  • a polynucleotide is operatively linked to expression control sequences allowing expression in prokaryotic or eukaryotic cells.
  • Expression of the polynucleotide comprises transcription of the polynucleotide into a translatable mRNA.
  • Regulatory elements ensuring expression in eukaryotic cells are well known to those skilled in the art. They may include regulatory sequences that facilitate initiation of transcription and optionally poly-A signals that facilitate termination of transcription and stabilization of the transcript. Additional regulatory elements may include transcriptional as well as translational enhancers, and/or naturally associated or heterologous promoter regions. Possible regulatory elements permitting expression in prokaryotic host cells include, e.g., the PL, Lac, Trp orTac promoter in E.
  • regulatory elements permitting expression in eukaryotic host cells are the AOX1 orGALI promoter in yeast or the CMV-promoter, SV40- promoter, RSV-promoter (Rous sarcoma virus), CMV-enhancer, SV40-enhancer or a globin intron in mammalian and other animal cells.
  • Beside elements which are responsible for the initiation of transcription such regulatory elements may also include transcription termination signals, such as the SV40-poly-A site or the tk-poly-A site, downstream of the polynucleotide.
  • transcription termination signals such as the SV40-poly-A site or the tk-poly-A site
  • leader sequences capable of directing the polypeptide to a cellular compartment or secreting it into the medium may be added to the coding sequence of the polynucleotide and have been described previously.
  • the leader sequence(s) is (are) assembled in appropriate phase with translation, initiation, and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein, or a portion thereof, into, for example, the extracellular medium.
  • a heterologous polynucleotide sequence can be used that encode a fusion protein including a C- or N- terminal identification peptide imparting desired characteristics, e.g., stabilization or simplified purification of expressed recombinant product.
  • polynucleotides encoding at least the variable domain of the light and/or heavy chain may encode the variable domains of both immunoglobulin chains or only one.
  • a polynucleotide(s) may be under the control of the same promoter or may be separately controlled for expression.
  • vectors, particularly plasmids, cosmids, viruses and bacteriophages used conventionally in genetic engineering that comprise a polynucleotide encoding a variable domain of an immunoglobulin chain of an antibody or antigen binding fragment; optionally in combination with a polynucleotide that encodes the variable domain of the other immunoglobulin chain of the antibody.
  • expression control sequences are provided as eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells, but control sequences for prokaryotic hosts may also be used.
  • Expression vectors derived from viruses such as retroviruses, vaccinia virus, adeno-associated virus, herpes viruses, or bovine papilloma virus, may be used for delivery of the polynucleotides or vector into targeted cell population (e.g., to engineer a cell to express an antibody or antigen binding fragment).
  • a variety of appropriate methods can be used to construct recombinant viral vectors.
  • polynucleotides and vectors can be reconstituted into liposomes for delivery to target cells.
  • the vectors containing the polynucleotides can be transferred into the host cell by suitable methods, which vary depending on the type of cellular host.
  • Antibodies and antigen binding fragments of the disclosure may be modified with a detectable label, including, but not limited to, an enzyme, prosthetic group, fluorescent material, luminescent material, bioluminescent material, radioactive material, positron emitting metal, nonradioactive paramagnetic metal ion, and affinity label for detection and isolation of pro/latent-myostatin.
  • the detectable substance may be coupled or conjugated either directly to the polypeptides of the disclosure or indirectly, through an intermediate (such as, for example, a linker) using suitable techniques.
  • Non-limiting examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, b-galactosidase, glucose oxidase, or acetylcholinesterase; non-limiting examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; non-limiting examples of suitable fluorescent materials include biotin, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, or phycoerythrin; an example of a luminescent material includes luminol; non-limiting examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include a radioactive metal ion, e.g., alpha-emitters or other radioisotopes such as, for example, iodine (1311, 12
  • the detectable substance may be coupled or conjugated either directly to the anti- pro/latent-myostatin antibodies, or antigen-binding portions thereof, of the disclosure or indirectly, through an intermediate (such as, for example, a linker) using suitable techniques.
  • Anti- pro/latent-myostatin antibodies, or antigen-binding portions thereof, conjugated to a detectable substance may be used for diagnostic assays as described herein.
  • Methods or treatments comprising administering a myostatin pathway inhibitor (such as a myostatin antibody) in conjunction with a GLP-1 pathway activator are encompassed by the present disclosure and can be used as a medicament to effectuate beneficial effects (e.g., therapeutic effects) in a subject when each is administered to the subject in an effective amount.
  • beneficial effects e.g., therapeutic effects
  • Exemplary such biologically beneficial effects are provided herein.
  • Beneficial biological effects in a subject can be achieved by administration of myostatin pathway inhibitors, e.g., antibodies, or antigen binding fragments thereof, as described herein, that specifically bind pro/latent myostatin.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are administered concurrently, simultaneously, or sequentially.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause two or more of the biological effects described below. In some embodiments, the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause three or more of the biological effects described below. In some embodiments, the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause four or more of the biological effects described below. In some embodiments, the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause five or more of the biological effects described below. In some embodiments, the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause six or more of the biological effects described below.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause seven or more of the biological effects described below. In some embodiments, the myostatin pathway inhibitor and the GLP-1 pathway activator are administered in an amount effective to cause eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, or sixteen of the biological effects described below.
  • a myostatin pathway inhibitor in conjunction with a GLP-1 pathway activator increases mass and/or function of a muscle tissue in the human subject.
  • the muscle tissue is selected from the group consisting of a smooth muscle tissue, a skeletal muscle tissue and a cardiac muscle tissue.
  • Smooth muscle tissue is made up from long tapering cells, generally involuntary and differs from striated muscle in the much higher actin/myosin ratio, the absence of conspicuous sarcomeres and the ability to contract to a much smaller fraction of its resting length. Smooth muscle cells are found particularly in blood vessel walls, surrounding the intestine and in the uterus.
  • Cardiac muscle tissue is a striated but involuntary tissue responsible for the pumping activity of the vertebrate heart.
  • the individual cardiac muscle cells are not fused together into multinucleate structures as they are in striated muscle tissue.
  • Skeletal muscle tissue is under voluntary control.
  • the muscle fibers are syncytial and contain myofibrils, tandem arrays of sarcomeres.
  • MHC myosin heavy chain
  • Slow-twitch muscles are better equipped to work aerobically and help enable long-endurance feats such as distance running, while fast-twitch muscles fatigue faster but are better equipped to work anaerobically and are used in powerful bursts of movements like sprinting.
  • the differentiation between slow and fast twitch muscle fibers is based on histochemical staining for myosin adenosine- triphosphatase (ATPase) and the type of myosin heavy chain.
  • the slow twitch muscle fiber (type I fiber) is MHC isoform I and the three fast twitch isoforms (type II fibers) are MHC isoform lla, MHC isoform lid, and MHC isoform lib (S. Schiaffino, J. Muscle Res. Cell. Motil., 10 (1989), pp. 197-205).
  • the mass and/or function of a fast twitch muscle tissue in the human subject is increased. In other embodiments, the mass and/or function of a slow twitch muscle tissue in the human subject is increased. Maintaining muscle mass in the context of treating obesity is known to support weight loss, e.g., as observed by resistance training. Myostatin inhibition according to the invention preferentially preserves fast-twitch fibers.
  • Fiber type switch Biological effects of an effective amount of the pharmaceutical compositions and therapeutic methods provided herein may be associated with a phenotypic change of muscle fiber types, which is a process referred to as fiber type switch.
  • fiber type switch is triggered by an event, such as an injury and starvation.
  • the disclosure provides a method for promoting fiber type switch in a subject.
  • the method comprises administering to the subject a composition comprising a myostatin pathway inhibitor, e.g., an antibody, or antigen binding fragment thereof, that specifically binds pro/latent-myostatin and blocks release of mature myostatin in an amount effective to promote fiber type switch, thereby promoting fiber type switch in the subject.
  • a myostatin pathway inhibitor e.g., an antibody, or antigen binding fragment thereof
  • the disclosure provides a method for preferentially increasing type II or fast twitch fibers over type I or slow twitch fibers in a subject.
  • the method comprises administering to the subject a composition comprising a myostatin pathway inhibitor, e.g., an antibody, or antigen binding fragment thereof, that specifically binds pro/latent-myostatin and blocks release of mature myostatin in an amount effective to preferentially increase type II or fast twitch fibers over type I or slow twitch fibers fiber type switch, thereby preferentially increasing type II or fast twitch fibers over type I or slow twitch fibers in the subject.
  • a myostatin pathway inhibitor e.g., an antibody, or antigen binding fragment thereof
  • administering can cause an increase in muscle mass and/or muscle function.
  • an increase in muscle mass is clinically meaningful to benefit or otherwise improve the health status of the subject.
  • clinically meaningful changes in muscle mass may improve the patient’s mobility, self-care, metabolism, etc.
  • the increase in muscle mass is an increase in lean muscle or lean muscles.
  • such increase in muscle mass is a systemic effect such that muscles in the whole body or substantially whole body show the measurable effect.
  • lean muscle is muscle that is densely packed with contractile tissue and has low fat and connective tissue content.
  • effects are localized to certain group/type of muscles.
  • the mass of the muscle tissue e.g., lean muscle tissue
  • the mass of the muscle tissue is increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the mass of the muscle tissue e.g., lean muscle tissue
  • Such increase in muscle mass may be deduced or measured by any suitable known methods, including measurement of cross-sectional area via MRI (e.g., forearm cross section), circumference, diaphragm width (e.g., via ultrasound), qNMR, DXA, etc.
  • administering can cause an enhancement in muscle function.
  • Muscle function may be assessed by a variety of measures, including, without limitation: force generation, grip strength (e.g., maximum grip strength), endurance, muscle oxidative capacity, dynamic grip endurance, etc.
  • grip strength e.g., maximum grip strength
  • endurance e.g., maximum grip strength
  • muscle oxidative capacity e.g., dynamic grip endurance
  • serum creatinine levels are used as a validated biomarker indicative of muscle mass, albeit with limited sensitivity.
  • the function of the muscle tissue is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the function of the muscle tissue is increased by at least about 1-5%, 5-10%, 10-20%, 1-30%, 1- 40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • increased muscle function comprises improved rating, for example, from 1 to 2, 2 to 3, 3 to 4, 4 to 5, 5 to 6, 6 to 7, 7 to 8, 8 to 9, or 9 to 10.
  • use of a myostatin pathway inhibitor alone or in conjunction with a GLP-1 pathway activator in the methods of the present invention may increase the mass and/or function of the muscle tissue in the subject suffering from a lesion, e.g., due to a spinal cord injury.
  • the subject is in an acute spinal cord injury phase immediately after injury, where diagnosis between complete and incomplete injury is generally difficult.
  • the subject is in a sub-acute spinal cord injury phase, where there is a distinction between complete and incomplete spinal cord injury, and recovery is possible through ongoing rehab.
  • the subject is in a chronic spinal cord injury phase.
  • the chronic SCI phase occurs around 4 or 6 months from the date of injury, where patients have demonstrated substantial decrease in rate of recovery or when rehab efforts have reached a plateau despite the ongoing standard of care efforts.
  • the mass and/or function of the muscle tissue below a lesion is increased in a subject suffering from a lesion, e.g., a spinal cord injury.
  • the mass and/or function of the muscle tissue above a lesion is increased in a subject suffering from a lesion, e.g., a spinal cord injury.
  • the muscle is selected from the group consisting of a soleus muscle, a gastrocnemius muscle, a bicep muscle and a tricep muscle.
  • the mass of the muscle tissue is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%. In other embodiments, the mass of the muscle tissue is increased by at least about 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • the function of the muscle tissue is increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the function of the muscle tissue is increased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • a myostatin pathway inhibitor e.g., antibody, or antigen binding fragment thereof that specifically binds pro/latent myostatin
  • a GLP-1 pathway activator increases locomotor function in the human subject, e.g., in a subject suffering from a lesion.
  • the locomotor function of the human subject is increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the locomotor function of the human subject is increased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20- 30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administration of the myostatin pathway inhibitor e.g., antibody, or antigen binding fragment thereof that specifically binds pro/latent myostatin, alone or in conjunction with a GLP-1 pathway activator increases the motor coordination and balance in the human subject, e.g., in a subject suffering from a lesion.
  • the motor coordination and balance of the human subject is increased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the motor coordination and balance of the human subject is increased by at least 1-5%, 5- 10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administering increases the muscle strength in the human subject, e.g., in a subject suffering from a lesion.
  • the muscle strength of the human subject is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the muscle strength of the human subject is increased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1- 40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administration of a myostatin pathway inhibitor alone or in conjunction with a GLP- 1 pathway activator can cause clinically meaningful changes in muscle function which corresponds to enhanced functionality of the patient.
  • enhanced functionality includes improvement in the patient’s mobility, self-care, metabolism, etc.
  • administration of an effective amount of the myostatin pathway inhibitor e.g., an antibody, or antigen binding fragment thereof, that specifically binds pro/latent myostatin facilitates or accelerates recovery from a condition, such as injuries, surgeries, and other medical procedures. Suitable such conditions may involve a condition that is associated with a nerve damage (whether resulting from an injury or a surgical or other clinical procedure).
  • suitable subjects include generally healthy individuals, such as a patient who: i) has sustained an acute injury involving a nerve damage that affects muscle function; ii) is scheduled to undergo a surgical procedure (therapeutic or corrective) that may cause an unintended nerve injury (e.g., motor neuron injury); iii) has undergone a surgical procedure that has caused an unintended muscle dysfunction; iv) receives a treatment that involves immobilization of a particular muscle or muscle groups (e.g., cast, etc.); v) is on ventilator (e.g., as a result of acute injury).
  • a myostatin pathway inhibitor described herein may accelerate recovery in such patients. In some embodiments, such administration may be prophylactic.
  • the antibody may be administered to prevent muscle dysfunction.
  • Prevention includes alleviating or lessening the severity of such dysfunction.
  • administration may be a local administration at or near the site of the affected area, e.g., injury, surgery, etc. Effect on Muscle Catabolism of Protein and/or Muscle Release of Amino Acids in the Human Subject
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator decreases muscle catabolism of protein and/or muscle release of amino acids in the human subject.
  • muscle catabolism of protein and/or muscle release of amino acids is decreased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • muscle catabolism of protein and/or muscle release of amino acids is decreased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administering prevents muscle loss or atrophy in the human subject at risk of developing muscle loss and/or atrophy.
  • muscle loss or atrophy is decreased or prevented by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • muscle loss or atrophy is decreased or prevented by at least 1 -5%, 5-10%, 10-20%, 1 -30%, 1 -40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • muscle mass is retained (i.e. , no muscle mass gain or loss) as a result of treatment, e.g., while losing fat mass.
  • a subject receiving the combination therapy may exhibit a gain in muscle mass.
  • treatment with the combination therapy maintains the gain in muscle mass relatively to muscle mass prior to treatment.
  • a suitable subject is a subject who has not developed atrophy but is considered at risk of developing atrophy.
  • a subject is on a weight loss program, such as a program comprising diet restriction and/or an exercise regimen.
  • the subject is on a weight loss program comprising a diet restriction regimen of at least 20%, e.g., at least 30%, 35%, 40%, 45%, or 50%, calorie reduction.
  • the subject has type 2 diabetes.
  • the subject has cardiovascular disease.
  • a subject has a disease or condition associated with a neurological defect that impairs motor neuron function. In some embodiments, such conditions are caused by muscular dystrophy or atrophy.
  • the neurological defect is caused by a nerve injury.
  • the nerve injury involves partial denervation of motor neurons, which causes partial impairment of function in the affected muscle.
  • such condition is caused by SCI.
  • the subject with SCI is in an acute or sub-acute phase of SCI (e.g., not yet reached a chronic phase).
  • compositions comprising an effective amount of an inhibitor of myostatin signaling (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) is administered to a population of patients who are at risk of developing muscle atrophy associated with partial denervation of motor neurons, the composition i) prevents manifestation or aggravation of the muscle atrophy in a statistically significant fraction of the patient population; or, ii) lessens the severity of the muscle atrophy in the statistically significant fraction of the patient population.
  • the myostatin signaling inhibitor is administered in conjunction with a GLP-1 pathway activator as described herein.
  • a myostatin signaling inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin signaling inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • administration of an effective amount of a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor also prevents or lessens neuropathy, e.g., diabetic neuropathy, or an early-onset axonal polyneuropathy in affected limbs.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • administration of a myostatin pathway inhibitor decreases intramuscular fat infiltration in the human subject.
  • intramuscular fat infiltration is decreased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • intramuscular fat infiltration is decreased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator affects the level of adipose tissue in the human subject.
  • adipose tissue refers to fat including the connective tissue that stores fat. Adipose tissue is derived from preadipocytes. Its main role is to store energy in the form of lipids, although it also cushions and insulates the body. The two types of adipose tissue are white adipose tissue (WAT), which stores energy, and brown adipose tissue (BAT), which generates body heat.
  • WAT white adipose tissue
  • BAT brown adipose tissue
  • Brown adipose tissue (BAT) is known to function in the dissipation of chemical energy in response to cold or excess feeding, and also has the capacity to modulate energy balance. Activation of brown adipose tissue has been shown to improve glucose homeostasis and insulin sensitivity in humans suggesting that anyone with impaired insulin function might benefit from BAT activation (Stanford et al . , J Clin Invest. 2013, 123(1): 215-223).
  • Beige adipose tissues are generated as a result of browning of WAT, also known as beiging. This occurs when adipocytes within WAT depots develop features of BAT. Beige adipocytes take on a multilocular appearance (containing several lipid droplets) and increase expression of uncoupling protein 1 (UCP1). In doing so, these normally energy-storing white adipocytes become energy-releasing adipocytes (Harms et al. Nature Medicine. 2013, 19 (10): 1252-63).
  • UCP1 uncoupling protein 1
  • Visceral fat or abdominal fat is located inside the abdominal cavity, packed between the organs (stomach, liver, intestines, kidneys, etc.). Visceral fat is different from subcutaneous fat underneath the skin, and intramuscular fat interspersed in skeletal muscles. Fat in the lower body, as in thighs and buttocks, is subcutaneous and is not consistently spaced tissue, whereas fat in the abdomen is mostly visceral and semi-fluid. An excess of visceral fat is known as central obesity, “central adiposity,” or "belly fat”, in which the abdomen protrudes excessively and new developments such as the Body Volume Index (BVI) are specifically designed to measure abdominal volume and abdominal fat. Excess visceral fat is also linked to type 2 diabetes, insulin resistance, inflammatory diseases and other obesity-related diseases (Mokdad et al., JAMA: The Journal of the American Medical Association. 2001 , 289 (1): 76-9).
  • Mass of adipose tissue can be determined by any method known to a person of ordinary skill in the art.
  • adipose tissue may be measured by qNMR, dual-energy X-Ray absorptiometry (DXA),and other methods known in the art.
  • administration of the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • administration of the myostatin pathway inhibitor decreases the level of white adipose tissue and visceral adipose tissue in the human subject.
  • the administration comprises administering a GLP-1 pathway activator in conjunction with the myostatin inhibitor.
  • the level of brown or beige adipose tissue is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the level of brown or beige adipose tissue is increased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1- 40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • the level of white or visceral adipose tissue is decreased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the level of white or visceral adipose tissue is decreased by at least 1-5%, 5-10%, 10-20%, 1- 30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • myostatin inhibition has different effects during the weight loss phase as compared to the weight maintenance phase.
  • inhibiting the myostatin pathway promotes more fat mass loss in the weight maintenance phase as compared to fat mass loss in the active weight loss phase.
  • inhibiting the myostatin pathway promotes more fat mass loss under moderate calorie restriction (e.g., 30% or less calorie restriction, e.g., 20% calorie restriction) as compared to extreme calorie restriction (e.g., 30% or more calorie restriction).
  • the rate of fat increase is slowed or stopped relative to the rate prior to treatment. In some embodiments, the treatment maintains the reduced rate of fat increase relative to the higher rate of fat increase prior to treatment.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator decreases the ratio of adipose- to-muscle tissue in the human subject.
  • the ratio of adipose-to-muscle tissue is decreased by at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the ratio of adipose-to-muscle tissue is decreased by at least 1-5%, 5- 10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administration of a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator maintains the reduction in the ratio between adipose-to-muscle tissue in a human subject who has previously achieved a reduced ratio of adipose-to-muscle tissue.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator increases the ratio of muscle tissue to adipose in the human subject.
  • the ratio of muscle tissue-to-adipose is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • the ratio of muscle tissue-to-adipose is increased by at least 1-5%, 5- 10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • administration of a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator maintains the increased ratio of muscle tissue to adipose tissue in a human subject who has previously achieved such an increased ratio.
