WO2022261079A2 - Proteins that bind cd80 and/or cd86, and ox40l - Google Patents

Proteins that bind cd80 and/or cd86, and ox40l Download PDF

Info

Publication number
WO2022261079A2
WO2022261079A2 PCT/US2022/032482 US2022032482W WO2022261079A2 WO 2022261079 A2 WO2022261079 A2 WO 2022261079A2 US 2022032482 W US2022032482 W US 2022032482W WO 2022261079 A2 WO2022261079 A2 WO 2022261079A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
chain variable
determining region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/032482
Other languages
English (en)
French (fr)
Other versions
WO2022261079A3 (en
Inventor
Alec Gross
Chia Chi SUN
Gang Chen
Yves Fomekong NANFACK
Qi AN
Bijan ZAKERI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merck Patent GmbH
Original Assignee
Merck Patent GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to IL309119A priority Critical patent/IL309119A/en
Priority to JP2023575897A priority patent/JP2024524880A/ja
Priority to BR112023025553A priority patent/BR112023025553A2/pt
Priority to EP22820886.4A priority patent/EP4351644A4/en
Priority to KR1020247000142A priority patent/KR20240019224A/ko
Priority to CN202280055594.9A priority patent/CN117794575A/zh
Priority to MX2023014695A priority patent/MX2023014695A/es
Priority to CA3218785A priority patent/CA3218785A1/en
Application filed by Merck Patent GmbH filed Critical Merck Patent GmbH
Priority to AU2022290257A priority patent/AU2022290257A1/en
Publication of WO2022261079A2 publication Critical patent/WO2022261079A2/en
Publication of WO2022261079A3 publication Critical patent/WO2022261079A3/en
Priority to US18/530,536 priority patent/US20240262922A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/32Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • EMD-015WO_SL.txt Said ASCII copy, created on May 25, 2022, is named EMD-015WO_SL.txt and is 872,058 bytes in size.
  • FIELD OF THE DISCLOSURE The present disclosure relates generally to proteins capable of modulating T cell costimulatory signaling, and uses of the same in the treatment of autoimmune diseases/disorders.
  • BACKGROUND A major therapeutic goal for the treatment of autoimmune diseases is to modulate T cell stimulation by specifically targeting costimulatory pathways.
  • T cells become fully activated when they receive two signals from: 1) T-cell receptor (TCR) activation due to interaction with a peptide/MHC complex on the surface of an antigen presenting cell (APC); and 2) T cell costimulatory receptor activation due to interaction with their cognate ligands.
  • T cell stimulation in the absence of the second costimulatory signal results in the development of anergic or tolerogenic T cell responses.
  • costimulatory molecules There are two major groups of costimulatory molecules: 1) the B7-CD28 superfamily, and 2) the tumor necrosis factor receptor (TNFR) superfamily.
  • Costimulatory molecules in the B7-CD28 superfamily include CD28 and ICOS on T cells and their cognate ligands CD80/CD86 (also known as B7.1/B7.2) and ICOS-L, respectively, on the surface of APCs.
  • Costimulatory molecules in the TNFR superfamily include 4-1BB, CD40L, OX40, CD27, GITR, and CD30 on T cells and their cognate ligands 4-1BBL, CD40, OX40L, CD70, GITRL, and CD30L, respectively.
  • APCs such as B cells, monocytes, macrophages and dendritic cells up-regulate the expression of CD80 and CD86 upon activation by antigenic, inflammatory, or pathogen- associated molecular pattern receptors. These ligands engage CD28 on T cells and provide the necessary second costimulatory signal to activate na ⁇ ve T cells and promote T cell proliferation.
  • CD80 and CD86 have a higher affinity to CTLA4 than CD28, CTLA4 expression on T cells inhibits CD80/CD86 binding to CD28 by sequestering the costimulatory ligands and attenuating T cell activation.
  • Abatacept is a soluble recombinant CTLA4-Ig fusion protein comprising of the extracellular domain of human CTLA4 and a modified human immunoglobulin 1 (IgG1) Fc domain.