  • Leptin is a hormone produced and secreted by adipose tissue that plays a role in regulating food intake and stimulating energy expenditure. Defects in leptin production have been reported to cause severe hereditary obesity in rodents and humans. In addition to its effects on body weight, leptin has a variety of other functions, including the regulation of hematopoiesis, angiogenesis, wound healing, and the immune and inflammatory response. Leptin acts through the leptin receptor, a single-transmembrane-domain receptor of the cytokine receptor family, which is found in many tissues in several alternatively spliced forms.
  • the LEP gene is the human homolog of the gene (ob) mutant in the mouse 'obese' phenotype.
  • the leptin level in a subject refers to the amount of circulating leptin in the body of the subject, e.g., a mammalian subject, and a reduction in leptin levels refers to a reduction in the amount of circulating leptin as compared to a baseline measurement, e.g., as a result of treatment.
  • the therapeutic efficacy of treating a subject may be determined by measuring a reduction in leptin levels in the blood of the subject after administering the myostatin inhibitor as compared to before the administration.
  • the therapeutic efficacy may be determined by (i) determining a blood level of leptin in the subject prior to administering the myostatin inhibitor; (ii) administering the myostatin inhibitor; and (iii) determining a blood level of leptin in the subject after administering the myostatin inhibitor; wherein a reduction in blood leptin level indicates therapeutic efficacy.
  • Adiponectin is an adipokine involved in the control of fat metabolism and insulin sensitivity with direct antidiabetic, anti-atherogenic and anti-inflammatory activities.
  • Adiponectin stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion and inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway.
  • Adiponectin may be involved in brown fat cell differentiation.
  • the term “adiponectin level” refers to the amount of circulating adiponectin, e.g., total adiponectin or glycosylated adiponectin.
  • the plasma adiponectin level of a subject may be measured by, e.g., the total adiponectin assay (ELISA kit EZHADP-61 K, Millipore, St. Charles, Missouri, USA) which captures all forms of circulating adiponectin, with a sensitivity of 0.78 ng/mL and within-batch and between-batch coefficients of variation of 1 .8% and 6.2%, respectively.
  • An increase or decrease in adiponectin level refers to a higher or lower amount of circulating adiponectin detected in a subject (e.g., following a treatment for a metabolic disease or disorder) compared to a baseline measurement.
  • Ghrelin is an appetite-regulating hormone that has an appetite-stimulating effect, induces adiposity, and stimulates gastric secretion.
  • Plasma ghrelin concentration is increased in fasting conditions and reduced after habitual feeding.
  • the normal ghrelin concentration of plasma samples in humans is 10-20 fmol/ml for n-octanoyl ghrelin and 100-150 fmol/ml fortotal ghrelin, including both acyl-modified and des-acyl ghrelins.
  • Ghrelin levels may be measured using, e.g., the Ghrelin Human ELISA kid, CAT# BMS2192 (Invitrogen).
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • administration of a myostatin pathway inhibitor increases the metabolic rate of the human subject.
  • the administration can increase the basal metabolic rate in the subject.
  • Metabolic rates can be calculated by any methods known in the art, for example, by examining the oxygen input and carbon dioxide output, or by indirect calorimetry.
  • the metabolic rate is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%. In other embodiments, the metabolic rate is increased by at least 1-5%, 5-10%, 10-20%, 1- 30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator affects glucose uptake by tissues in the human subject.
  • glucose uptake by muscle tissue is increased.
  • glucose uptake by the muscle tissue is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • glucose uptake by the muscle tissue is increased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10- 50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • glucose uptake by white adipose tissue, liver tissue and/or blood vessel tissue are reduced.
  • glucose uptake by white adipose tissue, livertissue and/or blood vessel tissue are reduced by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • glucose uptake by white adipose tissue, liver tissue and/or blood vessel tissue are reduced by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20- 60%, 30-80%, 40-90%, or 50-100%.
  • treatment of a subject with a myostatin pathway inhibitor alone or in conjunction with a GLP-1 pathway activator reduces non-fasted glucose levels in the serum of the subject relative to baseline prior to treatment.
  • non-fasted glucose levels refers to glucose content in a subject’s blood as measured without having to fast or refraining from eating or drinking for a prolonged period of time, e.g., 8 hours.
  • Blood glucose can be measured using a hemoglobin A1 C test, also known as an A1 C, HbA1 C, glycated hemoglobin, or glycosylated hemoglobin test. Conventional home glucose monitoring can also be used to measure blood sugar.
  • postprandial insulin level refers to the insulin concentration in a subject’s blood shortly after eating (e.g., two hours after eating).
  • postprandial glucose level refers to glucose concentrations in a subject’s blood shortly after eating (e.g., two hours after eating).
  • the postprandial insulin and glucose levels may be affected by carbohydrate absorption, insulin and glucagon secretion, and their coordinated effects on glucose metabolism in the liver and peripheral tissues.
  • the magnitude and time of the peak plasma insulin or glucose concentration depend on a variety of factors, including the timing, quantity, and composition of the meal. In non-diabetic human subjects, plasma glucose concentrations peak about 60 min after the start of a meal and return to preprandial levels within 2-3 hour.
  • Postprandial insulin levels may be measured using a postprandial insulin test, such as a two-hour postprandial insulin test.
  • Postprandial glucose levels may be measured using a postprandial blood glucose test, such as a two-hour postprandial blood glucose test.
  • administration of the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator increases insulin sensitivity of the human subject.
  • Methods for measuring insulin sensitivity are known in the art, for example, glucose tolerance test, and fasting insulin or glucose test. During a glucose tolerance test, a fasting patient takes a 75-gram oral dose of glucose, and then blood glucose levels are measured over the following two hours.
  • a glycemic level less than 7.8 mmol/L (140 mg/dl) is considered normal, a glycemic level of between 7.8 and 11 .0 mmol/L (140 to 197 mg/dl) is considered as impaired glucose tolerance (IGT), and a glycemic level of greater than or equal to 11.1 mmol/L (200 mg/dl) is considered as diabetes mellitus.
  • ITT impaired glucose tolerance
  • a fasting serum insulin level greater than 25 mlU/L or 174 pmol/L is considered insulin resistant.
  • a subject may follow a diet for two weeks comprising at least 150g carbohydrate per day.
  • a patient has an oral glucose tolerance test with samples obtained at baselines and again at 30, 60, 120, and 180 minutes.
  • a sum of the 2nd and 3rd hour insulin less than 60 pU/mL is considered to be within the normal range.
  • Borderline hyperinsulinemia or borderline insulin resistance is indicated when the sum of the 2nd and 3rd hour insulins are 60 or higher but less than 100.
  • Hyperinsulinemia may be indicated when the sum of the 2nd and 3rd hour insulins are 100 or more, when there is a delayed insulin peak in hours 2 or 3, or when fasting insulin is above 50. (see, e.g., DiNicolantonio, JJ, et. al.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator increases insulin dependent glycemic control in the human subject.
  • insulin dependent glycemic control is increased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • insulin dependent glycemic control is increased by at least 1-5%, 5- 10%, 10-20%, 1-30%, 1-40%, 1-50%, 10-50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator as described herein may prevent development of a metabolic disorder in the subject, e.g., a human subject.
  • development of a metabolic disorder is decreased by at least 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90% or 100%.
  • development of a metabolic disorder is decreased by at least 1-5%, 5-10%, 10-20%, 1-30%, 1-40%, 1 -50%, 10- 50%, 20-30%, 20-60%, 30-80%, 40-90%, or 50-100%.
  • a myostatin pathway inhibitor reduces a risk of a cardiovascular disease, e.g., by reducing levels of cholesterol and or the LDL/HDL ratio.
  • Cholesterol encompasses both low-density lipoprotein (LDL) cholesterol and high-density lipoprotein (HDL) cholesterol.
  • Total cholesterol level refers to a measure of the total amount of cholesterol (e.g., LDL and HDL) in a blood sample collected from a subject.
  • LDL cholesterol contains low-density lipoprotein that makes up most of the cholesterol found in the body.
  • a high level of LDL may cause lipid deposits (e.g., plaques) in arteries and may be associated with or linked to increased risk for cardiovascular conditions, such as heart disease and stroke.
  • HDL cholesterol contains high-density lipoprotein, which absorbs cholesterol and carries it back to the liver.
  • a high level of HDL cholesterol is associated with lower risk of heart disease and stroke.
  • Cholesterol levels can be measured using a blood test, including blood tests commonly known as complete cholesterol tests, lipid panels, or lipid profiles.
  • a suitable subject is a subject who has not fully developed a metabolic disease but is considered at risk of developing such a condition.
  • a subject has a disease or condition associated with muscle dysfunction.
  • the muscle dysfunction is associated with partial denervation of motor neurons, which causes partial impairment of function in the affected muscle.
  • such conditions are caused by muscular dystrophy or atrophy.
  • such condition is caused by SCI.
  • the subject with SCI is in an acute or sub-acute phase of SCI (e.g., not yet reached a chronic phase).
  • compositions comprising an effective amount of an inhibitor of myostatin signaling described herein (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) is administered to a population of patients who are at risk of developing a metabolic disorder associated with muscle dysfunction
  • the composition i) prevents manifestation or aggravation of the metabolic disorder in a statistically significant fraction of the patient population; or, ii) lessens the severity of the metabolic disorder in the statistically significant fraction of the patient population.
  • the inhibitor of myostatin signaling is administered in conjunction with a GLP-1 pathway activator.
  • effects on metabolism may be monitored or measured by insulin resistance, lipid panel/markers (e.g., leptin, adiponectin, ghrelin), inflammatory markers and oxidative stress markers, including, but are not limited to: IL-6, TNF, CRP, plasma total antioxidant status, lipid oxidation and erythrocyte glutathione peroxidase activity.
  • lipid panel/markers e.g., leptin, adiponectin, ghrelin
  • inflammatory markers and oxidative stress markers including, but are not limited to: IL-6, TNF, CRP, plasma total antioxidant status, lipid oxidation and erythrocyte glutathione peroxidase activity.
  • Myostatin pathway inhibitors and GLP-1 pathway activators described herein may be formulated into one or more pharmaceutical compositions suitable for administration in human or non-human subjects.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are co-formulated in one composition.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator may be co-formulated for intravenous (i.v.) or subcutaneous (s.c.) administration.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are formulated for separate administration to human or non-human subjects (e.g., mammals).
  • a myostatin pathway inhibitor may be formulated for i.v.
  • administration and a GLP-1 pathway activator may be formulated for s.c. or oral administration.
  • the myostatin pathway inhibitor is formulated for s.c. administration.
  • the dosing schedule forthe myostatin pathway inhibitor and the GLP-1 pathway activator may require administration on different days or at different times.
  • the myostatin pathway inhibitor and GLP-1 pathway activator may be administered concurrently, separately, or simultaneously.
  • Such pharmaceutical compositions may be intended for therapeutic use or prophylactic use.
  • One or more of the myostatin pathway inhibitors and/or GLP-1 pathway activators can be mixed with a pharmaceutically acceptable carrier (excipient), including buffer, to form a pharmaceutical composition for administering to a patient who may benefit from reduced myostatin signaling and GLP-1 pathway activation in vivo.
  • a pharmaceutically acceptable carrier including buffer
  • “Pharmaceutically acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Examples of pharmaceutically acceptable excipients (carriers), including buffers, would be apparent to the skilled artisan and have been described previously.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins
  • the pharmaceutical composition described herein comprises emulsion-based or lipid- based formulations, such as liposomes containing a myostatin inhibitor and/or a GLP-1 pathway activator, which can be prepared by any suitable method, such as described in Epstein, et al. , Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • PEG-PE PEG-derivatized phosphatidylethanolamine
  • the myostatin inhibitor and/or the GLP-1 pathway activator may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Exemplary techniques have been described previously, see, e.g., Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
  • the pharmaceutical composition described herein can be formulated in sustained-release format.
  • sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the myostatin inhibitor and/or the GLP-1 pathway activator, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and 7 ethyl-L-glutamate copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D- (-)-3-hydroxy butyric acid.
  • LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
  • sucrose acetate isobutyrate sucrose acetate isobutyrate
  • poly-D- (-)-3-hydroxy butyric acid poly-D- (-)-3-hydroxy butyric acid.
  • compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes.
  • Therapeutic antibody compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • compositions described herein comprising the myostatin inhibitor and the GLP-1 pathway activator can be in unit dosage forms (either separately or together) such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral, or rectal administration, or administration by inhalation or insufflation.
  • the principal active ingredient can be mixed with a pharmaceutical carrier, e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present disclosure, or a non-toxic pharmaceutically acceptable salt thereof.
  • a pharmaceutical carrier e.g., conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g., water
  • preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules.
  • This solid preformulation composition is then subdivided into unit dosage forms of the type described above containing from 0.1 mg to about 500 mg of the active ingredient of the present disclosure.
  • the tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
  • the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
  • the two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum orto be delayed in release.
  • enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
  • Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g. TweenTM 20, 40, 60, 80 or 85) and other sorbitans (e.g. SpanTM 20, 40, 60, 80 or 85).
  • Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
  • Suitable emulsions may be prepared using commercially available fat emulsions, such as IntralipidTM, LiposynTM, InfonutrolTM, LipofundinTM and LipiphysanTM.
  • the active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g. soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g. egg phospholipids, soybean phospholipids or soybean lecithin) and water.
  • a phospholipid e.g. egg phospholipids, soybean phospholipids or soybean lecithin
  • Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.
  • the emulsion compositions can be those prepared by mixing an anti-pro-myostatin antibody with IntralipidTM or the components thereof (soybean oil, egg phospholipids, glycerol and water).
  • compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
  • the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above.
  • the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
  • compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension, or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner. Kits
  • kits including disposable and/or kits for self-administration for use in alleviating diseases/disorders associated with a metabolic disorder.
  • kits can include one or more containers comprising a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator, e.g., any of those described herein.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are provided in the same container.
  • the container is a syringe.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator are provided in separate containers.
  • the kit can comprise instructions for use in accordance with any of the methods described herein.
  • the included instructions can comprise a description of administration of the myostatin pathway inhibitor and the GLP-1 pathway activator to treat, delay the onset, or alleviate a target disease as those described herein.
  • the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has the target disease.
  • the instructions comprise a description of administering an antibody and a GLP-1 pathway activator (e.g., a peptide hormone mimetic) to an individual at risk of the target disease.
  • the instructions relating to the use of a myostatin pathway inhibitor generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
  • the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
  • Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
  • the label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating a disease or disorder associated with metabolic syndrome, diabetes, or obesity. Instructions may be provided for practicing any of the methods described herein.
  • kits of this disclosure are in suitable packaging.
  • suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar® or plastic bags), and the like.
  • packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
  • a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • a sterile access port for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle.
  • At least one active agent in the composition is an anti- pro/latent-myostatin antibody, or antigen binding fragment thereof, as those described herein.
  • Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiments, the disclosure provides articles of manufacture comprising contents of the kits described above.
  • compositions and therapeutic regimens described herein are suitable for administration in human or non-human subjects, e.g., mammalian subjects. Accordingly, treatment regimens comprising a myostatin inhibitor in conjunction with a GLP-1 pathway activator (e.g., GLP-1 analogs such as liraglutide) are useful for administering to a subject who is likely to benefit from reduced myostatin signaling and increased insulin production.
  • suitable subjects include healthy individuals who may nonetheless benefit from enhanced muscle mass/function, as well as improved metabolism.
  • suitable subjects have an existing muscle condition and/or associated metabolic dysfunction.
  • suitable subjects are at risk of developing such condition(s).
  • suitable subjects are those on a therapy comprising another therapeutic agent to treat a muscle/metabolic condition, but which is associated with adverse effects or toxicity.
  • the subject is a human patient of between birth and ⁇ 18 years of age.
  • the subject is a human subject (child or adolescent) aged 2-19 years, inclusive of endpoints.
  • the subject is a human subject aged 12 years or older (e.g., 12-17 years), inclusive of endpoints.
  • preferred subjects include subjects (e.g., mammalian subjects) with obesity or who are overweight, e.g., those with at least one weight-related condition (such as diabetes mellitus type 2, high blood pressure, cardiovascular disease, or high cholesterol), including overweight subjects with a body mass index (BMI) of 27 kg/m 2 or greater.
  • BMI body mass index
  • a subject having obesity has a BMI of 28 to 40, inclusive of endpoints.
  • a subject having obesity has a BMI of 30 kg/m 2 or greater.
  • a subject having a BMI of 27 kg/m 2 or greater is considered overweight and a subject having a BMI of 30 kg/m2 or greater is considered obese according to European Medicines Agency Guideline on Clinical Evaluation of Medicinal Products Used in Weight Management.
  • the subjects are on a reduced calorie diet and/or an exercise regimen.
  • the subjects have a metabolic disorder.
  • the subject has an excess of abdominal fat.
  • Table 4 and Table 5 below show BMI ranges that may be used for overweight and obesity.
  • An online tool for gauging the BMIs of adults can be found at: https://www.cdc.gov.
  • a subject having obesity is obese and well, wherein the subject carries excess weight but does not have any comorbidities or risk factors for comorbid conditions and who does not experience any impairments in their daily feeling or functioning.
  • a subject having obesity is obese with risk factors, wherein the subject carries excess weight and does not yet have any comorbidities, but wherein the subject has measurable risk factors for comorbid conditions and/or impairments to their daily feeling or functioning.
  • the subject may be at risk for insulin resistance, glucose intolerance, hypertension, cardiovascular disease, dyslipidemia, hyperuricemia, type 2 diabetes, stroke, fatty liver disease, kidney disease and other health issues.
  • a subject having obesity is obese and sick, wherein the subject carries excess weight and has one or more obesity-attributable comorbidities and impairments to their daily feeling or functioning.
  • a subject having obesity is evaluated using the Edmonton Obesity Staging System (EOSS), a 5-point ordinal classification system that considers comorbidity and functional status, as shown in Table 6
  • EOSS Edmonton Obesity Staging System
  • a medicament disclosed herein is suitable for administration in a pediatric population, adult population, and/or an elderly population.
  • such medicament is suitable for administration in a subject aged 2-19 years, inclusive of endpoints.
  • such medicament is suitable for administration in a subject aged 12 years or older (e.g., 12-17 years), inclusive of endpoints.
  • the population in need for the myostatin inhibitor in combination with a GLP-1 path way agonist as described herein may range between 0 and 6 months of age, between 0 and 12 months of age, between 0 and 18 months of age, between 0 and 24 months of age, between 0 and 36 months of age, between 0 and 72 months of age, between 6 and 36 months of age, between 6 and 36 months of age, between 6 and 72 months of age, between 12 and 36 months of age, between 12 and 72 months of age.
  • the pediatric population suitable for receiving the myostatin inhibitor, e.g., antibody or antigen-binding fragment, described herein who is likely to benefit from such treatment may range between 0 and 6 years of age, between 0 and 12 years of age, between 3 and 12 years of age, between 0 and 17 years of age. In some embodiments, the population has an age of at least 5 years, e.g., 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, or 17 years. In some embodiments, the pediatric population may be aged below 18 years old. In some embodiments, the pediatric population may be (a) at least 5 years of age and (b) below 18 years of age.
  • the adult population in need for therapy comprising a myostatin inhibitor and a GLP-1 pathway activator as described herein may have an age of at least 20 years, e.g., at least 20, 25, 30, 35, 40, 45, 50, 55, 60 or 65 years. In some embodiments, the adult population may be below 65 years of age. In some embodiments, the adult population may be below 75 years of age.
  • the elderly population in need for therapy comprising a myostatin inhibitor and a GLP-1 pathway activator as described herein may have an age of 65 years or older (i.e. , > 65 years old), e.g., at least 70, 75 or 80 years.
  • a human subject who is likely to benefit from the treatment comprising a myostatin inhibitor and a GLP-1 pathway activator may be a human patient having, at risk of developing, or suspected of having a metabolic disease/disorder.
  • a subject having a metabolic disease or disorder e.g., obesity, type 2 diabetes mellitus (T2DM), etc.
  • T2DM type 2 diabetes mellitus
  • a subject suspected of having any of such disease/disorder might show one or more symptoms of the metabolic disease/disorder.
  • a subject at risk for the metabolic disease/disorder can be a subject having one or more of the risk factors for that metabolic disease/disorder.
  • a human subject who is likely to benefit from the treatment comprising a myostatin inhibitor and a GLP-1 pathway activator may be a human subject having T2DM with a hemoglobin A1 c (HbA1 c) between 5% and 15% (e.g., between 6.5% and 10%, inclusive of endpoints).
  • HbA1 c hemoglobin A1 c
  • a human subject who is likely to benefit from the treatment comprising a myostatin inhibitor and a GLP-1 pathway activator may be a human subject having T2DM who has been on an anti-diabetic treatment for at least 3 months. In some embodiments, the subject has been on an anti-diabetic treatment for approximately 3 months. In some embodiments, the subject has been on an anti-diabetic treatment for at least 6 months.
  • a human subject who is likely to benefit from the treatment comprising a myostatin inhibitor and a GLP-1 pathway activator may be a human subject having a body weight of at least 70 kg. In some embodiments, the subject has a body weight of at least 80 kg. In some embodiments, the subject has a body weight of 80 to 140 kg, inclusive of endpoints. In some embodiments, the subject has a body weight of more than 140 kg.