  • Abatacept selectively binds CD80/CD86 on APCs and prevent costimulatory activation of CD28 on T cells, resulting in decreased T cell activation, signaling and proliferation.
  • Abatacept has demonstrated clinical efficacy in treating a number of autoimmune diseases including adult rheumatoid arthritis, psoriatic arthritis, and juvenile idiopathic arthritis.
  • OX40L also known as CD252, gp34, and TNFSF4
  • CD252, gp34, and TNFSF4 are 34kDa type II transmembrane protein of the TNF superfamily. OX40L expression is induced upon activation of APCs and chronically activated T cells. OX40L is also upregulated in non-lymphoid cells like human tonsillar mast cells, bronchial smooth muscle cells, and vascular endothelial cells of inflamed or diseased tissues.
  • OX40L exists in a soluble form due to cleavage by proteolytic enzymes as is typical of most TNF family ligands. Soluble OX40L serum levels have been reported to be elevated in autoimmune disease patients as compared to healthy subjects. [0009] OX40L on APCs binds to OX40 (CD134, TNFRSF4) expressed on activated CD4 and CD8 T cells. OX40 is not expressed on resting na ⁇ ve or resting memory T cells. OX40L binds as a homotrimeric complex to three OX40 monomers on T cells.
  • OX40L binding of OX40L to OX40 stimulates T cell expansion, differentiation, and survival of T effector subsets including T helper 1 (Th1), T helper 2 (Th2), T follicular helper (Tfh), and T helper 17 (Th17) cells.
  • OX40 signaling is also critical for the generation, maintenance, and optimal re-activation of memory CD4+ T cells.
  • Dysregulation of the OX40L-OX40 pathway had been implicated in a wide variety of inflammatory diseases such as multiple sclerosis, arthritis, graft versus host disease (GVHD), lupus nephritis and rheumatoid arthritis.
  • TNFSF4 the gene encoding OX40L
  • SLE systemic lupus erythematosus
  • SSc systemic sclerosis
  • Myeloid cells and B cells expressing OX40L have been demonstrated to support Tfh cell development, contributing to SLE disease pathogenesis.
  • OX40L-OX40 signaling also contributes to the pathogenesis of autoimmune disease by dysregulating T regulatory cells (Tregs or Tregs). Foxp3+ Tregs play an important role in establishing immunological tolerance by suppressing over-activated T effector (Teff, Teff, or Teffector) cells.
  • the invention generally relates to proteins capable of modulating T cell costimulatory signaling, and uses of the same in the treatment of autoimmune diseases/disorders.
  • the present disclosure provides a protein comprising a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, and a polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is a polypeptide comprising a CTLA4 extracellular domain or functional fragment thereof; a polypeptide comprising a CD28 extracellular domain or functional fragment thereof; an antibody; a Fab; a Fab’, a F(ab’)2, a single-chain variable fragment (scFv); a minibody; or a nanobody (VHH).
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 comprises an extracellular domain of CTLA4 or functional fragment thereof consisting of or comprising a sequence having at least 90% sequence identity to SEQ ID NO: 29, SEQ ID NO: 173, or SEQ ID NO: 174.
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 inhibits CD28 costimulatory signaling in T cells.
  • the polypeptide or complex of two or more polypeptides that specifically binds OX40L inhibits binding of endogenous OX40L to endogenous OX40.
  • the polypeptide or complex of two or more polypeptides that specifically binds OX40L comprises an antigen-binding site.
  • the antigen binding site is an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH).
  • the antigen-binding site is a Fab comprising a polypeptide comprising the sequence of SEQ ID NO: 336 connected to the C-terminus of the Fab heavy chain CH1 domain.
  • proteins of the present disclosure further comprise a bridging moiety.
  • the bridging moiety is functional or non-functional.
  • the bridging moiety comprises polypeptide of an immunoglobulin Fc domain or functional fragment thereof, a human serum albumin (HSA) polypeptide or functional fragment thereof, a polypeptide linker, or a polypeptide hinge.