  • a control subject as described herein, is a subject who provides an appropriate reference for evaluating the effects of a particular treatment or intervention of a test subject or subject.
  • Control subjects can be of similar age, race, gender, weight, height, and/or other features, or any combination thereof, to the test subjects.
  • a myostatin assay (e.g., myostatin ELISA) is used to identify a subject requiring treatment of a myostatin inhibitor and a GLP-1 pathway activator.
  • myostatin assay can be found in Lakshman et al. Molecular and Cell Endocrinology (2009) 302:26-32 (myostatin ELISA) and Bergen et al. Skeletal Muscle (2015) 5:21 (liquid chromatography with tandem mass spectrometry, both of which are incorporated by reference herein.
  • a GLP-1 assay (e.g., a measurement of circulating GLP-1) is used to identify a subject requiring treatment of a myostatin inhibitor and a GLP-1 pathway activator.
  • Circulating levels of GLP-1 and other incretin hormones may be determined by enzyme-linked immunosorbent assay (ELISA) and/or other methods known in the art. Circulating levels of GLP-1 level may be determined, e.g., by using a commercially available quantitative.
  • muscle performance generally refers to the capacity of the muscle to contract and/or to apply a force (e.g., to an external object).
  • muscle performance may relate to the capacity of the muscle to consume energy.
  • muscle performance may relate to the capacity of the muscle to produce and/or consume adenosine triphosphate (ATP) molecules to facilitate muscle contraction.
  • muscle performance refers to the capacity of the muscle to contract repeatedly for a particular duration of time.
  • muscle performance refers to the capacity of the muscle to apply a force to an object, e.g., to move the object over a measurable distance.
  • muscle performance refers to the capacity of the muscle to apply a force to an object for a particular duration of time (e.g., to move the object over a measurable distance for a particular duration of time).
  • the combination of a myostatin inhibitor and a GLP-1 pathway activator, described herein is administered to a subject in need of the treatment at an amount sufficient to inhibit the proteolytic activation of pro/latent-myostatin to active myostatin by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo.
  • a myostatin inhibitor e.g., antibody or antigen-binding portion thereof, is administered in an amount effective in reducing the pro/latent-myostatin or latent myostatin level by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater).
  • the combination of a myostatin inhibitor and a GLP-1 pathway activator, described herein is administered to a subject in need of the treatment at an amount sufficient to inhibit the proteolytic activation of pro/latent-myostatin to active myostatin by at least 20% (e.g., 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater) in vivo and/or at an amount sufficient to enhance insulin secretion or inhibit glucagon secretion by at least 0.5, 1 .0, 1 .5, 2.0. 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, or 10.0 fold.
  • the myostatin inhibitor e.g., anti-pro/latent-myostatin antibody or antigen-binding portion thereof, described herein is administered to a subject who will benefit from increased muscle mass.
  • the combination of a myostatin inhibitor and a GLP-1 pathway activator is administered to a subject who will benefit from increased muscle-to-fat ratios.
  • the combination described herein is administered to a subject who will benefit from increased muscle function.
  • the subject may or may not have or be at risk of having a condition associated with decreased muscle mass and/or decreased muscle function.
  • the subject has or is at risk of having a condition associated with decreased muscle mass and/or decreased muscle function.
  • the methods of the present invention further comprise selecting a patient (subject) or a patient population who is likely to benefit from the combination or adjunct (add-on) therapy described herein.
  • the subject suffers from or is at risk of developing a muscle condition or disorder.
  • the subject suffers from or is at risk of developing a metabolic disorder.
  • the subject suffers or is at risk of developing a disease or disorder associated with impaired neurological signaling.
  • Patient selection may be based on the responsiveness of a patient to another therapy aimed to treat a metabolic disease such as obesity or type 2 diabetes. Patients who respond poorly to such therapy may have an enhanced response to the therapy when used in conjunction with, complementary to, as an adjunct therapy or as an add-on therapy with a myostatin pathway inhibitor.
  • a myostatin pathway inhibitor is used in the treatment of a metabolic disease in a patient, wherein the treatment comprises administration of the myostatin pathway inhibitor to the patient who has received another therapy aimed to treat the metabolic disease but has failed to achieve an intended therapeutic goal or expected therapeutic outcome, wherein optionally, the myostatin pathway inhibitor is a myostatin-selective inhibitor, and wherein further optionally the metabolic disease is obesity/overweight and/or type 2 diabetes.
  • said “another therapy aimed to treat the metabolic disease” is or comprises a GLP-1 receptor agonist.
  • Examples of the other therapies including those comprising GLP-1 receptor agonist, include, without limitation, albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002, glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, dulaglutide, danuglipron (Pfizer).
  • GLP-1 receptor agonist/GIP receptor antagonist combination such as AMG 133 (Amgen); GLP-1/GIP dual agonists such as tirzepatide (LY3298176; Eli Lilly) and CT-388; amylin/GLP-1 combination such as cagrilintide/semaglutide combination (Novo Nordisk); GLP-1/glucagon combination such as DD01 (Neuraly); GLP-1/glucagon combination such as ALT-801 (Altimmune), GLP-1/GIP such as CT-388 (Carmot); GLP-1 /glucagon dual agonist such as IBI362 (LY-330567 (Innovent/Eli Lilly), danuglipron (PF-06882961) (Pfizer), setmelanotide (Rhythm), MEDI0382; and GLP-1/GIP/Glucagon triple receptor agonist such as LY3437943 (Eli Li Li), danuglipron (PF-06882961) (Pfizer), setmela
  • the intended therapeutic goal or expected therapeutic outcome is a reduction of body weight (percent change from baseline) of at least 5% or at least 10%, reduced BMI, reduced waist circumference, reduced fat mass, increased lean to fat mass ratio, and/or improved insulin sensitivity.
  • Patient selection may be based on a patient’s ability to perform or adhere to a therapeutic regimen for a weight management treatment.
  • a myostatin pathway inhibitor is used in the treatment of a metabolic disease in a patient wherein the treatment comprises administration of the myostatin pathway inhibitor to the patient who is on a weight management therapy such as a GLP-1 pathway activator and who cannot or fails to perform or continue a reduced calorie regimen and/or an exercise regimen intended as part of the GLP-1 pathway activator therapy.
  • Patient selection may be based on background therapy or therapies that the patient is receiving.
  • the background therapies may be standard-of-care medications for weight management and/or diabetes.
  • a myostatin-selective inhibitor is used in the treatment of obesity/overweight in a patient, wherein the treatment comprises administration of the myostatin-selective inhibitor to the patient who is on a background therapy containing a biguanide such as metformin or a derivative thereof.
  • metaformin examples include Fortamet, Glucophage, Glucophage XR, Glumetza, Riomet, Obimet, Gluformin, Dianben, Diabex, Diaformin, Metsol, Siofor, Metforgamma and Glifor, as well as metformin-containing medications that include additional active. Examples include, but are not limited to, thiazolidinediones (glitazones) and rosiglitazone.
  • a myostatin selective inhibitor is used to treat an overweight or an obese patient wherein the treatment comprises administering the myostatin selective inhibitor to a patient who is on a medication for type 2 diabetes.
  • the anti-diabetic medication may be an alpha-glucosidase inhibitor; a dipeptidyl peptidase-4 (DPP-4) inhibitor such as alogliptin, linagliptin, saxagliptin or sitagliptin; a sodium-glucose cotransporter-2 (SGLT- 2) inhibitor such as dapagliflozin, canagliflozin, empagliflozin, or ertugliflozin; a sulfonylurea; or a thiazolidinedione.
  • DPP-4 dipeptidyl peptidase-4
  • SGLT- 2 sodium-glucose cotransporter-2
  • an effective amount of the pharmaceutical composition described above can be administered to a subject (e.g., a mammalian subject) in need of the treatment via a suitable route, such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes.
  • a suitable route such as intravenous administration, e.g., as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, inhalation or topical routes.
  • the administration is subcutaneous.
  • nebulizers for liquid formulations including jet nebulizers and ultrasonic nebulizers may also be useful for administration.
  • Liquid formulations can be directly nebulized, and lyophilized powder can be nebulized after reconstitution.
  • anti-pro/latent-myostatin antibodies can be aerosolized using a fluorocarbon formulation and a metered dose inhaler or inhaled as a lyophilized and milled powder.
  • compositions can be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
  • parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques.
  • injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
  • the composition comprising a myostatin pathway inhibitor (such as myostatin inhibitor) is formulated for subcutaneous administration.
  • the composition contains both the myostatin pathway inhibitor and a GLP-1 pathway activator in the same formulation.
  • separate formulations may be used.
  • Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
  • water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically-acceptable excipient is infused.
  • Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer’s solution or other suitable excipients.
  • Intramuscular preparations e.g., a sterile formulation of a suitable soluble salt form of the antibody
  • a pharmaceutical excipient such as water-for-injection, 0.9% saline, or 5% glucose solution.
  • a myostatin inhibitor e.g., anti-pro/latent-myostatin antibody or antigen-binding portion thereof
  • site-specific or targeted local delivery techniques include various implantable depot sources of the myostatin inhibitor, e.g., anti-pro/latent- myostatin antibody or antigen-binding portion thereof, or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No.
  • the particular dosage regimen, e.g., dose, timing and repetition, used in the methods described herein will depend on the particular subject and that subject's medical history as well as the formulation and pharmacokinetic properties of each drug administered, e.g., the myostatin inhibitor and the GLP-1 pathway activator.
  • Treatment efficacy for a disease/disorder associated with metabolic syndrome can be assessed using any suitable methods.
  • the increase in the context of an increase in the level of pro-myostatin in the target muscle, is at least 1-fold, 1 .2-fold, 1 .5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10- fold or more (or any range bracketed by any of the values), compared to a control level of pro-myostatin.
  • the increase in the level of pro-myostatin in the target muscle is an increase in a range of 1-fold to 3- fold, 1 .2-fold to 10-fold, 2-fold to 9-fold, 3-fold to 8-fold, 4-fold to 7-fold, 2-fold to 7-fold, etc. compared to the control level of pro-myostatin.
  • control level refers to an accepted or pre-determined level of a biological marker, e.g., a level of a marker obtained before treatment or the onset of disease or before administration of a drug, e.g., an antibody or an antigen-binding portion thereof.
  • a biological marker e.g., a level of a marker obtained before treatment or the onset of disease or before administration of a drug, e.g., an antibody or an antigen-binding portion thereof.
  • the level of a biological marker present in a subject or population of subjects having one or more particular characteristics, e.g., the presence or absence of a particular disease or condition.
  • the increase in the context of an increase in latent myostatin in the target muscle after the administering step, is detectable within 4 hours, 24 hours, 48 hours, 7 days, 14 days, 21 days, 28 days or 30 days (or any time range bracketed by any of the listed duration of times) after the administering step.
  • an increase in latent myostatin in the target muscle after the administering step is detectable for at least 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days (or any time range bracketed by any of the listed duration of times) after the administering step.
  • an increase in the level of latent myostatin in the target muscle after the administering step is at least 1-fold, 1.2-fold, 1.5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5- fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold or more (or any range bracketed by any of the values), compared to the level of latent myostatin in the target muscle before the administering step.
  • an increase in the level of latent myostatin in the target muscle after the administering step is an increase in a range of 1-fold to 3- fold, 1 .2-fold to 10-fold, 2-fold to 9-fold, 3-fold to 8-fold, 4-fold to 7-fold, 2-fold to 7-fold, etc., compared to the level of latent myostatin in the target muscle before the administering step.
  • an increase in the context of an increase in latent myostatin in the circulation after the administering step, an increase is detectable within 4 hours, 24 hours, 48 hours, 7 days, 14 days, 21 days, 28 days, or 30 days (or any time range bracketed by any of the listed duration of times) after the administering step.
  • an increase in latent myostatin in the circulation after the administering step is detectable for at least 5 days, 7 days, 14 days, 21 days, 28 days, or 30 days (or any time range bracketed by any of the listed duration of times) after the administering step.
  • an increase in the level of latent myostatin in the circulation afterthe administering step is at least 1-fold, 2-fold, 3-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 35-fold, 40-fold, 45-fold, or 50-fold or more (or any range bracketed by any of the values), compared to the level of latent myostatin in the circulation before the administering step.
  • an increase in the level of latent myostatin in the target muscle after the administering step is an increase in a range of 1-fold to 3-fold, 1 .2-fold to 10-fold, 2-fold to 9-fold, 3-fold to 8-fold, 4-fold to 7-fold, 2-fold to 7-fold, etc., compared to the level of latent myostatin in the target muscle before the administering step.
  • the decrease in the context of a decrease in the level of latent myostatin in the circulation, is at least 1-fold, 1 .2-fold, 1 .5-fold, 2-fold, 2.5-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10- fold or more (or any range bracketed by any of the values), compared to a control level of latent myostatin.
  • a decrease in the level of latent myostatin in the circulation is a decrease in a range of 1-fold to 3- fold, 1 .2-fold to 10-fold, 2-fold to 9-fold, 3-fold to 8-fold, 4-fold to 7-fold, 2-fold to 7-fold, etc.
  • the myostatin inhibitor may be adjunct therapy, add-on therapy, used in combination with or be complementary to the GLP-1 pathway activator.
  • an effective amount is an amount effective to increase mass of a target muscle in the subject compared with a control muscle mass.
  • the mass of a muscle treated with an effective amount of the combination therapy is increased by at least 1 %, at least 2%, at least 3%, at least 4%, at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 11 %, at least 12%, at least 13%, at least 14%, at least 15%, at least 16%, at least 17%, at least 18%, at least 19%, at least 20%, etc. as compared with a control muscle that is not treated with an effective amount of the combination.
  • such a muscle mass increase is achieved in a select group or type of muscles in the subject.
  • an effective amount is an amount effective to maintain muscle mass in a subject (e.g., a mammal) throughout treatment with a myostatin inhibitor and a GLP-1 pathway activator.
  • a subject receiving the combination treatment may retain muscle mass as fat mass is reduced.
  • an effective amount is an amount effective to reduce loss of mass in a target muscle in a subject compared with a control muscle mass, during and/or after the treatment with the combination therapy.
  • control in reference to a control sample refers to any clinically or scientifically relevant comparative sample or counterpart, including, for example, a sample from a healthy subject, a sample from a subject having a deficiency that can cause or make the subject susceptible to a certain disease or condition, a subject with a disease or condition of interest, a sample from a subject treated with a pharmaceutical carrier, a sample from a subject prior to treatment, a sham or buffer treated subject or sample, an untreated subject or sample, and the like.
  • an effective amount is an amount effective to reduce overall body weight.
  • body weight of a subject treated with an effective amount of the combination therapy is decreased by at least 5%, at least 6%, at least 7%, at least 8%, at least 9%, at least 10%, at least 11 %, at least 12%, at least 13%, at least 14%, at least 15%, at least 16%, at least 17%, at least 18%, at least 19%, at least 20%, etc. as compared to a subject receiving a GLP-1 pathway activator alone.
  • the reduction in body weight of a subject treated with an effective amount of the combination therapy is predominantly due to reduction of fat mass as determined by qNMR.
  • an effective amount is an amount effective to switch fiber types in the subject.
  • an effective amount of the combination therapy can promote a fiber type switch from type I to type II.
  • an effective amount of the combination therapy can promote a fiber type switch from type I to type MB.
  • an effective amount of the combination therapy can promote type II fibers, relative to other types of fibers.
  • an effective amount of the combination therapy can promote type MB fibers, relative to other types of fibers.
  • such phenotypic switch in fibers may occur without significant change in overall muscle mass. In other embodiments, such phenotypic switch in fibers may coincide an increase in overall muscle mass.
  • an effective amount is an amount effective to increase diameter of muscle fiber in the subject compared with a control muscle fiber.
  • the increase in the diameter of the muscle fiber is an increase of at least 1 .1-fold, at least 1 .2-fold, at least 1 .3-fold, at least 1 .4-fold, at least 1 .5- fold, at least 1 .6-fold , at least 1 .7-fold, at least 1 .8-fold, at least 1 .9-fold, at least 2-fold, at least 4-fold, at least 5- fold or more compared with a control muscle fiber.
  • the increase in the diameter of muscle fiber is an increase in a range of 1-fold to 5-fold, 2-fold to 10-fold, 1-fold to 1 .5-fold, 1-fold to 2-fold, etc. compared with a control muscle fiber.
  • an effective amount is an amount effective to increase muscle-to-fat ratio in the subject compared with a control muscle mass.
  • the increase in the muscle-to-fat ratio is an increase of at least 1.1-fold, at least 1 .2-fold, at least 1 .3-fold, at least 1 .4- fold, at least 1 .5-fold, at least 1 .6-fold, at least 1 .7-fold, at least 1 .8-fold, at least 1 .9-fold, at least 2-fold, at least 4- fold, at least 5-fold or more compared with a control subject.
  • the increase in the muscle- to-fat ratio is an increase in a range of 1-fold to 5-fold, 2-fold to 10-fold, 1-fold to 1.5-fold, 1-fold to 2-fold, etc. compared with a control subject.
  • an effective amount is an amount effective to decrease intramuscular fat infiltration in the subject compared with a control muscle mass.
  • the decrease in the intramuscular fat infiltration is a decrease of at least 1 .1-fold, at least 1 .2-fold, at least 1 .3-fold, at least 1 .4-fold, at least 1 .5-fold, at least 1.6-fold, at least 1.7-fold, at least 1.8-fold, at least 1.9-fold, at least 2-fold, at least 4-fold, at least 5-fold or more compared with a control subject.
  • the decrease in intramuscular fat infiltration is a decrease in a range of 1-fold to 5-fold, 2-fold to 10-fold, 1-fold to 1.5-fold, 1-fold to 2-fold, etc. compared with a control subject.
  • a method of preventing a reduction of and/or increasing muscle mass in a human subject includes administering a myostatin inhibitor in conjunction with a GLP-1 pathway activator to a subject wherein the combination therapy inhibits proteolytic formation of mature myostatin by a tolloid protease.
  • the combination therapy inhibits proteolytic formation of mature myostatin by a tolloid protease.
  • inhibition of proteolytic cleavage of pro-myostatin or latent myostatin by a tolloid protease results in a progressive or sustained increase in muscle mass.
  • a subject exhibits a progressive increase in muscle mass for at least 2 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 14 weeks, 16 weeks, 18 weeks, or 20 weeks (or any range bracketed by any of the values).
  • a method of preventing a reduction of and/or increasing muscle mass in a human subject includes administering a myostatin inhibitor, e.g., a pro/latent-myostatin antibody, or antigen binding fragment thereof, to a subject comprising more than two doses.
  • administering the combination therapy comprises at least a first dose and a second dose, the first dose and the second dose are administered to the subject at least about one week apart, 2 weeks apart, 4 weeks apart, 6 weeks apart, 8 weeks apart, or 12 weeks apart.
  • control muscle mass refers to a reference standard useful for evaluating effects of a condition (e.g., treatment with a myostatin inhibitor and a GLP-1 pathway activator on the mass of a target muscle in a subject.
  • the target muscle is a gastrocnemius muscle.
  • a control muscle mass is a predetermined value.
  • a control muscle mass is experimentally determined.
  • a control muscle mass is the mass of a target muscle in a subject who has not been administered the myostatin inhibitor, e.g., pro/latent-myostatin antibody, or antigen binding fragment thereof.
  • a control muscle mass is the mass (e.g., the average mass) of a target muscle in a population of subjects who have not been administered the combination therapy. In some embodiments, a control muscle mass is the mass of a target muscle in a subject prior to (e.g., immediately prior to) being administered the combination therapy.
  • a control muscle mass is the mass of a target muscle in a subject who has been administered, in place of the myostatin inhibitor, (e.g., an anti-myostatin antibody), a normal antibody (e.g., of the same isotype as the anti-myostatin antibody) that has been obtained from an animal that has not been exposed to the antigen to which the anti-myostatin antibody, or antigen binding fragment thereof, is directed.
  • a control muscle mass is the mass of a target muscle in a subject who has been administered, in place ofthe myostatin inhibitor, e.g., pro/latent-myostatin antibody, or antigen binding fragment thereof, a vehicle, e.g., saline.
  • Empirical considerations such as the half-life, generally will contribute to the determination of the dosage.
  • antibodies and antigen-binding portions thereof that are compatible with the human immune system such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the antibody and to prevent the antibody being attacked by the host's immune system.
  • the pharmacokinetic properties of small peptides e.g., peptide hormones such as incretins, may be improved by tethering the peptide to a bulkier molecule (such as BSA) or modifying recognition sites for peptidases such as DPP-IV by, e.g., acylation or amino acid substitution.
  • Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a disease/disorder associated with a metabolic disorder such as obesity, diabetes, or metabolic syndrome.
  • sustained continuous release formulations of a myostatin inhibitor and/or a GLP-1 pathway activator may be appropriate.
  • Various formulations and devices for achieving sustained release would be apparent to the skilled artisan and are within the scope of this disclosure.
  • Dosage regimens for a GLP-1 pathway activator are in part dependent on the mode of administration, and additionally may be dependent on the pharmacokinetics of the particular drug substance.
  • exenatide based on exendin-4
  • exenatide may be administered to a mammal (e.g., a human) subcutaneously at an initial dose of 5 pg twice daily, with a maintenance dose of 5-10 pg twice daily, within 1 hour before morning and evening meals, and approximately 6 or more hours apart.
  • Extended release exenatide (exenatide ER) may be administered to a mammal (e.g., a human) subcutaneously at a dose of 2 mg once daily with or without food.
  • Lixisenatide (based on exendin-4) may be administered to a mammal (e.g., a human) subcutaneously at an initial dose of 10 pg once daily, with a maintenance dose of 20 pg once daily, within an hour before the first meal of the day.
  • Liraglutide (a modified human GLP-1) may be administered to a mammal (e.g., a human) subcutaneously at a starting dose of 0.6 mg and a maintenance dose of 1 .2 or 1 .8 mg being given once daily with or without food.
  • Dulaglutide (a modified human GLP-1) may be administered subcutaneously once daily (with or without food) at a starting dose of 0.75 mg and a maintenance dose of 0.75 or 1 .5 mg.
  • Semaglutide (a modified human GLP-1) may be administered subcutaneously once daily (with or without food) at a starting dose of 0.25 mg and a maintenance dose of 0.5 or 1 .Omg.
  • a myostatin inhibitor and a GLP-1 pathway activator
  • an obese or overweight subject is given a GLP-1 mimetic once daily via subcutaneous injection.
  • a GLP-1 pathway activator e.g., a GLP-1 mimetic
  • the starting dose of a GLP-1 mimetic is lower than the maintenance dose of the GLP-1 mimetic.
  • the dose (one or both of a starting dose or maintenance dose) of the GLP-1 mimetic (or other GLP-1 pathway activator) administered in the combination therapy is lower than the FDA-approved dose.