  • the bridging moiety comprises a polypeptide of a human IgG1, IgG2, IgG3, or IgG4 Fc domain.
  • the polypeptide of a human IgG1 Fc domain comprises a sequence having at least 90% or 100% sequence identity to an amino acid sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 238, SEQ ID NO: 214, SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240.
  • the polypeptide of a human IgG1 Fc domain comprises one or more than one effector function silencing mutation.
  • the hinge polypeptide comprises mutations at positions 234 and 235 from leucine to alanine.
  • the bridging moiety further comprises a hinge polypeptide comprising an amino acid sequence having at least 90% sequence identity to an amino acid sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 242, SEQ ID NO: 176, SEQ ID NO: 249, SEQ ID NO: 177, SEQ ID NO: 243, SEQ ID NO: 212, SEQ ID NO: 244, SEQ ID NO: 213, SEQ ID NO: 245, SEQ ID NO: 247, and SEQ ID NO: 248.
  • a hinge polypeptide comprising an amino acid sequence having at least 90% sequence identity to an amino acid sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 242, SEQ ID NO: 176, SEQ ID NO: 249, SEQ ID NO: 177, SEQ ID NO: 243, SEQ ID NO: 212, SEQ ID NO: 244, SEQ ID NO: 213, SEQ ID NO: 245, SEQ ID NO: 247, and SEQ ID NO: 2
  • the bridging moiety is connected to the N-terminus or the C-terminus of the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86.
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is connected to the N-terminus of the bridging moiety.
  • the bridging moiety is connected to the N-terminus or the C-terminus of the polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected to the C-terminus of the bridging moiety.
  • a linker polypeptide comprising a (GGGGS)n (SEQ ID NO: 181) sequence, wherein n is 1 to 12, connects the polypeptide or complex of two or more polypeptides that specifically binds OX40L to the bridging moiety.
  • proteins of the present disclosure comprise a second polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the bridging moiety is a polypeptide of a human IgG1 Fc domain and the polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected to the C-terminus of the polypeptide of the human IgG1 Fc domain and the second polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected to the C- terminus of a second polypeptide of a human IgG1 Fc domain.
  • the first and/or the second polypeptide or complex of two or more polypeptides that specifically binds OX40L comprises an antigen-binding site, for example a Fab, or an extracellular domain of OX40 or functional fragment thereof.
  • the second polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected to the bridging moiety by a linker polypeptide comprising a (GGGGS) n (SEQ ID NO: 181) sequence, wherein n is 1 to 12.
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence of (a) ARHRGX1YX2FDX3 (SEQ ID NO: 220), wherein X1 is S or I, X2 is F or H, and X3 is I or Y; or (b) ARERSX1X2WYPX3DY (SEQ ID NO: 221) wherein X1 is N or S, X2 is N, D, G or S, and X3 is I or F.
  • proteins of the present disclosure comprise antigen-binding sites comprising (a) a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence GX1SX2X3X4SX5YY (SEQ ID NO: 222), wherein X1 is A, G, or V, X2 is V, or I, X3 is S or R, X4 is S, or T, and X5 is S, or G; (b) a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of: (1) IX 1 YX 2 GST (SEQ ID NO: 223) wherein X 1 is Y, or N, and X 2 is S, or G, (2) X 1 DYSGT (SEQ ID NO: 224) wherein X 1 is I or M, or (3) IGSVDYSGX 1 T (SEQ ID NO: 225), wherein X 1 is N, A, or S; and (c) a heavy chain variable complementarity-determining region 1
  • proteins of the present disclosure comprise antigen-binding sites comprising (a) a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of: (1) X1IENKN (SEQ ID NO: 226), wherein X1 is N or D, or (2) SX1RX2X3X4 (SEQ ID NO: 227), wherein X1 is V or L, X2 is R or N, X3 is F or Y, and X4 is F or Y; (b) a light chain variable complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of: RDN (SEQ ID NO: 82), GKD (SEQ ID NO: 228), or RDS (SEQ ID NO: 90); and (c) a light chain variable complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of: (1) QVX1DSX2X3VV (SEQ ID NO: 231), wherein X1 is R or
  • proteins of the present disclosure comprise antigen-binding sites comprising (i) (a) a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence GX 1 SX 2 X 3 X 4 SX 5 YY (SEQ ID NO: 222), wherein X 1 is A, G, or V, X 2 is V, or I, X 3 is S or R, X 4 is S, or T, and X 5 is S, or G; and (b) a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence IX 1 YX 2 GST (SEQ ID NO: 223), wherein X 1 is Y, or N, and X 2 is S, or G; and (c) a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence ARHRGX 1 YX 2 FDX 3 (SEQ ID NO: 220), wherein X 1 is S or I, X
  • proteins of the present disclosure comprise antigen-binding sites comprising (i) (a) a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence GX 1 SX 2 X 3 X 4 SX 5 YY (SEQ ID NO: 222), wherein X 1 is A, G, or V, X 2 is V, or I, X 3 is S or R, X 4 is S, or T, and X 5 is S, or G; and (b) a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence X 1 DYSGT (SEQ ID NO: 224), wherein X 1 is I or M; and (c) a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence ARERSX 1 X 2 WYPX 3 DY (SEQ ID NO: 221), wherein X 1 is N or S, X 2 is N, D, G or S, and
  • proteins of the present disclosure comprise antigen-binding sites comprising a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain complementarity- determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of RDN (SEQ ID NO: 82), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of QVRDSNIVV (SEQ ID NO: 83).
  • VHCDR1 comprising an amino acid sequence of GGSIST
  • proteins of the present disclosure comprise antigen-binding sites comprising a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a heavy chain complementarity- determining region 2 (VHCDR2) comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a light chain complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of SVRRFF (SEQ ID NO: 97), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of GKD (SEQ ID NO: 98), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of NSRDSSGYLVL (SEQ ID NO: 99).
  • VHCDR1 comprising an amino acid sequence of GVS
  • proteins of the present disclosure comprise antigen-binding sites comprising a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a heavy chain complementarity- determining region 2 (VHCDR2) comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a light chain complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • VHCDR1 comprising an amino acid sequence of GASVSSSSYY
  • proteins of the present disclosure comprise antigen-binding sites comprising a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101) a heavy chain complementarity- determining region 2 (VHCDR2) comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a light chain complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • VHCDR1 comprising an amino acid sequence of GGSISSSS
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 76, SEQ ID NO: 92, SEQ ID NO: 84, or SEQ ID NO: 100, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 80, SEQ ID NO: 96, SEQ ID NO: 88, or SEQ ID NO: 104.
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 76, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 80.
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 92, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 96. [0030] In some embodiments, proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 8, SEQ ID NO: 16, SEQ ID NO: 14, or SEQ ID NO: 18, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 13, or SEQ ID NO: 17.
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 8, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 7.
  • proteins of the present disclosure comprise antigen-binding sites comprising an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 16, and an amino acid sequence having at least 90% sequence identity to SEQ ID NO: 15.
  • proteins of the present disclosure comprise antigen-binding sites that bind at position 60 and/or 83 of the extracellular domain of human OX40L.
  • the antigen-binding site binds at position 17, 18, 19, 20, 21, 23, 26, 28, 60, 83, 110, 111, 112, 113, and 114 of the extracellular domain of human OX40L. In some embodiments, the antigen-binding site binds at position 58, 59, 60, 61, 62, 63, 81, 82, and 83 of the extracellular domain of human OX40L.