  • dosages for a myostatin inhibitor e.g., an anti-pro/latent-myostatin antibody, or antigen binding fragment thereof, as described herein may be determined empirically in individuals who have been given one or more administration(s) of the myostatin inhibitor, e.g., antibody, or antigen binding fragment thereof. Individuals are given incremental dosages of the antagonist. To assess efficacy of the antagonist, an indicator of the disease/disorder can be followed.
  • an initial candidate dosage can be about 2 mg/kg.
  • a typical daily dosage might range from about any of 0.1 pg/kg to 3 pg/kg to 30 pg/kg to 300 pg/kg to 3 mg/kg, to 30 mg/kg to 100 mg/kg or more, depending on the factors mentioned above.
  • the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a disease or disorder associated with pro/latent- myostatin, or a symptom thereof.
  • An exemplary dosing regimen comprises administering an initial dose of about 2 mg/kg, followed by a weekly maintenance dose of about 1 mg/kg of the antibody, or antigen binding fragment thereof, or followed by a maintenance dose of about 1 mg/kg every other week.
  • other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the practitioner wishes to achieve. For example, dosing from one to four times a week is contemplated. In some embodiments, dosing ranging from about 3 pg/kg to about 2 mg/kg (such as about 3 pg/kg, about 10 pg/kg, about 30 pg/kg, about 100 pg/kg, about 300 pg/kg, about 1 mg/kg, and about 2 mg/kg) may be used.
  • dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, every 4 months, every 5 months, every 6 months, every 8 months, every 10 months, every year, or longer.
  • the progress of this therapy is easily monitored by conventional techniques and assays.
  • the dosing regimen (including the antibody used) can vary over time.
  • the administration of any of the myostatin inhibitors, e.g., antibodies, or antigen binding fragments thereof, described herein comprises a single dose. In some embodiments, the administration of any of the myostatin inhibitors, e.g., antibodies, or antigen binding fragments thereof, described herein comprises multiple doses (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 doses). Administering may comprise more than two doses. In some embodiments, the administration comprises at least a first dose and a second dose of a therapeutically effective amount of the myostatin inhibitor, e.g., antibody or antigen-binding portion thereof. In one embodiment, the first dose and the second dose are administered to the subject at least about 4 weeks apart, 6 weeks apart, 8 weeks apart, or 12 weeks apart.
  • the appropriate dosage of a myostatin inhibitor and a GLP-1 pathway activator will depend on the specific myostatin inhibitor (or compositions thereof) and GLP-1 pathway activator employed, the type and severity of the disease/disorder, whether the combination therapy is administered for preventive or therapeutic purposes, previous therapy, current medication profile of the patient, the patient's clinical history and response to the combination therapy, potential synergy of the drug combination, and the discretion of the attending physician.
  • a clinician will administer the combination therapy (either together or each drug individually) until a dosage of the combination or of each drug individually is reached that achieves the desired result.
  • Administration of the combination therapy can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
  • the administration of a myostatin inhibitor and a GLP-1 pathway activator may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing a metabolic disease or disorder.
  • treating refers to the application or administration of a composition including one or more active agents to a subject, who has a disease/disorder associated with myopathy, a symptom of the disease/disorder, or a predisposition toward the disease/disorder, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward the disease/disorder.
  • Alleviating a metabolic disease/disorder includes delaying the development or progression of the disease, or reducing disease severity. Alleviating the disease does not necessarily require curative results. As used therein, "delaying" the development of a metabolic disease/disorder means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated.
  • a method that "delays" or alleviates the development of a disease, or delays the onset of the disease is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method.
  • Measurement of improvement in conditions associated with a metabolic disease or disorder may be quantitated, e.g., by evaluation of circulating metabolic biomarkers by qNMR (examples of such biomarkers are discussed, e.g., in Robberecht et al. , Metab Syndr Relat Disord. 2016 Mar;14(2):47-93, and Belhayara et al., Nutrients. 2020 Mar; 12(3): 727, each of which is herein incorporated by reference in its entirety).
  • “Development” or “progression” of a disease means initial manifestations and/or ensuing progression of the disease.
  • Development of the disease can be detectable and assessed using standard clinical techniques. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein “onset” or “occurrence” of a disease/disorder associated with a metabolic disorder includes initial onset and/or recurrence.
  • the invention encompasses pharmaceutical compositions and related methods used as combination therapies for treating subjects who may benefit from myostatin inhibition and GLP-1 pathway activation in vivo.
  • such subjects may receive combination therapies that include a first composition comprising at least one myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) in conjunction with a second composition comprising at least one additional therapeutic intended to treat the same or overlapping disease or clinical condition.
  • the first and second compositions may both act on the same cellular target, or discrete cellular targets.
  • the first and second compositions may treat or alleviate the same or overlapping set of symptoms or aspects of a disease or clinical condition.
  • the first and second compositions may treat or alleviate a separate set of symptoms or aspects of a disease or clinical condition.
  • Such combination therapies may be administered in conjunction with each other.
  • the phrase “in conjunction with,” in the context of combination therapies, means that therapeutic effects of a first therapy overlaps temporarily and/or spatially with therapeutic effects of a second therapy in the subject receiving the combination therapy.
  • the combination therapies may be formulated as a single formulation for concurrent administration, or as separate formulations, for simultaneous or sequential administration of the therapies.
  • concurrent administration as used herein, may include co-formulated therapeutics being administered together, or separately formulated therapeutics being administered at the same time, e.g., simultaneously, or, in some embodiments, on the same day.
  • sequential administration includes therapeutic regimens in which therapeutics are administered at separate times.
  • a subject receives concurrent administration of two or more therapies when subject is on one or more first therapeutic(s) at the beginning of the treatment regimen and one or more second therapeutic(s) is/are added to the regimen at a specific point during the treatment.
  • combination therapies produce synergistic effects in the treatment of a disease.
  • the term “synergistic” refers to effects that are greater than additive effects (e.g., greater efficacy) of each monotherapy in aggregate.
  • combination therapies produce additive effects in the treatment of a disease.
  • combination therapies comprising a method described herein (e.g., administration of a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator) produce efficacy that is overall equivalent to that produced by another therapy (such as monotherapy of an additional agent) but are associated with fewer unwanted adverse effect or less severe toxicity associated with the second agent, as compared to the monotherapy of the second agent.
  • a combination therapies allow lower dosage of the second agent but maintain overall efficacy.
  • Such combination therapies may be particularly suitable for patient populations where a long-term treatment is warranted and/or involving pediatric patients, patients aged 2-19 years, or patients aged 12 years or older (e.g., 12-17 years), inclusive of endpoints.
  • the invention provides pharmaceutical compositions and methods for use in combination therapies for the increase of lean mass to fat mass ratio, and for the treatment or prevention of metabolic diseases or diseases associated with an impaired neurological signaling, including metabolic syndrome, diabetes (e.g., T2DM), obesity, and spinal cord injury.
  • the methods or pharmaceutical compositions for use comprise a first therapy.
  • the methods or pharmaceutical compositions for use further comprise a second therapy.
  • the first therapy may be useful for increasing the ratio of lean mass to fat mass.
  • the second therapy may be useful in treating or preventing metabolic diseases or diseases associated with an impaired neurological signaling.
  • the second therapy may diminish or treat at least one symptom(s) associated with the targeted disease.
  • the first and second therapies may exert their biological effects by similar or unrelated mechanisms of action. In some embodiments, either one or both of the first and second therapies may exert their biological effects by a multiplicity of mechanisms of action.
  • the first therapy is a GLP-1 pathway activator and the second therapy is a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor).
  • the GLP- 1 pathway activator is administered in conjunction with the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor).
  • the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the myostatin pathway inhibitor is administered to a subject who is receiving a GLP-1 pathway activator therapy.
  • the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) is administered to a subject who has not previously received a GLP-1 pathway activator therapy.
  • the GLP-1 pathway activator and the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) are administered concurrently.
  • the GLP-1 pathway activator and the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) are administered sequentially.
  • the GLP-1 pathway activator and the is administered myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) are administered separately.
  • compositions described herein may have the first and second therapies in the same pharmaceutically acceptable carrier or in a different pharmaceutically acceptable carrier for each described embodiment. It further should be understood that the first and second therapies may be administered simultaneously or sequentially within described embodiments.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator e.g., a GLP-1 pathway activator
  • the myostatin pathway inhibitor is a myostatin-selective inhibitor.
  • the myostatin pathway inhibitor inhibits pro/latent myostatin.
  • the myostatin pathway inhibitor does not inhibit GDF11.
  • the myostatin pathway inhibitor inhibits myostatin and does not inhibit any other members of the TQRb superfamily.
  • additional therapeutic agents which can be used with the combination therapy include, but are not limited to, additional diabetes mellitus-treating agents, diabetic complication-treating agents, cardiovascular diseases-treating agents, anti-hyperlipemic agents, hypotensive or antihypertensive agents, anti-obesity agents, chemotherapeutic agents, immunotherapeutic agents, immunosuppressive agents, and the like.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • the additional therapeutic agent is administered in the same treatment regimen as the combination therapy comprising the myostatin pathway inhibitor and the GLP-1 pathway activator.
  • the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the GLP-1 pathway activator are administered to a subject who is already receiving one or more therapeutic agents such as those described above.
  • treatment with myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin- selective inhibitor
  • results in a reduction of symptoms of type 2 diabetes results in a reduction of symptoms of type 2 diabetes.
  • treatment with a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator results in induction of remission of T2DM.
  • remission of T2DM refers to a return of blood sugar levels to normal or healthy levels, e.g., blood sugar level of someone without diabetes, e.g., an A1C level of less than 6.5%.
  • the combination of a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator e.g., a myostatin-selective inhibitor
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator e.g., a myostatin-selective inhibitor
  • the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • the GLP-1 pathway activator are administered to a subject who is on a diet and/or exercise regimen for weight loss or for improving or alleviating symptoms of one or more metabolic diseases or diseases associated with an impaired neurological signaling, including metabolic syndrome, diabetes (e.g., T2DM), obesity, and spinal cord injury.
  • the diet regimen includes, but is not limited to, caloric restriction (e.g., reduced calorie intake or reduced absorption of calories), diets with modified nutrient content (e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.) or modified timing of food intake (e.g., intermittent fasting, increased frequency of feeding, etc.) or a combination of modified timing, portion size, and nutrient content (e.g., more frequent meals of smaller portions containing high protein, low fat, and/or other nutrient content restrictions).
  • caloric restriction e.g., reduced calorie intake or reduced absorption of calories
  • modified nutrient content e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.
  • modified timing of food intake e.g., intermittent fasting, increased frequency of feeding, etc.
  • a combination of modified timing, portion size, and nutrient content e.g., more frequent meals of smaller portions containing high protein, low fat, and/or other
  • agents for treating diabetes mellitus include insulin formulations (e.g., animal insulin formulations extracted from a pancreas of a cattle or a swine; a human insulin formulation synthesized by a gene engineering technology using microorganisms or methods), insulin sensitivity enhancing agents, pharmaceutically acceptable salts, hydrates, or solvates thereof (e.g., pioglitazone, troglitazone, rosiglitazone, netoglitazone, balaglitazone, rivoglitazone, tesaglitazar, farglitazar, CLX-0921 , R-483, NIP-221 , NIP-223, DRF- 2189, GW-7282TAK-559, T-131 , RG-12525, LY-510929, LY-519818, BMS-298585, DRF-2725, GW-1536, Gl- 262570, KRP-297
  • insulin formulations e.g., animal insulin formulations
  • GLP1 -R pathway activators include, but are not limited to, incretin mimetics such as albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002 (GLP1 mimetic with albumin moiety to extend half-life; see, e.g., Eur J Pharmacol. 2021 Jan 5;890:173650 for discussion of half-life extension of GLP-1), glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, XW003, noisyiglutide, MEDI0382, or dulaglutide;
  • incretin mimetics such as albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002 (GLP1 mimetic with albumin moiety to extend half-life; see, e.g., E
  • GLP1 R pathway activators include DPPIV inhibitors, non-limiting examples of which are sitagliptin, vildagliptin, saxagliptin, linagliptin, gemigliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, omarigliptin, evogliptin, gosogliptin, dutogliptin, and berberine.
  • DPPIV inhibitors non-limiting examples of which are sitagliptin, vildagliptin, saxagliptin, linagliptin, gemigliptin, anagliptin, teneligliptin, alogliptin, trelagliptin, omarigliptin, evogliptin, gosogliptin, dutogliptin, and berberine.
  • agents for treating diabetic complications include, but are not limited to, aldose reductase inhibitors (e.g., tolrestat, epalrestat, zenarestat, zopolrestat, minalrestat, fidareatat, SK-860, CT-112 and the like), neurotrophic factors (e.g., NGF, NT-3, BDNF and the like), PKC inhibitors (e.g., LY-333531 and the like), advanced glycation end-product (AGE) inhibitors (e.g., ALT946, pimagedine, pyradoxamine, phenacylthiazolium bromide (ALT766) and the like), active oxygen quenching agents (e.g., thioctic acid or derivative thereof, a bioflavonoid including flavones, isoflavones, flavonones, procyanidins, anthocyanidins, pycnogenol, lutein, lycopen
  • remission of diabetes can be induced by administration of a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) in combination with a GLP-1 pathway activator, optionally in combination with a caloric restriction diet, or other diet.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator optionally in combination with a caloric restriction diet, or other diet.
  • an exercise routine is included depending on the subject’s physical capabilities.
  • a subject having T2DM that is in remission may be able to reduce or eliminate other diabetes medication.
  • the combination of a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator may be used according to the methods disclosed herein in combination with one or more of a hyperlipidemic agent, an immunotherapeutic agent, an anti-obesity agent, a chemotherapeutic agent, an immunotherapeutic agent, an immunosuppressive agent or an agent that improves cachexia.
  • Anti-hyperlipemic agents include, for example, statin-based compounds which are cholesterol synthesis inhibitors (e.g., pravastatin, simvastatin, lovastatin, atorvastatin, fluvastatin, rosuvastatin and the like), squalene synthetase inhibitors or fibrate compounds having a triglyceride-lowering effect (e.g., fenofibrate, gemfibrozil, bezafibrate, clofibrate, sinfibrate, clinofibrate and the like), niacin, PCSK9 inhibitors, triglyceride lowing agents or cholesterol sequesting agents.
  • statin-based compounds which are cholesterol synthesis inhibitors (e.g., pravastatin, simvastatin, lovastatin, atorvastatin, fluvastatin, rosuvastatin and the like), squalene synthetase inhibitors or fibrate compounds having
  • Hypotensive agents include, for example, angiotensin converting enzyme inhibitors (e.g., captopril, enalapril, delapril, benazepril, cilazapril, enalapril, enalaprilat, fosinopril, lisinopril, moexipril, perindopril, quinapril, ramipril, trandolapril and the like) or angiotensin II antagonists (e.g., losartan, candesartan cilexetil, olmesartan medoxomil, eprosartan, valsartan, telmisartan, irbesartan, tasosartan, pomisartan, ripisartan forasartan, and the like) or calcium channel blockers (e.g., amlodipine) or aspirin.
  • Anti-obesity agents include, for example, agents that increase energy expenditure and/or fat metabolism and weight loss by neural and chemical regulation.
  • Anti-obesity agents include biologic agents, such as antibodies, fusion proteins, nanobodies, and the like, as well as small molecule agents.
  • Agents include those targeting of GLP- 1 and its receptor (GLP-1 R), including GLP-1 R agonists or other GLP-1 pathway activators, including biologies such as glutazumab, everestmab, exenatide, liraglutide, lixisenatide, tirzepatide, albiglutide, XW003, noisyiglutide, MEDI0382, and dulaglutide, and small molecules such as topiramate, dexfenfluramine, fenfluramine, phentermine, phenmetrazine, sibutramine, amfepramone, dexamphetamine, mazindol, diethylpropion, orlistat, cathine, oleoyl- estrone, perflubron, benfluorex, setmelanotide, aclimostat, cetilistat, amlintide, rimonabant, phenylpropanolamine, clobenzorex and the like.
  • Agents also include insulin and insulin-secretion promoting agents, gastrointestinal lipase inhibitors (e.g., orlistat and the like), sodium glucose cotransporter 2 (SGLT-2) inhibitors, beta 3-adrenoceptor agonists (e.g., CL-316243, SR-58611-A, UL-TG-307, SB-226552, AJ-9677, BMS-196085 and the like), peptide- based appetite-suppressing agents (e.g., leptin, CNTF and the like), cholecystokinin agonists (e.g., lintitript, FPL- 15849 and the like), oxytocin and oxytocin analogs (such as carbetocin),and the like.
  • gastrointestinal lipase inhibitors e.g., orlistat and the like
  • sodium glucose cotransporter 2 (SGLT-2) inhibitors e.g., beta 3-adrenoceptor agonists
  • Chemotherapeutic agents include, for example, alkylating agents (e.g., cyclophosphamide, iphosphamide and the like), metabolism antagonists (e.g., methotrexate, 5-fluorouracil and the like), anticancer antibiotics (e.g., mitomycin, adriamycin and the like), vegetable-derived anticancer agents (e.g., vincristine, vindesine, taxol and the like), cisplatin, carboplatin, etoposide and the like.
  • alkylating agents e.g., cyclophosphamide, iphosphamide and the like
  • metabolism antagonists e.g., methotrexate, 5-fluorouracil and the like
  • anticancer antibiotics e.g., mitomycin, adriamycin and the like
  • vegetable-derived anticancer agents e.g., vincristine, vindesine, taxol
  • Immunotherapeutic agents include, for example, microorganisms or bacterial components (e.g., muramyl dipeptide derivative, picibanil and the like), polysaccharides having immune potentiating activity (e.g., lentinan, sizofilan, krestin and the like), cytokines obtained by a gene engineering technology (e.g., interferon, interleukin (IL) and the like), colony stimulating factors (e.g., granulocyte colony stimulating factor, erythropoietin and the like) and the like, among these substances, those preferred are IL-1 , IL-2, IL-12 and the like.
  • IL-1 e.g., IL-1 , IL-2, IL-12 and the like.
  • Immunosuppressive agents include, for example, calcineurin inhibitor/immunophilin modulators such as cyclosporine (Sandimmune, Gengraf, Neoral), tacrolimus (Prograf, FK506), ASM 981 , sirolimus (RAPA, rapamycin, Rapamune), or its derivative SDZ-RAD, glucocorticoids (prednisone, prednisolone, methylprednisolone, dexamethasone and the like), purine synthesis inhibitors (mycophenolate mofetil, MMF, CellCept(R), azathioprine, cyclophosphamide), interleukin antagonists (basiliximab, daclizumab, deoxyspergualin), lymphocyte-depleting agents such as antithymocyte globulin (Thymoglobulin, Lymphoglobuline), anti-CD3 antibody (OKT3), and the like.
  • additional agents suitable for administration as a combination therapy in conjunction with the myostatin pathway inhibitor include anti-fibrotic agents, such as TQRb1 inhibitors.
  • second agents suitable for administration as a combination therapy in conjunction with the antibodies described herein are modulators (e.g., agonists and antagonists) of certain members of the TQRb super family of growth factors, such as BMP6, BMP7, GDF11 , T6Rb2, T6Rb3, etc.
  • additional therapy comprises an inhibitor of RGMc, such as anti-RGMc antibodies.
  • any of the above-mentioned agents can be administered in combination with the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor)/GLP-1 pathway activator to treat a metabolic disease or disorder, e.g., metabolic syndrome, obesity, T2DM, or T2DM associated with obesity.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator e.g., a metabolic disease or disorder, e.g., metabolic syndrome, obesity, T2DM, or T2DM associated with obesity.
  • any of the above-mentioned agents may be administered in combination with the myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and/or GLP-1 pathway activator to treat a metabolic disease or disorder, e.g., metabolic syndrome, obesity, T2DM, orT2DM associated with obesity, wherein the agents are administered in conjunction with a diet and/or exercise regimen.
  • the myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator e.g., a metabolic disease or disorder, e.g., metabolic syndrome, obesity, T2DM, orT2DM associated with obesity
  • Examples of the diet regimen include, but are not limited to, caloric restriction (e.g., reduced calorie intake or reduced absorption of calories), diets with modified nutrient content (e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.) or modified timing of food intake (e.g., intermittent fasting, increased frequency of feeding, etc.) or a combination of modified timing, portion size, and nutrient content (e.g., more frequent meals of smaller portions containing high protein, low fat, and/or other nutrient content restrictions).
  • caloric restriction e.g., reduced calorie intake or reduced absorption of calories
  • modified nutrient content e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.
  • modified timing of food intake e.g., intermittent fasting, increased frequency of feeding, etc.
  • a combination of modified timing, portion size, and nutrient content e.g., more frequent meals of smaller portions containing high protein, low fat, and/or
  • compositions described herein are suitable for administration to human patients for the treatment or prevention of diseases and conditions where reduced myostatin signaling and increased insulin production is desirable.
  • diseases and conditions include, but are not limited to: metabolic syndrome, obesity, type 2 diabetes mellitus (T2DM), and T2DM associated with obesity.
  • T2DM type 2 diabetes mellitus
  • Exemplary conditions for which the compositions and methods of the present invention may be useful are further described below.
  • a metabolic disease (also referred to as a metabolic disorder) is generally associated with aberrant glucose, lipid/fat and/or protein/nitrogen metabolism, or osmotic dysregulation, and has pathological consequences arising from such condition.
  • a number of metabolic disorders of the invention share certain characteristics, e.g., they are associated with a loss of fat-free or lean muscle mass, an excess of fat mass, a lower metabolic rate, insulin resistance, lack of ability to regulate blood sugar, weight gain, and/or increase in body mass index. In some cases, such metabolic conditions may be triggered or exacerbated by medication that the patients receive.
  • Metabolic disorders and diseases for treatment according to the methods provided herein include but are not limited to metabolic syndrome, obesity, overweight with at least one comorbidity, type 2 diabetes mellitus, and type 2 diabetes mellitus associated with obesity.
  • the metabolic disorder is T2DM.
  • the metabolic disorder is obesity.
  • the present invention is based, at least in part, on the discovery that administration of a combination of a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator, to subjects having a metabolic disease significantly improves both the physiological and the functional characteristics of the injured subjects.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator significantly increases the metabolic rate or energy expenditure in subjects having metabolic disease.