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a bridging moiety comprising a sequence comprising of SEQ ID NO: 177 and a sequence comprising of SEQ ID NO: 179; and (iii) an antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81),
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a first bridging moiety comprising a sequence comprising of SEQ ID NO: 177 and a sequence comprising of SEQ ID NO: 179; and (iii) a first antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain variable complementarity-determining region 1 (VLCDR1) comprising
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) an antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of SVRRFF (SEQ ID NO: 97), a
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a first bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) a first antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a light chain variable complementarity-determining region 1 (VLCDR1) comprising an
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 214; and (iii) an antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a light chain variable complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a light chain variable complementarity- determining
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide complex the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a first bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 214; and (iii) a first antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) an antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a light chain variable complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of NIENKN (SEQ ID NO: 89),
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a first bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) a first antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a heavy chain variable complementarity- determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a light chain variable complementarity-determining region 1 (VLCDR1) comprising
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) an antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81),
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising SEQ ID NO: 174; (ii) a first bridging moiety comprising a sequence comprising of SEQ ID NO: 213 and a sequence comprising of SEQ ID NO: 216; and (iii) a first antigen-binding site comprising, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain variable complementarity-determining region 1 (VLCDR1) comprising
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214; SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) an antigen-binding site comprising
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a first bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214; SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215.
  • SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235 (ii) a bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214, SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) an antigen-binding site comprising a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of SYAMS (SEQ ID NO: 105), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IISGSGGFTYYADSVK (
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215.
  • SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235 (ii) a first bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214, SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) a first antigen-binding site comprising a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of SYAMS (SEQ ID NO: 105), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IISGSGGFTYYAD
  • SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235 (ii) a second bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214, SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) a second antigen-binding site comprising a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of SYAMS (SEQ ID NO: 105), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IISGSGGFTYYAD
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214 , SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) an antigen-binding site comprising
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a first bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214 , SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO:
  • proteins of the present disclosure comprise (i) a polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214 , SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO: 240; and (iii) an antigen-binding site comprising
  • proteins of the present disclosure comprise a first arm and a second arm, the first arm comprising (i) a first polypeptide comprising the extracellular domain of CTLA4 comprising a sequence selected from a group consisting of SEQ ID NO: 174, SEQ ID NO: 119, SEQ ID NO: 215, SEQ ID NO: 233, SEQ ID NO: 234, and SEQ ID NO: 235; (ii) a first bridging moiety comprising a sequence selected from a group consisting of SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 248, and a sequence selected from a group consisting of SEQ ID NO: 178, SEQ ID NO: 237, SEQ ID NO: 214 , SEQ ID NO: 216, SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 239, and SEQ ID NO:
  • proteins of the present disclosure comprise an amino acid sequence at least 90% identical to the amino acid sequence of SEQ ID NO: 40, SEQ ID NO: 62, SEQ ID NO: 64, SEQ ID NO: 182, SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, SEQ ID NO: 186, SEQ ID NO: 48, SEQ ID NO: 68, SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, SEQ ID NO: 190, SEQ ID NO: 191, SEQ ID NO: 46, SEQ ID NO: 66, SEQ ID NO: 192, SEQ ID NO: 193, SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 196, SEQ ID NO: 50, SEQ ID NO: 70, SEQ ID NO: 197, SEQ ID NO: 198, SEQ ID NO: 199, SEQ ID NO: 200, SEQ ID NO: 201, SEQ ID NO:
  • proteins of the present disclosure comprise polypeptides comprising amino acid sequences at least 90% identical to the amino acid sequences of: SEQ ID NO: 40 and SEQ ID NO: 39; SEQ ID NO: 62 and SEQ ID NO: 61; SEQ ID NO: 64 and SEQ ID NO: 63; SEQ ID NO: 182 and SEQ ID NO: 63; SEQ ID NO: 183 and SEQ ID NO: 63; SEQ ID NO: 184 and SEQ ID NO: 63; SEQ ID NO: 185 and SEQ ID NO: 63; SEQ ID NO: 186 and SEQ ID NO: 63; SEQ ID NO: 48 and SEQ ID NO: 47; SEQ ID NO: 68 and SEQ ID NO: 67; SEQ ID NO: 187 and SEQ ID NO: 67; SEQ ID NO: 188 and SEQ ID NO: 67; SEQ ID NO: 189 and SEQ ID NO: 67; SEQ ID NO: 190 and SEQ ID NO: 67
  • proteins of the present disclosure comprise two polypeptides comprising amino acid sequences of SEQ ID NO: 63 and two polypeptides comprising amino acid sequences of SEQ ID NO: 64, or two polypeptides comprising amino acid sequences of SEQ ID NO: 68 and two polypeptides comprising amino acid sequences of SEQ ID NO: 67.