  • the combination therapy also significantly attenuated spinal cord injury (SCI)- induced reduction in sub-lesional muscle mass and overall body mass and, while at the same time reducing the mass of undesirable adipose tissue such as white and visceral adipose tissue.
  • Subjects treated with the combination therapy may also exhibit a significant improvement in their locomotor function, muscle strength, as well as motor coordination and balance skills.
  • the present invention provides methods for treating or preventing metabolic diseases in a human subject.
  • the methods include selecting a human subject suffering from a metabolic disease and administering to the human subject an effective amount of a combination of a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator, thereby treating or preventing the metabolic disease in the human subject.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator e.g., a myostatin pathway inhibitor
  • the myostatin pathway inhibitor is a myostatin- selective inhibitor.
  • the myostatin-selective inhibitor is an antibody, or antigen binding fragment thereof, that specifically binds to pro/latent myostatin, but does not bind to GDF11.
  • Antibodies that specifically recognize pro/latent myostatin, but not GDF11 are beneficial and avoid undesirable toxicity caused by off-target binding of antibodies to GDF11 in the subject.
  • the subject is a pediatric subject.
  • the subject is a subject aged 2-19 years, inclusive of endpoints.
  • the subject is a subject aged 12 years or older (e.g., 12-17 years), inclusive of endpoints.
  • metabolic diseases examples include but are not limited to, type 2 diabetes, metabolic syndrome, pre-diabetes, obesity, cardiovascular diseases (such as congestive heart failure), spinal cord injury (SCI) (e.g., complete or incomplete/partial SCI), hypo- metabolic states, double diabetes, Cushing’s disease (also referred to as Cushing’s syndrome), obesity syndrome (e.g., diet-associated or diet-induced obesity), insulin resistance, insulin insufficiency, hyperinsulinemia, impaired glucose tolerance (IGT), abnormal glycogen metabolism, hyperlipidemia, hypoalbuminemia, hypertriglyceridemia, kidney disease, syndrome X, fatty liver disease and metabolic bone diseases.
  • metabolic diseases include diseases associated with impaired neurological signaling or partial denervation.
  • metabolic diseases include conditions triggered by or associated with certain medication (e.g., side effects).
  • Body composition may be measured by a variety of methods, including dual energy X-ray absorptiometry (DEXA). Total body scans using DEXA provide generally accurate and precise measurements of body composition, including bone mineral content, bone mineral density, lean tissue mass, fat tissue mass, and fractional contribution of fat.
  • DEXA dual energy X-ray absorptiometry
  • Diabetes refers to a group of metabolic diseases characterized by high blood sugar (glucose) levels which result from defects in insulin secretion or action, or both. There are two most common types of diabetes, namely type 1 diabetes and type 2 diabetes, which both result from the body's inability to regulate insulin. Insulin is a hormone released by the pancreas in response to increased levels of blood sugar (glucose) in the blood.
  • T2DM type 2 diabetes mellitus
  • NDDM noninsulin-dependent diabetes mellitus
  • Type 2 diabetes may occur in children and adolescents but usually begins after age 30 and becomes progressively more common with age: about 15 percent of people over age 70 have type II diabetes. Obesity is a risk factor for type 2 diabetes, and 80 to 90 percent of the people with this disorder are obese.
  • diabetes includes pre-diabetes.
  • Pre-diabetes refers to one or more early diabetic conditions including impaired glucose utilization, abnormal or impaired fasting glucose levels, impaired glucose tolerance, impaired insulin sensitivity and insulin resistance.
  • Prediabetes is a major risk factor for the development of type 2 diabetes mellitus, cardiovascular disease, and mortality. Much focus has been given to developing therapeutic interventions that prevent the development of type 2 diabetes by effectively treating prediabetes.
  • diabetes includes double diabetes, which is a combination of type 1 diabetes with features of insulin resistance and type 2 diabetes.
  • Diabetes can be diagnosed by the administration of a glucose tolerance test. Clinically, diabetes is often divided into several basic categories. Primary examples of these categories include, autoimmune diabetes mellitus, non-insulin-dependent diabetes mellitus (type 1 NDDM), insulin-dependent diabetes mellitus (type 2 IDDM), non- autoimmune diabetes mellitus, non-insulin-dependent diabetes mellitus (type 2 NIDDM), and maturity-onset diabetes of the young (MODY).
  • a further category often referred to as secondary, refers to diabetes brought about by some identifiable condition which causes or allows a diabetic syndrome to develop.
  • Examples of secondary categories include, diabetes caused by pancreatic disease, hormonal abnormalities, drug- or chemical-induced diabetes, diabetes caused by insulin receptor abnormalities, diabetes associated with genetic syndromes, and diabetes of other causes (see e.g., Harrison's (1996) 14th ed., New York, McGraw-Hill).
  • Obesity is another prevalent metabolic disease that can be treated or prevented by the methods of the present invention.
  • “Obesity” refers to a chronic condition defined by an excess amount of body fat. The normal amount of body fat (expressed as percentage of body weight) is between 25-30% in women and 18-23% in men. Women with over 30% body fat and men with over 25% body fat are considered obese. Obesity can be defined using any clinically relevant definitions. For example, in adults, body mass index (BMI, kg/m2) is frequently used as a measure of overweight and obesity, with overweight being defined as a BMI 25-29.9 kg/m2, obesity as a BMI equal to or greater than 30 kg/m2, and morbid obesity being defined as BMIs over 40 kg/m2.
  • BMI body mass index
  • Obesity can also be defined in adults by central adiposity as measured by waist circumference, with raised waist circumference defined as equal to or greater than 102 cm in men and equal to or greater than 88 cm in women.
  • Subjects with obesity may exhibit other symptoms such as increased fasting plasma glucose, increased fasting plasma triglycerides, decreased fasting high density lipoprotein (HDL) level, and increased blood pressure.
  • Obesity may also cause various orthopedic problems, skin disorders and swelling of the feet and ankles. Severe complications of obesity include a much higher risk of coronary artery disorder and of its major risk factors type II diabetes, hyperlipidemia and hypertension.
  • the obesity is sarcopenic obesity.
  • the subject having obesity is on a caloric restriction regimen.
  • metabolic syndrome refers to the concept of a clustering of metabolic risk factors that come together in a single individual and lead to a high risk of developing diabetes and/or cardiovascular diseases.
  • the main features of metabolic syndrome include insulin resistance, hypertension (high blood pressure), cholesterol abnormalities, dyslipidemia, triglyceride abnormalities, an increased risk for clotting and excess body weight, especially in the abdomen, or obesity.
  • metabolic syndrome can be diagnosed by the presence of three or more of the following components: (1) an elevated waist circumference (men, equal to or greater than 40 inches (102 cm); women, equal to or greater than 35 inches (88 cm)); (2) elevated triglycerides (equal to or greater than 150 mg/dL); (3) reduced High Density Lipoprotein cholesterol or HDL (men, less than 40 mg/dL; women, less than 50 mg/dL); (4) elevated blood pressure (equal to or greater than 130/85 mm Hg); and (5) elevated fasting glucose (equal to or greater than 100 mg/dL).
  • an elevated waist circumference men, equal to or greater than 40 inches (102 cm); women, equal to or greater than 35 inches (88 cm)
  • elevated triglycerides equal to or greater than 150 mg/dL
  • reduced High Density Lipoprotein cholesterol or HDL men, less than 40 mg/dL; women, less than 50 mg/dL
  • elevated blood pressure equal to or greater than 130/85 mm Hg
  • the methods of the present invention are suitable for treating or preventing metabolic disease such as obesity syndromes.
  • metabolic disease such as obesity syndromes.
  • the term “obesity syndrome” refers any disorder or conditions causing a subject to be grossly fat or overweight. Like other metabolic diseases, people with obesity syndrome are usually associated a loss of fat-free or lean muscle mass, an excess of fat mass, a lower metabolic rate, insulin resistance, lack of ability to regulate blood sugar, weight gain, and increase in body mass index.
  • the obesity syndrome is selected from the group consisting of Prader Willi, an obesity syndrome associated with a genetic disorder, and an obesity syndrome associated with a hypothalamic disorder.
  • the methods of the present invention are also suitable for treating or preventing metabolic diseases associated with a hypo-metabolic state.
  • a hypo-metabolic state refers to a state of reduced metabolism or metabolic activity, where the body is not producing enough energy. Patients with a hypo-metabolic state generally have a lower metabolic rate, a loss of fat-free or lean muscle mass, an excessive gain of fat mass, insulin resistance, lack of ability to regulate blood sugar, weight gain, and an increase in body mass index.
  • the hypo-metabolic state is selected from the group consisting of a state associated with prolonged immobilization, a state associated with bed-rest, a state associated with casting, a state associated with a stroke, a state associated with amputation, and a post-surgery state.
  • the hypo-metabolic state is a post-surgery state, e.g., paraspinal muscle atrophy after lumbar spine surgery.
  • the paraspinal muscle atrophy is a nerve injury-dependent muscle atrophy.
  • the surgery is a spinal surgery.
  • the spinal surgery is a lumbar spine surgery or a lumbar spine procedure, e.g., a lumbar fusion procedure, a lumbar nonfusion procedure, a posterior lumbar fusion procedure, an anterior lumbar fusion procedure, a minimally invasive (MIS) posterior lumbar decompression procedure, a minimally invasive (MIS) posterior lumbar fusion procedure, a non-MIS equivalent procedure, etc.
  • a lumbar spine surgery or a lumbar spine procedure e.g., a lumbar fusion procedure, a lumbar nonfusion procedure, a posterior lumbar fusion procedure, an anterior lumbar fusion procedure, a minimally invasive (MIS) posterior lumbar decompression procedure, a minimally invasive (MIS) posterior lumbar fusion procedure, a non-MIS equivalent procedure, etc.
  • the methods of the present invention are suitable for treating or preventing metabolic diseases such as Cushing’s disease, which is also referred to as Cushing’s syndrome or Cushing’s syndrome.
  • Cushing’s disease refers to a collection of signs and symptoms due to prolonged exposure to cortisol. This may stem from endogenous causes, such as a condition in which the pituitary gland releases too much adrenocorticotropic hormone (ACTH), or exogenous causes, such as the use of oral corticosteroid medication.
  • endogenous causes such as a condition in which the pituitary gland releases too much adrenocorticotropic hormone (ACTH), or exogenous causes, such as the use of oral corticosteroid medication.
  • ACTH adrenocorticotropic hormone
  • Some of the hallmark signs and symptoms of Cushing’s disease may include: progressive obesity, such as weight gain and fatty tissue deposits, particularly around the midsection and upper back and between the shoulders (buffalo hump) (upper body obesity above the waist); thin arms and legs, round, red, full face (moon face); changes in the skin, such as pink or purple stretch marks (striae) on the skin of the abdomen, thighs, breasts and arms, thinning, fragile skin that bruises easily, low healing of cuts, insect bites and infections, and acne.
  • progressive obesity such as weight gain and fatty tissue deposits, particularly around the midsection and upper back and between the shoulders (buffalo hump) (upper body obesity above the waist); thin arms and legs, round, red, full face (moon face); changes in the skin, such as pink or purple stretch marks (striae) on the skin of the abdomen, thighs, breasts and arms, thinning, fragile skin that bruises easily, low healing of cuts, insect bites and infections, and acne.
  • striae pink or
  • Cushing’s disease Patients with Cushing’s disease may also experience severe fatigue, muscle weakness, depression, anxiety and irritability, loss of emotional control, cognitive difficulties, new or worsened high blood pressure, headache, type 2 diabetes, and/or bone loss which may lead to fractures overtime. In children, Cushing’s disease may cause impaired growth (slow growth rate).
  • the Cushing’s disease is selected from the group consisting of corticosteroid- induced Cushing’s disease and tumor-induced Cushing’s disease.
  • the cause of Cushing’s disease is long-term use of corticosteroid medications
  • controlled reduction of the dosage of the drug over a period of time while still adequately managing the underlining disease or condition for which the drug is being administered, may be considered.
  • the patient who is on a corticosteroid therapy has one or more autoimmune or inflammatory diseases, such as rheumatoid arthritis, lupus and asthma.
  • Corticosteroid may also be prescribed to patients to suppress the body’s immunity in order to prevent the body from rejecting an allograft transplant, such as a transplanted organ or tissue.
  • patients receiving a corticosteroid therapy include a sub-population of individuals who do not tolerate well, who are poorly responsive or not responsive, to other treatment options, such as noncorticosteroid medications. In such situations, the physician may continue to prescribe corticosteroid medication. In some embodiments, surgery may be considered as an alternative option.
  • the cause of Cushing syndrome is a tumor
  • complete surgical removal and/or radiation therapy can be considered.
  • patients have a tumor in the pituitary, adrenal glands, lungs or pancreas. After the operation, cortisol replacement therapy is typically administered to provide the body with the correct amount of adrenal hormone production.
  • patients with Cushing syndrome never experience a resumption of normal adrenal function and therefore may require lifelong replacement therapy.
  • the inhibitors of myostatin activation described herein may be suitable to treat such patients.
  • medication can be used to control cortisol production when surgery and/or radiation don't work. Medications may also be used before surgery in patients who have become very sick with Cushing syndrome.
  • the inhibitors of myostatin activation encompassed by the present disclosure may be used to treat such patients prior to surgery to improve signs and symptoms and minimize surgical risk.
  • Medications currently used to control excessive production of cortisol at the adrenal gland include ketoconazole (Nizoral), mitotane (Lysodren) and metyrapone (Metopirone).
  • Mifepristone Korlym
  • Mifepristone does not decrease cortisol production, but it blocks the effect of cortisol on the tissues.
  • Side effects from these medications may include fatigue, nausea, vomiting, headaches, muscle aches, high blood pressure, low potassium and swelling. Some have more serious side effects, such as neurological side effects and liver toxicity.
  • the inhibitors of myostatin activation encompassed by the present disclosure may be used alone (in lieu of) or in combination with any of these therapeutics.
  • the tumor or its treatment will cause other hormones produced by the pituitary or adrenal gland to become deficient, which may require hormone replacement therapy.
  • hormone replacement therapy In some embodiments, none of these currently available treatment options are appropriate or effective, surgical removal of the adrenal glands (bilateral adrenalectomy) may be considered, which will require lifelong replacement medications. Patients who are candidates for such option may benefit from a myostatin inhibition therapy described herein, before and/or after adrenalectomy.
  • cardiovascular disease refers to any disease of the heart or blood vessels.
  • Cardiovascular or heart disease includes but is not limited to, for example, angina, arrhythmia, coronary artery disease (CAD), coronary heart disease, cardiomyopathy (including dilated cardiomyopathy, restrictive cardiomyopathy, arrhythmogenic right ventricular cardiomyopathy, and diabetic cardiomyopathy), heart attack (myocardial infarction), heart failure (e.g., acute heart failure (AHF) or chronic heart failure (CHF)), hypertrophic cardiomyopathy, mitral regurgitation, mitral valve prolapse, pulmonary stenosis, etc.
  • AHF acute heart failure
  • CHF chronic heart failure
  • Blood vessel disease includes but is not limited to, for example, peripheral vascular disease, artery disease, carotid artery disease, deep vein thrombosis, venous diseases, and atherosclerosis.
  • a subject having heart failure is resistant to diuretic therapy.
  • a subject having heart failure responds poorly to diuretic therapy.
  • Obesity is a risk factor for the development of cardiovascular disease.
  • Obese individuals experience cardiovascular disease events at an earlier age, live with cardiovascular disease for a greater proportion of their lifetime and have a shorter average lifespan than individuals with normal weight.
  • Obesity contributes directly to cardiovascular risk factors, including dyslipidemia, type 2 diabetes, hypertension, and sleep disorders.
  • Obesity accelerates atherosclerotic changes through multiple mechanisms, including insulin resistance and inflammation.
  • Obesity also leads to the development of cardiovascular disease and cardiovascular disease mortality independently of other cardiovascular risk factors.
  • Visceral adiposity promotes systemic and vascular inflammation, which is fundamental to the atherosclerotic process. Inflammation induced by obesity increases the likelihood of LDL oxidation, which in turn promotes atherogenesis.
  • Insulin resistance is associated with dyslipidemia and metabolic syndrome, which are linked to atherosclerosis. Endothelial function in obesity, e.g., due to decreased bioavailability of nitric oxide in the setting of inflammation and oxidative stress also contributes to the progression of atherosclerosis. Obesity also has been liked to abnormalities in the coronary microvasculature and on epicardial coronary vessels.
  • Another aspect of the disclosure includes a method of treating a subject having a metabolic disease or condition related to aging. Exemplary diseases and conditions related to ageing include, without limitation, sarcopenia (age-related muscle loss), frailty, and androgen deficiency.
  • the myostatin pathway inhibitor for use in the methods disclosed herein is a monoclonal antibody selective for myostatin.
  • the monoclonal antibody specifically binds and inhibits the activation step of myostatin/GDF8.
  • such antibodies bind pro-myostatin and/or latent myostatin, thereby inhibiting activation and subsequent release of mature myostatin, but do not bind mature myostatin that is not associated with a latent (inactive) complex.
  • the antibodies or fragments thereof bind tethered forms (e.g., intramuscular) of inactive myostatin (e.g., pro- myostatin), which have the ability to locally act upon tissue-associated myostatin within a disease niche.
  • inactive myostatin e.g., pro- myostatin
  • the antibodies or fragments thereof bind soluble forms (e.g., in circulation) of inactive myostatin (e.g., latent-myostatin), which have the ability to act upon circulating latent myostatin that may have endocrine or systemic effects.
  • preferred inhibitors of myostatin for carrying out the methods of the present invention are those that are selective for myostatin that do not antagonize other members of the TQRb superfamily of growth factors/cytokines, such as GDF11 .
  • Such selectivity is advantageous particularly in pediatric patient populations and/or patient populations requiring a long-term care (e.g., chronic therapy), where inhibiting other pathways, such as GDF11 , may produce harmful or unwanted side effects or adverse events.
  • the present invention further provides methods for promoting robust weight loss (e.g., loss of fat mass (i.e., the weight of fat in the body) without concomitant loss of lean muscle mass) in both healthy subjects, e.g., bodybuilders, or in subjects having metabolic diseases, such as obesity, e.g., diet-induced obesity, metabolic syndrome, and/ortype 2 diabetes mellitus (T2DM).
  • weight loss e.g., loss of fat mass (i.e., the weight of fat in the body) without concomitant loss of lean muscle mass
  • healthy subjects e.g., bodybuilders
  • metabolic diseases such as obesity, e.g., diet-induced obesity, metabolic syndrome, and/ortype 2 diabetes mellitus (T2DM).
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator e.g., an insulin secretion-promoting agent, e.g., liraglutide
  • administration of the myostatin pathway inhibitor and the GLP-1 pathway activator results in about a 5%, about 10%, about 15%, or about 20% or greater loss of fat mass in the subject during the course of treatment
  • Body fat mass increases with age in both men and women through middle age.
  • Abdominal fat in particular is associated with higher risk of cardiovascular disease, metabolic syndrome, hypertension, diabetes, dyslipidemia in a subject when compared to the risk in individuals without abdominal obesity.
  • Fat mass or abdominal fat mass may be measured directly by dual energy X-ray absorptiometry, ultrasound, computed tomography, or magnetic resonance imaging (e.g., qNMR).
  • abdominal obesity is defined as a waist circumference of 102 cm or greater in men, and 88 cm or greater in women.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator may result in more robust weight loss due to the maintenance of a higher metabolic rate; improved cardiometabolic benefits (such as lipid profile, glucose metabolism, cardiovascular risk, etc.); and higher reduction in fat (e.g., total fat or visceral fat and/or other deleterious fat levels) as compared to dieting or to the administration of the myostatin pathway inhibitor or the GLP- 1 pathway activator alone.
  • administration of the combination therapy disclosed herein may prevent or reduce muscle atrophy and/or bone loss which can occur concomitantly with a diet, e.g., a caloric restriction diet, a low-carbohydrate diet, a ketogenic diet, etc.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator optionally in combination with a diet, may increase the ratio of muscle to fat in the subject.
  • administration of a GLP- 1 pathway activator yields a similar pharmacological effect as calorie restriction.
  • administering a GLP-1 pathway inhibitor in conjunction with a myostatin pathway inhibitor provides added benefit to weight loss and fat mass loss as compared to either agent administered alone.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a GLP-1 pathway activator enables prevention or mitigation of lowering of the metabolic rate in a subject, and prevention or reduction of lean muscle loss.
  • the combination of myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator may optionally be combined with a diet, e.g., a caloric restriction diet.
  • a moderate calorie restriction diet is recommended, as this provides for better patient compliance and better long-term outcomes since subjects do not have to adhere to austere, aggressive diets, e.g., aggressive caloric restriction diets.
  • Such treatments are particularly useful for subjects who have limitations on physical activity, e.g., subjects having an orthopedic injury, spinal cord injury, musculoskeletal disease, a pulmonary disorder, a cardiovascular disorder, a neurologic disorder, severe obesity, etc.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a diet e.g., a caloric restriction diet
  • such a treatment enables subjects with limitations on physical activity to undergo a more robust diet, e.g., caloric restriction diet, because they are no longer limited by concerns regarding muscle loss or bone loss due to the administration of the myostatin pathway inhibitor.
  • the combination therapy may also contribute to a reduction of feelings of hunger and unhealthy food behaviors in a patient due to the action of a GLP-1 pathway activator on the central nervous system.
  • the subject is on a diet regimen, but is not on an exercise regimen. In some embodiments, the subject is on an exercise regimen, but is not on a diet regimen. In some embodiments, the subject is on a diet regimen, and an exercise regimen.
  • Examples of a diet regimen include, but are not limited to, caloric restriction (e.g., reduced calorie intake or reduced absorption of calories), diets with modified nutrient content (e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.) or modified timing of food intake (e.g., intermittent fasting, increased frequency of feeding, etc.) or a combination of modified timing, portion size, and nutrient content (e.g., more frequent meals of smaller portions containing high protein, low fat, and/or other nutrient content restrictions).
  • caloric restriction e.g., reduced calorie intake or reduced absorption of calories
  • modified nutrient content e.g., high protein, low fat, low carbohydrate, keto, paleo, etc.
  • modified timing of food intake e.g., intermittent fasting, increased frequency of feeding, etc.
  • a combination of modified timing, portion size, and nutrient content e.g., more frequent meals of smaller portions containing high protein, low fat, and/
  • Clinical effects of the combination and adjunct therapies described herein may be measured by any suitable methods or criteria in order to assess benefits on pharmacologic management of excess adiposity and accompanying metabolic disturbances (Heymsfield et al. J Biol Chem. 2020 Apr 17;295(16) :5404-5418.).
  • various parameters of body composition can be measured, such as changes in total body fat mass, lean mass, waist circumference, HbA1 c levels, and body weight.
  • Any suitable techniques can be employed to assess body composition, including, without limitation, qNMR, dual energy x-ray absorptiometry (DXA), magnetic resonance imaging (MRI)-derived hepatic fat fraction, hydrodensitometry, air displacement plethysmography (ADP), bioelectrical impedance analysis (BIA), bioimpedance spectroscopy (BIS), electrical impedance myography (EIM), 3D body scanners, and multi-compartment models (e.g., 3-compartment and 4- compartment models).