  • proteins of the present disclosure have an IC50 less than 12 nM, for example 5 nM to 12 nM or 5 nM to 9 nM, as measured in an OX40L neutralization/OX40- HEK reporter assay.
  • proteins of the present disclosure have an IC50 of 2 nM to 12 nM, for example 2 nM to 9.5 nM, as measured in a primary T cell activation assay. [0057] In some embodiments, proteins of the present disclosure have a K D for OX40L binding of less than 75 nM, for example 20 nM to 75 nM, as measured in a Biacore assay.
  • a protein of the present disclosure significantly inhibits at least one of IL-2, IFN ⁇ , IL-6, and TNF ⁇ production by cells in an in vitro mixed lymphocyte reaction assay as compared to cells treated under the same conditions but in the absence of protein, or in the presence of a human CTLA4 extracellular domain fused at the N-terminus of a human IgG1 Fc domain (CTLA4-Ig) and an anti-OX40L antibody, presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig human IgG1 Fc domain
  • a protein of the present disclosure significantly inhibits alloreactive CD4 + and CD8 + T cell proliferation in an in vitro mixed lymphocyte reaction assay as compared to alloreactive CD4 + and CD8 + T cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig and/or an anti-OX40L antibody.
  • a protein of the present disclosure preferentially inhibits alloreactive CD4 + and CD8 + T cell proliferation as compared to regulatory T cell (T reg ) proliferation in an in vitro mixed lymphocyte reaction assay as compared to alloreactive CD4 + and CD8 + T cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig and/or an anti-OX40L antibody.
  • a protein of the present disclosure significantly enhances T reg suppressive function in an in vitro mixed lymphocyte reaction assay as compared to T reg cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4- Ig and/or an anti-OX40L antibody.
  • a protein of the present disclosure significantly inhibits alloreactive CD4 + and CD8 + T cell proliferation in an adoptive transfer assay in humanized mice as compared to alloreactive CD4 + and CD8 + T cells in mice treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig and/or an anti-OX40L antibody.
  • a protein of the present disclosure significantly inhibits serum IFN ⁇ levels in an adoptive transfer assay in humanized mice as compared to mice treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig and/or an anti-OX40L antibody.
  • a protein of the present disclosure is not significantly internalized into myeloid-derived dendritic cells (MDDCs).
  • a protein of the present disclosure is cross-reactive with cynomolgus OX40L and/or is not cross-reactive with mouse, rabbit, or rat OX40L.
  • a protein of the present disclosure is cross reactive with cynomolgus CD80 and CD86.
  • the present disclosure provides the use of a heavy chain polypeptide as disclosed herein in the preparation of a protein comprising the heavy chain polypeptide and a light chain polypeptide as disclosed herein.
  • the present disclosure provides a formulation comprising a protein as disclosed herein and a pharmaceutically acceptable carrier.
  • the present disclosure provides a nucleic acid encoding a protein as disclosed herein.
  • the present disclosure provides a cell comprising one or more nucleic acids encoding a protein as disclosed herein.
  • the present disclosure provides a method of treating an autoimmune disease in a patient comprising administering to the patient a protein or formulation as disclosed herein.
  • autoimmune diseases that can be treated by proteins of the present disclosure include rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, atopic dermatitis, Achalasia, Addison’s disease, Adult Still's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome, Autoimmune angioedema, Autoimmune dysautonomia, Autoimmune encephalomyelitis, Autoimmune hepatitis, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune orchitis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune urticaria, Axonal & neuronal neuropathy (AMAN), Baló disease, Behcet’s, Be
  • the present disclosure provides a method of treating graft versus host disease (GVHD) in a patient, comprising administering to the patient a protein or formulation as disclosed herein.