  • DXA dual energy x-ray absorptiometry
  • MRI magnetic resonance imaging
  • ADP air displacement plethysmography
  • BIOA bioelectrical impedance analysis
  • BIOS bioimpedance spectroscopy
  • EIM electrical impedance myography
  • the combination and adjunct therapies described herein may result in a change in total body fat mass in a subject as compared to baseline.
  • total body fat mass is measured by dual energy x-ray absorptiometry (DXA) (Garito et al. Diabetes Obes Metab. 2018;20(1 ):94-102).
  • DXA dual energy x-ray absorptiometry
  • the combination and adjunct therapies described herein may result in a change in diabetes status in a subject as compared to baseline.
  • diabetes status can be determined by measuring the subject’s HbA1c level, homeostatic model assessment, quantitative insulin sensitivity check, Matsuda Index (Yokoyama et al. J Clin Endocrinol Metab.
  • the combination and adjunct therapies described herein may result in a change in a subject’s body weight, BMI, waist circumference, and/or waist-to-hip ratio. In some embodiments, the combination and adjunct therapies described herein may result in a change in a subject’s body composition.
  • the subject’s body composition may be assessed by DXA-measurements of bone mineral-free lean mass, magnetic resonance imaging (MRI)-derived hepatic fat fraction (Mashood et al. J Magn Reson Imaging. 2013;37(6):1359-1370), and/or subcutaneous and abdominal visceral adipose tissue (Fallah et al. MAGMA. 2017 ;30 (2):139-151).
  • MRI magnetic resonance imaging
  • subcutaneous and abdominal visceral adipose tissue Fallah et al. MAGMA. 2017 ;30 (2):139-151).
  • the combination and adjunct therapies described herein may result in a change in a subject’s metabolic status (Garito et al. Diabetes Obes Metab. 2018;20(1 ):94-102; Goyal et al. N Am J Med Sci.
  • the subject’s metabolic status may be assessed using metabolic biomarkers, non-limiting examples of such markers are discussed in, e.g., in Robberecht et al., Metab Syndr Relat Disord. 2016 Mar;14(2):47-93, and Belhayara et al., Nutrients. 2020 Mar; 12(3): 727, each of which is herein incorporated by reference in its entirety.
  • the subject’s metabolic status may be assessed based on the subject’s cardiovascular risk factors, including serum lipid levels, high-sensitivity C-reactive protein level, interleukin 6 level, leptin level, adiponectin level, and blood pressure.
  • cardiovascular risk factors including serum lipid levels, high-sensitivity C-reactive protein level, interleukin 6 level, leptin level, adiponectin level, and blood pressure.
  • the combination and adjunct therapies described herein may result in a change in a subject’s physical performance.
  • the subject’s physical performance may be assessed by measuring hand grip strength by dynamometry (Rooks et al. J AmGeriatr Soc. 2017;65(9): 1988-1995).
  • Example 1 Effects of myostatin inhibition coupled with calorie restriction in a diet-induced obesity model
  • Metabolic disorders such as obesity and diabetes can benefit from a reduction in calorie consumption in that they may experience a reduction in severity of their symptoms.
  • ultra-low-calorie diets are impractical, and difficult for patients to maintain.
  • a substantial portion of the weight loss is in lean muscle rather than fat, some estimates show about 25% of the weight loss is muscle, although this may be as high as 33% in the context of more rapid weight loss, further complicated by the body’s metabolic adaptations.
  • the basal metabolic rate typically declines to compensate for the body’s calorie deficit. With this lower basal metabolic rate, an individual would need to maintain the reduced calorie intake and increased physical activity to stay calorie budget neutral.
  • mice having diet-induced obesity were administered Ab2 with a calorie reduction diet after mice had been fed a high fat diet.
  • HFD high fat diet
  • Groups 2 and 3 received 70% of the Group 1 amount (30% calorie reduction (CR)), and Groups 4-5 received 80% of the Group 1 amount (20% CR). Food consumption was quantitatively measured daily.
  • a negative control antibody (“IgG”) was administered to groups 2 and 4, and the myostatin inhibitor Ab2 was administered to groups 3 and 5. Each was administered via intraperitoneal (i.p.) injection once weekly. The first day of dosing was designated as Day 1 .
  • mice The body weight of individual animals was measured 3X per week beginning on study day -2. Body composition analysis was performed on days -2, 14, 29, and 44. On scheduled days, animals were removed from their home cage and placed into a plastic restraint compatible with the body composition analysis machine (Bruker NMR LF90II). The restrainer was placed into the Bruker NMR, body composition was assessed, and the animals were returned to their home cage. Animals were maintained in the restrainer for no longer than five minutes.
  • Results are shown in FIG. 1 .
  • the highest percentage of weight loss was observed in group 2 (30% CR, negative control antibody) and group 3 (30% CR, Ab2) (FIG. 1A).
  • the highest percentage of muscle loss was observed in groups 2 (30% CR, negative control antibody) and 4 (20% CR, negative control antibody) showing that administration of the myostatin inhibitor Ab2 preserved some lean muscle mass over time compared to control (FIG. 1 B).
  • FIG. 1 C shows a comparison of the percent change of lean mass weights on day 44 as compared to baseline. Under conditions of either 20% or 30% calorie restriction, the percent loss of lean mass was highly significantly attenuated by Ab2 (p ⁇ 0.0001).
  • FIG. 1 D gastrocnemius weights, average of left & right gastrocnemius (“gastroc”) shows that the gastrocnemius muscle mass did not decrease over time, even in the 30% CR cohort. This provides further evidence that myostatin inhibition is protective against muscle loss during calorie restriction.
  • leptin levels were reduced by 22% in animals in Group 5 (20%CR + Ab2) as compared to animals in Group 4 (20% CR + IgG) and Group 1 (high fat diet ad lib). As leptin is produced by adipocytes, this may be due to the reduction in fat mass in the Group 5 animals compared to the control groups, resulting in fewer leptin-producing cells, and/or due to higher metabolic demand from greater muscle mass in the Group 5 animals compared to the control groups. When the results are normalized to the percentage of fat, Ab2 had no effect on leptin FIG. 11 (right panel).
  • Example 2 Effects of a myostatin inhibitor and a GLP-1 analog on body weight, body composition and liver lipid contents in a diet-induced obesity model
  • FIG. 2A illustrates the dose-proportional change in weight observed over the 18-day study.
  • the C57BL/6NTac DIO (diet induced obesity) mouse model was chosen for this study as it is an accepted rodent species for nonclinical pharmacology testing of the choline deficient, L-amino acid-defined, high fat diet (CD- HFD) induced Non-Alcoholic Steatohepatitis (NASH). Eighty male mice at 16 weeks of age were fed the diet wherein 60% of their calories were from fat. This diet was maintained for 6-8 weeks prior to the start of the study; and the animals demonstrated increased weight, triglycerides, insulin resistance, and glucose intolerance.
  • CD- HFD L-amino acid-defined, high fat diet
  • NASH Non-Alcoholic Steatohepatitis
  • mice were maintained on the high fat diet throughout the study and received either control antibody mlgG1 or Ab2.
  • the animals were weighed and assigned to treatment groups (Groups 1 - 8) in such a way as to generate groups with no significant differences with regards to body weight as recorded on Day -2.
  • mice were given control antibody mlgG1 or Ab2 by intraperitoneal injection once per week. Liraglutide was administered subcutaneously daily.
  • body composition was measured by qNMR. Mice were placed into a plastic restrainer compatible with the body composition analysis machine Bruker NMR LF90II and body composition was assessed. Body composition analysis was also performed on days 15 and 28 of the study. Prior to dose administration of liraglutide on Study Day 28, non-fasted blood glucose was checked on all animals. Approximately 5 - 10 pL of blood was collected and blood glucose levels measured using a hand-held glucometer (Abbot Alpha Trak). At the end of the study, blood was collected via cardiac puncture. Left and right gastrocnemius muscles (soleus muscle intact) were collected from all groups and weighed. The left inguinal fat pad was collected and weighed. The entire liver was collected, blotted, and weighed and the right lateral lobe was cut into 3 mm thick slices for histological analysis.
  • FIG. 2B shows the percentage of body weight change from baseline.
  • the animals in Group 8 that received 0.1 mg/kg liraglutide + Ab2 lost a significant amount of weight as compared to the animals in Group 7 that received the control antibody (p 0.0065; FIG. 2B).
  • the weight gain observed in these animals is possibly due to an increase in muscle mass. Indeed, as seen in FIG. 2C, all mice treated with Ab2 showed a significant increase in the percentage change of lean mass as compared with mice treated with IgG control, thus demonstrating that Ab2 maintained lean mass better than liraglutide alone.
  • FIG. 2D demonstrates the effect of treating animals with both Ab2 and liraglutide on the gastrocnemius muscle.
  • Ab2 significantly increased muscle mass when administered alone (p ⁇ 0.0001).
  • Mice treated with liraglutide at a dose of 0.06 mg/kg lost gastrocnemius muscle mass when administered a control IgG antibody.
  • these mice had increased muscle mass.
  • administering an inhibitor of the myostatin pathway and an activator of the GLP-1 pathway provided a strong beneficial effect on obesity.
  • the myostatin inhibitor enhanced weight loss in animals on a high fat diet treated with the GLP-1 pathway activator.
  • the myostatin inhibitor also maintained or increased lean muscle mass, including gastrocnemius mass, across the tested GLP-1 pathway activator dose range.
  • the myostatin inhibitor supported fat mass loss with ascending doses of the GLP-1 pathway activator.
  • Livers from the mice were sectioned for histology and stained with hematoxylin and eosin, and lipid composition determined according to the method described in Nakano et al. , J Clin Exp Hepatol.
  • Example 3 Effects of a myostatin inhibitor on energy expenditure in a diet-induced obesity model
  • C57BL6/J DIO mice weighing approximately 42 g were maintained on a high fat diet comprising 60% fat for 10 weeks prior to beginning this study then divided into three groups of (1) high fat diet with no treatment; (2) high fat diet reduced in calories by 30%; and (3) high fat diet reduced in calories by 30% and treated with 20 mg/kg once weekly with the myostatin inhibiting antibody Ab2. Energy expenditure was calculated using Oxymax for Windows. 02 and C02 measurements were taken every 25 to 40 minutes in a 24-hour cycle and raw data measurements were used to calculate AUC values.
  • TEE Total energy expenditure was determined by measuring oxygen consumption (VO ) in metabolic cages at 24 hours. TEE can be calculated by dividing VO by body weight. Lean mass and fat mass, however, do not contribute equally to TEE because lean mass is more metabolically active.
  • the Respiratory Exchange Ratio is the ratio between the metabolic production of CO and the uptake of O .
  • a low RER indicates that fat is the predominant fuel source, and a high RER indicates that carbohydrates are the predominant fuel source.
  • FIG. 3E shows that, while calorie restriction lowered RER, indicating that calorie restriction increased lipid oxidation as a fuel source, RER remained unchanged by myostatin inhibition, i.e., equal changes in VO and VCO were observed.
  • the Ab2 myostatin inhibitor increased VO consumption, VCO output and total energy expenditure in mice that were calorie restricted by 30%. No change in VO or VCO were observed when normalized to lean mass, indicating that the observed increases are due to increased metabolic demand from a greater muscle mass.
  • the antibody treatment did not change the RER in the calorie restricted mice, indicating that fuel type utilization, i.e., lipid vs. carbohydrate, was not affected by specific myostatin inhibition.
  • mice weighing approximately 36 g were maintained on a high fat diet comprising 60% fat for 14 weeks prior to beginning the study then divided into three groups of ten mice each and fed (1) a high fat diet ad lib; (2) a high fat diet reduced in calories by 20% and treated once weekly with 20 mg/kg of a placebo control monoclonal IgG; and (3) a high fat diet reduced in calories by 20% and treated once weekly with 20 mg/kg of the myostatin inhibiting antibody Ab2.
  • Mice were treated with control IgG antibody or Ab2 for six weeks. Body weight was measured three times per week, body composition was measured by qNMR pre-dose at week 0 and at weeks 2, 4 and 6.
  • the animals were placed in metabolic cages at the end of the study for 72 hours. The animals were allowed to acclimate to the metabolic cage for the first 24 hours, following which metabolic cage data was collected for the next 48 hours. The left and right gastrocnemius muscles were then weighed, and the left gastrocnemius muscle was snap frozen. Inguinal fat pads were weighed, and the left inguinal fat pad was snap frozen.
  • the myostatin inhibitor Ab2 preserved lean body mass, measured by qNMR, in the animals that were calorie restricted by 20%. As shown in FIG. 5A, lean body mass increased in animals fed the high fat diet ad lib and decreased in the calorie restricted animals. Consistent with results presented above, the anti-myostatin antibody preserved lean body mass. FIG. 5B shows the same data expressed as a change from the baseline mass. The animals treated with the anti-myostatin antibody Ab2 lost significantly less lean body mass than the animals treated with the control antibody.
  • the myostatin inhibitor Ab2 also increased gastrocnemius muscle weight in the animals that were calorie restricted by 20%. As shown in FIG. 5C, gastrocnemius weight increased in animals treated with Ab2 compared to those treated with the control antibody. FIG. 5D shows the same data expressed as a change from the baseline mass. The calorie restricted animals treated with the control antibody lost gastrocnemius muscle weight while the calorie restricted animals treated with Ab2 gained gastrocnemius muscle weight.
  • the myostatin inhibitor Ab2 decreased energy expenditure as measured by oxygen consumption and carbon dioxide output compared to mice treated with control antibody in the animals that were calorie restricted by 20%.
  • the control antibody did not affect either O consumption or CO output compared to animals that were not calorie restricted.
  • FIG. 5E shows these decreases as measured by area under the curve and normalized to lean mass.
  • FIG. 5F shows the average respiratory exchange ratio as a function of time over the course of the 72 hours that the mice spent in the metabolic cage. Compared to mice that were not calorie restricted, the calorie restricted mice displayed a marked circadian rhythm that cycled between nocturnal and diurnal periods. No difference was detected between the mice treated with Ab2 and those administered the control antibody.
  • mice Physical activity levels of the mice were determined by measuring the number of times the mice crossed infrared beams inside the metabolic cages. During the 72-hour period, the physical activity of mice treated with Ab2 showed a trend toward increased activity during all 72 hours in the cages as compared to the physical activity of mice treated with control antibody. This trend in increased physical activity was also clear when compared to the mice that were not calorie restricted (FIG. 5G). This trend in increased activity in the Ab2-treated mice was observed in both nocturnal and diurnal periods.
  • FIG. 7 shows the energy expenditure parameters of the mice that were 20% calorie restricted and treated with either the myostatin inhibitor antibody Ab2 or a control antibody.
  • Ab2 decreased the energy expenditure of the 20% calorie restricted mice and had little or no effect on the respiratory exchange rate.
  • Experiment 2 demonstrated the ability of the myostatin inhibiting antibody Ab2 to maintain lean mass. In animals that were moderately (20%) calorie restricted, myostatin inhibition supported the maintenance of lean mass but did not dramatically reduce body weight compared to the control antibody, although a trend towards reducing fat mass was observed. The treated animals showed a trend towards greater activity.
  • Experiment 1 was subjected to 30% calorie restriction and animals in Experiment 2 were subjected to 20% calorie restriction.
  • Another difference between Experiment 2 and Experiment 1 is that Experiment 2 used animals that were weight-stable (i.e.
  • Experiment 1 used animals that were in active weight loss.
  • the parameters measured in Experiment 2 e.g., energy expenditure, were measured during weight maintenance as opposed to the parameters measured in Experiment 1 , which were measured during active weight loss.
  • a myostatin pathway inhibitor and a GLP-1 pathway activator for use as a combination therapy for weight management in the treatment of obesity or overweight in a subject wherein the treatment comprises administration of effective amounts of the myostatin pathway inhibitor and the GLP-1 pathway activator to the subject to treat obesity or overweight, wherein optionally the subject has at least one weight-related condition.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator for use according to embodiment 1 wherein the myostatin pathway inhibitor and the GLP-1 pathway activator are formulated into a single formulation, or the myostatin pathway inhibitor and the GLP-1 pathway activator are part of a single molecular construct.
  • the myostatin pathway inhibitor and the GLP-1 pathway activator for use according to embodiment 1 wherein the myostatin pathway inhibitor and the GLP-1 pathway activator are formulated into separate formulations.
  • the inhibitor of the myostatin signaling pathway and the activator of the GLP-1 signaling pathway for use according to any one of the preceding embodiments, wherein the inhibitor of the myostatin signaling pathway is a myostatin-selective inhibitor, wherein optionally, the myostatin-selective inhibitor is apitegromab, trevogrumab, GYM329, or a MST1032 variant, wherein further optionally the variant is an Fc variant comprising one or more mutations that increase affinity for FcRn.
  • inhibitor of the myostatin signaling pathway and the activator of the GLP-1 signaling pathway for use according to any one of embodiments 1 -5, wherein the inhibitor of the myostatin signaling pathway is a myostatin- selective inhibitor that competes or cross-competes with apitegromab, trevogrumab, GYM329, or a MST1032 variant.
  • inhibitor of the myostatin signaling pathway and the activator of the GLP-1 signaling pathway for use according to any one of the preceding embodiments, wherein the inhibitor of the myostatin signaling pathway is a non-selective myostatin inhibitor, wherein optionally the non-selective myostatin inhibitor also inhibits Activin A and/or GDF11.
  • non-selective myostatin inhibitor is a ligand trap (e.g., ACE-031 , ACE- 083, and BIIB-110/ALG-801); an anti-ActRllb (e.g., bimagrumab); neutralizing antibody that binds mature myostatin (e.g., stamulumab (MYO-029), domagrozumab (PF-06252616), Landogrozumab (LY2495655), AMG-745/PINTA- 745 (Myostatin peptibody), RG6206 (an antimyostatin adnectin, which is a single-strand fusion protein containing domains of fibronectin), or BMS-986089 (anti-myostatin adnectin also known as taldefgrobep alfa).
  • a ligand trap e.g., ACE-031 , ACE- 083, and BIIB-110/ALG
  • the activator of the GLP-1 signaling pathway is a GLP-1 receptor agonist
  • the GLP-1 receptor agonist is a GLP-1 analog
  • the GLP-1 analog is semaglutide, exenatide ER, liraglutide, lixisenatide, tirzepatide, XW003, noisyiglutide, MEDI0382, dulaglutide or albiglutide.
  • the myostatin pathway inhibitor is an antibody or antigen-binding fragment thereof that binds an epitope that comprises one or more amino acid resides of KALDEN (SEQ ID NO: 118) and/or FVQILRLIKPMKDGTRYTGIRSLK (SEQ ID NO: 57), wherein the antibody or antigen-binding fragment cross- competes with apitegromab for antigen binding; wherein, optionally, the antibody or antigen-binding fragment comprises an HCDR3 sequence that contains up to two amino acid sequences as compared to SEQ ID NO: 10, wherein, further optionally, the antibody or antigen-binding fragment comprises a HCDR3 sequence comprising a leucine at amino acid position 3 and a tryptophan at amino acid position 9, as numbered according to SEQ ID NO: 10
  • a myostatin pathway inhibitor for use as an adjunct therapy for weight management in the treatment of obesity or overweight in a subject, wherein the treatment comprises administration of an effective amount of the myostatin pathway inhibitor to treat obesity or overweight, wherein the subject is treated with a GLP-1 pathway activator, wherein optionally the subject has at least one weight-related condition.
  • a GLP-1 pathway activator for use as an adjunct therapy for weight management in the treatment of obesity or overweight in a subject, wherein the treatment comprises administration of an effective amount of the GLP-1 pathway activator to treat obesity or overweight, wherein the subject is treated with a myostatin pathway inhibitor, wherein optionally the subject has at least one weight-related condition.
  • a myostatin pathway inhibitor for use in the treatment of obesity or overweight in a subject wherein the treatment comprises administration of an effective amount of the myostatin pathway inhibitor to treat obesity or overweight.
  • a myostatin pathway inhibitor for use in the treatment of type 2 diabetes mellitus associated with obesity in a subject, wherein the treatment comprises administration of an effective amount of the myostatin pathway inhibitor to treat type 2 diabetes mellitus associated with obesity.
  • a method of treating a mammalian subject having a metabolic disorder comprising: administering to the subject a myostatin pathway inhibitor (e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor) and a GLP-1 pathway activator, wherein the myostatin inhibitor and the GLP-1 pathway activator are administered in amounts sufficient to treat the metabolic disorder.
  • a myostatin pathway inhibitor e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • GLP-1 pathway activator e.g., a myostatin inhibitor, e.g., a myostatin-selective inhibitor
  • a method of treating a mammalian subject having a metabolic disorder and receiving a GLP-1 pathway activator comprising administering to the subject a myostatin pathway inhibitor in an amount sufficient to treat the metabolic disorder.
  • the myostatin inhibitor comprises stamulumab, trevogrumab, LY2495655, AMG 745, bimagrumab, Bl IB-110; domagrozumab, apitegromab, MS1032LO19, GYM329, taldefgrobep alfa, or efmitermant alfa.
  • the myostatin inhibitor is a selective myostatin inhibitor.
  • the myostatin inhibitor is an antibody or antigen binding fragment thereof that binds pro- and/or latent-myostatin, wherein optionally the antibody is apitegromab, GYM329, or a MST1032 variant.
  • the myostatin inhibitor is an antibody or antigen-binding fragment thereof that binds mature myostatin, wherein optionally the antibody is trevogrumab, a fragment or variant thereof.
  • GLP-1 pathway activator is a Protein kinase A (PKA) or exchange protein activated by cAMP (EPAC) activator.
  • PKA Protein kinase A
  • EPAC exchange protein activated by cAMP
  • the GLP-1 receptor agonist comprises albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002, glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, XW003, noisyiglutide, MEDI0382, or dulaglutide.
  • a method of treating or preventing muscle loss in a mammalian subject currently being treated with a GLP-1 receptor agonist and optionally on a calorie-restricted diet comprising administering to the subject a myostatin inhibitor wherein administration of the myostatin inhibitor reduces lean muscle loss.
  • a method of preventing a reduction in metabolic rate in a mammalian subject currently being treated with a GLP-1 receptor agonist and optionally on a calorie-restricted diet comprising administering to the subject a myostatin inhibitor, wherein administration of the myostatin inhibitor prevents a reduction in metabolic rate.
  • a method of increasing fat metabolism in a mammalian subject currently being treated with a GLP-1 receptor agonist and optionally on a calorie-restricted diet comprising administering to the subject a myostatin inhibitor, wherein administration of the myostatin inhibitor prevents a reduction in metabolic rate.
  • the myostatin inhibitor comprises stamulumab, trevogrumab, LY2495655, AMG 745, bimagrumab, Bl IB-110; domagrozumab, apitegromab, MS1032LO19, GYM329, taldefgrobep alfa, or efmitermant alfa.
  • the GLP-1 receptor agonist comprises albiglutide, taspoglutide, semaglutide, exenatide, BPI-3016, GW002, glutazumab, exendin-4, exenatide, GLP-1 (7-36)NH2, everestmab, liraglutide, lixisenatide, tirzepatide, XW003, noisyiglutide, MEDI0382, or dulaglutide.
  • a composition comprising a myostatin inhibitor and a GLP-1 pathway activator.
  • a method of maintaining a subject in a state of reduced weight following a weight-reducing treatment comprising administering a selective myostatin inhibitor and a GLP-1 receptor agonist to the subject, wherein the administration is carried out subsequent to the weight-reducing treatment in order to maintain the reduced body weight or delay an increase in body weight in the subject.
  • weight-reducing treatment comprises one or more of diet, exercise, and treatment with a weight-reducing agent.
  • the weight-reducing treatment comprises one or more of a lipase inhibitor, a cannabinoid receptor 1 agonist, a melanocortin-4 receptor agonist, a neuropeptide Y2 receptor antagonist, a 5-hydroxytryptamine 2C receptor agonist, a ghrelin antagonist, pancreatic peptide YY3-36, leptin, a diacylglycerol O-transferase 1 inhibitor, a noradrenaline-dopamine-5HT reuptake inhibitor, bupropion/naltrexone, bupropione/ zonisamide, topiramate/phentermine, pramlintide/metreleptin, a melanin-concentrating hormone antagonist, a cholecystokinin inhibitor, a fatty acid synthase inhibitor an acetyl Co-A carboxylase inhibitor, a stearoyl-CoA desaturase inhibitor, a beta 3

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Child & Adolescent Psychology (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Dermatology (AREA)
  • Neurology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/US2022/034588 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders Ceased WO2022271867A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
ES22744054T ES3062188T3 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
SI202230232T SI4358995T1 (sl) 2021-06-23 2022-06-22 Zaviralec miostatinske poti v kombinaciji z aktivatorjem poti glp-1 za uporabo pri zdravljenju presnovnih motenj
MX2023014840A MX2023014840A (es) 2021-06-23 2022-06-22 Un inhibidor de la vía de la miostatina en combinación con un activador de la vía de la glp-1 para su uso en el tratamiento de trastornos metabólicos.
EP22744054.2A EP4358995B1 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
EP25220159.5A EP4714494A3 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
CA3221555A CA3221555A1 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
PL22744054.2T PL4358995T3 (pl) 2021-06-23 2022-06-22 Inhibitor szlaku miostatyny w połączeniu z aktywatorem szlaku glp-1 do stosowania w leczeniu zaburzeń metabolicznych
DK22744054.2T DK4358995T3 (da) 2021-06-23 2022-06-22 Myostatin-vej-hæmmer i kombination med en glp-1-vej-aktivator til brug ved behandling af metaboliske forstyrrelser
AU2022299185A AU2022299185A1 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
FIEP22744054.2T FI4358995T3 (fi) 2021-06-23 2022-06-22 Mystostatiinireitin estäjä yhdessä glp-1-reitin aktivaattorin kanssa käytettäviksi metabolisten häiriöiden hoidossa
US18/572,397 US20240368262A1 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
IL309078A IL309078A (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a GLP-1 pathway activator for use in the treatment of metabolic disorders
JP2023578073A JP2024524159A (ja) 2021-06-23 2022-06-22 代謝障害の治療における使用のためのglp-1経路活性化剤と組み合わせたミオスタチン経路阻害剤

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US202163214234P 2021-06-23 2021-06-23
US63/214,234 2021-06-23
US202163260136P 2021-08-10 2021-08-10
US63/260,136 2021-08-10
US202163260254P 2021-08-13 2021-08-13
US63/260,254 2021-08-13
US202263266348P 2022-01-03 2022-01-03
US63/266,348 2022-01-03
US202263269702P 2022-03-21 2022-03-21
US63/269,702 2022-03-21

Publications (1)

Publication Number Publication Date
WO2022271867A1 true WO2022271867A1 (en) 2022-12-29

Family

ID=82608742

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/034588 Ceased WO2022271867A1 (en) 2021-06-23 2022-06-22 A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders

Country Status (15)

Country Link
US (1) US20240368262A1 (cg-RX-API-DMAC7.html)
EP (2) EP4714494A3 (cg-RX-API-DMAC7.html)
JP (1) JP2024524159A (cg-RX-API-DMAC7.html)
AU (1) AU2022299185A1 (cg-RX-API-DMAC7.html)
CA (1) CA3221555A1 (cg-RX-API-DMAC7.html)
DK (1) DK4358995T3 (cg-RX-API-DMAC7.html)
ES (1) ES3062188T3 (cg-RX-API-DMAC7.html)
FI (1) FI4358995T3 (cg-RX-API-DMAC7.html)
IL (1) IL309078A (cg-RX-API-DMAC7.html)
MX (1) MX2023014840A (cg-RX-API-DMAC7.html)
PL (1) PL4358995T3 (cg-RX-API-DMAC7.html)
PT (1) PT4358995T (cg-RX-API-DMAC7.html)
SI (1) SI4358995T1 (cg-RX-API-DMAC7.html)
TW (1) TW202317175A (cg-RX-API-DMAC7.html)
WO (1) WO2022271867A1 (cg-RX-API-DMAC7.html)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024064842A1 (en) * 2022-09-21 2024-03-28 Regeneron Pharmaceuticals, Inc. Methods of treating obesity, diabetes, and liver dysfunction
WO2025027052A1 (en) * 2023-07-31 2025-02-06 Sixpeaks Bio Ag Antibody conjugates and fusion proteins
US12338279B2 (en) 2022-12-22 2025-06-24 Scholar Rock, Inc. Selective and potent inhibitory antibodies of myostatin activation
WO2025219859A1 (en) * 2024-04-14 2025-10-23 Biohaven Therapeutics Ltd. Combination therapy to treat overweight, obesity, and related health conditions
WO2025245160A1 (en) 2024-05-21 2025-11-27 Scholar Rock, Inc. Myostatin-selective inhibitors for treating metabolic disorders
WO2026037938A1 (en) * 2024-08-16 2026-02-19 Protuoso Pte. Ltd. Fusion proteins comprising a glp-1 receptor agonist and a myostatin pathway inhibitor
US12582712B2 (en) 2015-09-15 2026-03-24 Scholar Rock, Inc. Method of making anti-pro/latent myostatin antibodies

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025227129A2 (en) 2024-04-25 2025-10-30 Starrock Pharma Llc Delivery vehicles comprising proglucagon derived polypeptides and anabolic polypeptides and uses thereof

Citations (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
EP0171496A2 (en) 1984-08-15 1986-02-19 Research Development Corporation of Japan Process for the production of a chimera monoclonal antibody
EP0173494A2 (en) 1984-08-27 1986-03-05 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by DNA splicing and expression
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
GB2177096B (en) 1984-09-03 1989-05-17 Celltech Ltd Production of chimeric antibodies
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US6582915B1 (en) 1991-12-02 2003-06-24 Medical Research Council Production of anti-self bodies from antibody segment repertories and displayed on phage
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2014182676A2 (en) 2013-05-06 2014-11-13 Scholar Rock, Inc. Compositions and methods for growth factor modulation
WO2016073853A1 (en) 2014-11-06 2016-05-12 Scholar Rock, Inc. Anti-pro/latent-myostatin antibodies and uses thereof
WO2016098357A1 (en) 2014-12-19 2016-06-23 Chugai Seiyaku Kabushiki Kaisha Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use
WO2017049011A1 (en) 2015-09-15 2017-03-23 Scholar Rock, Inc. Anti-pro/latent-myostatin antibodies and uses thereof
WO2017120523A2 (en) 2016-01-08 2017-07-13 Scholar Rock, Inc. Anti-pro/latent myostatin antibodies and methods of use thereof
WO2017218592A1 (en) 2016-06-13 2017-12-21 Scholar Rock, Inc. Use of myostatin inhibitors and combination therapies
WO2018116201A1 (en) * 2016-12-21 2018-06-28 Novartis Ag Myostatin, activin or activin receptor antagonists for use in treating obesity and related conditions
WO2018129395A1 (en) 2017-01-06 2018-07-12 Scholar Rock, Inc. Methods for treating metabolic diseases by inhibiting myostatin activation
WO2019193204A1 (en) * 2018-04-06 2019-10-10 Cyprumed Gmbh Pharmaceutical compositions for the transmucosal delivery of therapeutic peptides and proteins
WO2020160291A2 (en) * 2019-01-30 2020-08-06 Scholar Rock, Inc. LTBP COMPLEX-SPECIFIC INHIBITORS OF TGFβ AND USES THEREOF

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101704893B1 (ko) 2012-06-15 2017-02-08 화이자 인코포레이티드 Gdf-8에 대한 개선된 길항물질 항체 및 그의 용도
AR107078A1 (es) 2015-12-18 2018-03-21 Chugai Pharmaceutical Co Ltd Anticuerpo antimiostatina, polipéptidos que contienen regiones fc variantes así como métodos de uso
EP4218817A3 (en) * 2017-01-06 2023-09-06 Scholar Rock, Inc. Methods for treating metabolic diseases by inhibiting myostatin activation

Patent Citations (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4816397A (en) 1983-03-25 1989-03-28 Celltech, Limited Multichain polypeptides or proteins and processes for their production
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
EP0171496A2 (en) 1984-08-15 1986-02-19 Research Development Corporation of Japan Process for the production of a chimera monoclonal antibody
EP0173494A2 (en) 1984-08-27 1986-03-05 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by DNA splicing and expression
GB2177096B (en) 1984-09-03 1989-05-17 Celltech Ltd Production of chimeric antibodies
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
WO1990002809A1 (en) 1988-09-02 1990-03-22 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
WO1991017271A1 (en) 1990-05-01 1991-11-14 Affymax Technologies N.V. Recombinant library screening methods
WO1992020791A1 (en) 1990-07-10 1992-11-26 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992001047A1 (en) 1990-07-10 1992-01-23 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1992009690A2 (en) 1990-12-03 1992-06-11 Genentech, Inc. Enrichment method for variant proteins with altered binding properties
WO1992015679A1 (en) 1991-03-01 1992-09-17 Protein Engineering Corporation Improved epitode displaying phage
WO1992018619A1 (en) 1991-04-10 1992-10-29 The Scripps Research Institute Heterodimeric receptor libraries using phagemids
WO1993001288A1 (de) 1991-07-08 1993-01-21 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Phagemid zum screenen von antikörpern
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
US6593081B1 (en) 1991-12-02 2003-07-15 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6582915B1 (en) 1991-12-02 2003-06-24 Medical Research Council Production of anti-self bodies from antibody segment repertories and displayed on phage
US5981568A (en) 1993-01-28 1999-11-09 Neorx Corporation Therapeutic inhibitor of vascular smooth muscle cells
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
WO2000053211A2 (en) 1999-03-09 2000-09-14 University Of Southern California Method of promoting myocyte proliferation and myocardial tissue repair
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2014182676A2 (en) 2013-05-06 2014-11-13 Scholar Rock, Inc. Compositions and methods for growth factor modulation
WO2016073853A1 (en) 2014-11-06 2016-05-12 Scholar Rock, Inc. Anti-pro/latent-myostatin antibodies and uses thereof
WO2016098357A1 (en) 2014-12-19 2016-06-23 Chugai Seiyaku Kabushiki Kaisha Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use
WO2017049011A1 (en) 2015-09-15 2017-03-23 Scholar Rock, Inc. Anti-pro/latent-myostatin antibodies and uses thereof
WO2017120523A2 (en) 2016-01-08 2017-07-13 Scholar Rock, Inc. Anti-pro/latent myostatin antibodies and methods of use thereof
WO2017218592A1 (en) 2016-06-13 2017-12-21 Scholar Rock, Inc. Use of myostatin inhibitors and combination therapies
WO2018116201A1 (en) * 2016-12-21 2018-06-28 Novartis Ag Myostatin, activin or activin receptor antagonists for use in treating obesity and related conditions
WO2018129395A1 (en) 2017-01-06 2018-07-12 Scholar Rock, Inc. Methods for treating metabolic diseases by inhibiting myostatin activation
WO2019193204A1 (en) * 2018-04-06 2019-10-10 Cyprumed Gmbh Pharmaceutical compositions for the transmucosal delivery of therapeutic peptides and proteins
WO2020160291A2 (en) * 2019-01-30 2020-08-06 Scholar Rock, Inc. LTBP COMPLEX-SPECIFIC INHIBITORS OF TGFβ AND USES THEREOF

Non-Patent Citations (63)

* Cited by examiner, † Cited by third party
Title
"Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
"Remington, The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS AND WILKINS
"UniProt", Database accession no. 008689
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402
AMBERY ET AL., LANCET, vol. 391, no. 10140, 30 June 2018 (2018-06-30), pages 2607 - 2618
ANGAL S. ET AL.: "A single amino acid substitution abolishes the heterogeneity of chimeric mouse/human (lgG4) antibody", MOL IMMUNOL, vol. 30, 1993, pages 105 - 108, XP023683005, DOI: 10.1016/0161-5890(93)90432-B
BELHAYARA ET AL., NUTRIENTS, vol. 12, no. 3, March 2020 (2020-03-01), pages 727
BERGEN ET AL., SKELETAL MUSCLE, vol. 5, 2015, pages 21
BEYCHOK: "Cells of Immunoglobulin Synthesis", 1979, ACADEMIC PRESS
BURCH ET AL., J. NEUROL, 2017
CABRI ET AL., FRONT MOL BIOSCI., vol. 8, 2021, pages 697586
CAS , no. 782500-75-8
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
DAGBAY ET AL., J. BIOL. CHEM., vol. 295, no. 16, 2020, pages 5404 - 5418
DINICOLANTONIO, JJ, POSTPRANDIAL INSULIN ASSAY AS THE EARLIEST BIOMARKER FOR DIAGNOSING PRE-DIABETES, TYPE 2 DIABETES AND INCREASED CARDIOVASCULAR RISK, 28 November 2017 (2017-11-28), Retrieved from the Internet <URL:http://openheart.bmj.com/content/openhrt/4/2/e000656.full.pdf>
EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688
EUR J PHARMACOL., vol. 890, 5 January 2021 (2021-01-05), pages 173650
FALLAH ET AL., MAGMA, vol. 30, no. 2, 2017, pages 139 - 151
GARITO ET AL., DIABETES OBES METAB., vol. 20, no. 1, 2017, pages 94 - 102
GARITO ET AL., DIABETES OBES METAB., vol. 20, no. 1, 2018, pages 94 - 102
GOYAL ET AL., N AM J MED SCI., vol. 4, no. 4, 2012, pages 180 - 184
HARMS ET AL., NATURE MEDICINE., vol. 19, no. 10, 2013, pages 1252 - 63
HEYMSFIELD ET AL., J BIOL CHEM., vol. 295, no. 16, 17 April 2020 (2020-04-17), pages 5404 - 5418
HEYMSFIELD ET AL., JAMA NETWORK OPEN, vol. 4, no. 1, 2021, pages e2033457
HREBICEK ET AL., J CLIN ENDOCRINOL METAB., vol. 87, no. 1, 2002, pages 144 - 147
HWANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4030
IGAWA ET AL.: "Engineered Monoclonal Antibody with Novel Antigen-Sweeping Activity In vivo", PLOS ONE, vol. 8, no. 5, 2013, pages e63236, XP055626799, DOI: 10.1371/journal.pone.0063236
IGAWA ET AL.: "pH-dependent antigen-binding antibodies as a novel therapeutic modality", BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1844, 2014, pages 1943 - 1950, XP029050320, DOI: 10.1016/j.bbapap.2014.08.003
JONES ET AL., INT J BODY COMPOS RES., vol. 302, no. 2, 2009, pages 67 - 72
JONES ET AL., NAT. COMM., vol. 9, 2018, pages 1602
KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 68
KARLINALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 77
KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 499
LATRES ET AL., NATURE COMMUNICATIONS, vol. 8, 2017, pages 15153
LI ET AL., BIOCHEM PHARMACOL., vol. 150, April 2018 (2018-04-01), pages 46 - 53
MARIOT ET AL., NAT. COM., vol. 8, 2017, pages 1859
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MASHOOD ET AL., J MAGN RESON IMAGING., vol. 37, no. 6, 2013, pages 1359 - 1370
MATSUDA ET AL., DIABETES CARE., vol. 22, no. 9, 1999, pages 1462 - 1470
MEECE J., ADV THER., vol. 34, 2017, pages 638 - 657
MOKDAD ET AL., JAMA: THE JOURNAL OF THE AMERICAN MEDICAL ASSOCIATION, vol. 289, no. 1, 2001, pages 76 - 9
MORRISON ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 81, 1985, pages 6851
MURAMATSU ET AL., SCI REP., vol. 11, no. 1, 25 January 2021 (2021-01-25), pages 2160
NAKANO ET AL., J CLIN EXP HEPATOL., vol. 5, no. 3, pages 190 - 8
PAN ET AL., ARTIFICIAL CELLS, NANOMEDICINE, AND BIOTECHNOLOGY, vol. 48, no. 1, 2020, pages 854 - 866
PHARMACOL RES., vol. 122, August 2017 (2017-08-01), pages 130 - 139
PROG MOL BIOL TRANSL SCI., vol. 121, 2014, pages 23 - 65
RENA ET AL., DIABETOLOGIA, vol. 60, 2017, pages 1577 - 85
ROBBERECHT ET AL., METAB SYNDR RELAT DISORD., vol. 14, no. 2, March 2016 (2016-03-01), pages 47 - 93
ROOKS ET AL., J AMGERIATR SOC., vol. 65, no. 9, 2017, pages 1988 - 1995
ROSENBAUM ET AL., J CLIN INVEST., vol. 115, no. 12, December 2005 (2005-12-01), pages 3579 - 86
ROSENSTOCK ET AL., LANCET, vol. 398, 2020, pages 143 - 155
ROSSI ET AL., OBESITY (SILVER SPRING, vol. 19, no. 9, 2011, pages 1747 - 1754
S. SCHIAFFINO, J. MUSCLE RES. CELL. MOTIL., vol. 10, 1989, pages 197 - 205
See also references of EP4358995A1
SENGLE ET AL., J. BIOL. CHEM., vol. 286, no. 7, 2011, pages 5087 - 5099
SMITH, SCIENCE, vol. 228, 1985, pages 1315 - 1317
STANFORD ET AL., J CLIN INVEST., vol. 123, no. 1, 2013, pages 215 - 223
SUH ET AL., PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 117, no. 9, 2020, pages 4910 - 4920
TAKEDA ET AL., NATURE, vol. 314, 1985, pages 452
WILLIAMS, DIABETES THER, vol. 11, 2020, pages 1199 - 1216
YOKOYAMA ET AL., J CLIN ENDOCRINOL METAB., vol. 89, no. 3, 2004, pages 1481 - 1484

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12582712B2 (en) 2015-09-15 2026-03-24 Scholar Rock, Inc. Method of making anti-pro/latent myostatin antibodies
WO2024064842A1 (en) * 2022-09-21 2024-03-28 Regeneron Pharmaceuticals, Inc. Methods of treating obesity, diabetes, and liver dysfunction
US12338279B2 (en) 2022-12-22 2025-06-24 Scholar Rock, Inc. Selective and potent inhibitory antibodies of myostatin activation
WO2025027052A1 (en) * 2023-07-31 2025-02-06 Sixpeaks Bio Ag Antibody conjugates and fusion proteins
WO2025219859A1 (en) * 2024-04-14 2025-10-23 Biohaven Therapeutics Ltd. Combination therapy to treat overweight, obesity, and related health conditions
WO2025245160A1 (en) 2024-05-21 2025-11-27 Scholar Rock, Inc. Myostatin-selective inhibitors for treating metabolic disorders
WO2026037938A1 (en) * 2024-08-16 2026-02-19 Protuoso Pte. Ltd. Fusion proteins comprising a glp-1 receptor agonist and a myostatin pathway inhibitor

Also Published As

Publication number Publication date
FI4358995T3 (fi) 2026-02-04
JP2024524159A (ja) 2024-07-05
DK4358995T3 (da) 2026-02-02
EP4358995A1 (en) 2024-05-01
EP4714494A2 (en) 2026-03-25
EP4358995B1 (en) 2025-12-03
TW202317175A (zh) 2023-05-01
SI4358995T1 (sl) 2026-03-31
PT4358995T (pt) 2026-02-17
US20240368262A1 (en) 2024-11-07
CA3221555A1 (en) 2022-12-29
AU2022299185A1 (en) 2024-01-25
PL4358995T3 (pl) 2026-04-20
EP4714494A3 (en) 2026-04-22
ES3062188T3 (en) 2026-04-09
IL309078A (en) 2024-02-01
MX2023014840A (es) 2024-02-12

Similar Documents

Publication Publication Date Title
EP4358995B1 (en) A myostatin pathway inhibitor in combination with a glp-1 pathway activator for use in treating metabolic disorders
JP7723649B2 (ja) 抗プロ/潜在型ミオスタチン抗体およびその使用方法
AU2022268305B2 (en) Methods for treating metabolic diseases by inhibiting myostatin activation
US12338279B2 (en) Selective and potent inhibitory antibodies of myostatin activation
WO2018129395A1 (en) Methods for treating metabolic diseases by inhibiting myostatin activation
HK40097104A (en) Methods for treating metabolic diseases by inhibiting myostatin activation
HK40015470A (en) Treating metabolic diseases by inhibiting myostatin activation
HK40015470B (en) Treating metabolic diseases by inhibiting myostatin activation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22744054

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 309078

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 3221555

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/014840

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2023578073

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022299185

Country of ref document: AU

Ref document number: AU2022299185

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2022744054

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022299185

Country of ref document: AU

Date of ref document: 20220622

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022744054

Country of ref document: EP

Effective date: 20240123

WWG Wipo information: grant in national office

Ref document number: 2022744054

Country of ref document: EP