  • GVHD graft versus host disease
  • the present disclosure provides an antibody or functional fragment thereof comprising, according to the IMGT unique numbering scheme, a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain variable complementarity- determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81), a light chain variable complementarity-determining region 2 (VLCDR2) comprising
  • an antibody of the present disclosure comprises a heavy chain variable domain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 76, and a light chain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 80.
  • an antibody of the present disclosure or functional fragment thereof comprises, according to the IMGT unique numbering scheme, a VHCDR1 comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a VHCDR2 comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a VHCDR3 comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a VLCDR1 comprising an amino acid sequence of SVRRFF (SEQ ID NO: 97), a VLCDR2 comprising an amino acid sequence of GKD (SEQ ID NO: 98), and a VLCDR3 comprising an amino acid sequence of NSRDSSGYLVL (SEQ ID NO: 99).
  • an antibody of the present disclosure comprises a heavy chain variable domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 92, and a light chain variable domain comprises an amino acid sequence at least 90% identical to SEQ ID NO: 96.
  • an antibody of the present disclosure or functional fragment thereof comprises, according to the IMGT unique numbering scheme, a VHCDR1 comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a VHCDR2 comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a VHCDR3 comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • an antibody of the present disclosure comprises a heavy chain variable domain comprising an amino acid sequence at least 90% identical to SEQ ID NO: 84, and the light chain variable domain (VL) comprises an amino acid sequence at least 90% identical to SEQ ID NO: 88.
  • an antibody of the present disclosure or functional fragment thereof comprises, according to the IMGT unique numbering scheme, a VHCDR1 comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101), a VHCDR2 comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a VHCDR3 comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • an antibody of the present disclosure comprises a heavy chain variable domain (VH) comprising an amino acid sequence at least 90% identical to SEQ ID NO: 100, and a light chain variable domain (VL) comprises an amino acid sequence at least 90% identical to SEQ ID NO: 104.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • antibodies of the present disclosure, or functional fragments thereof are human IgG1 antibodies.
  • the present disclosure provides the use of an antibody as disclosed herein or functional fragment thereof, in the preparation of a protein as disclosed herein. [0081] Other embodiments and details of the disclosure are presented herein below.
  • FIGs.1A-1W provide schematic illustrations of various protein designs of fusion proteins with Ig Fc constant domains that bind CD80 and/or CD86, and OX40L.
  • FIG.1A is a schematic illustration of an exemplary fusion protein where Extracellular Domains (ECDs) of CD28 are fused to the N-terminus of an Fc domain and ECDs of OX40 are fused to the C- terminus of the same Fc domain.
  • FIG.1B is a schematic illustration of an exemplary fusion protein where ECDs of OX40 are fused to the N-terminus of an Fc domain and ECDs of CD28 are fused to the C-terminus of the same Fc domain.
  • FIG.1C is a schematic illustration of an exemplary fusion protein where ECDs of CTLA4 are fused to the N-terminus of an Fc domain and ECDs of OX40 are fused to the C-terminus of the same Fc domain.
  • FIG.1D is a schematic illustration of an exemplary fusion protein where ECDs of OX40 are fused to the N-terminus of an Fc domain and ECDs of CTLA4 are fused to the C-terminus of the same Fc domain.
  • FIG.1E is a schematic illustration of an exemplary fusion protein where ECDs of CD28 are each fused in tandem to the N-termini of ECDs of OX40 which are then fused to the N-termini of an Fc domain.
  • FIG.1F is a schematic illustration of an exemplary fusion protein where ECDs of CTLA4 are each fused in tandem to the N-termini of ECDs of OX40 which are then fused to the N-terminus of an Fc domain.
  • FIG.1G is a schematic illustration of an exemplary fusion protein where ECDs of OX40 are each fused in tandem to the N-termini of ECDs of CD28 which are then fused to the N-terminus of an Fc domain.
  • FIG.1H is a schematic illustration of an exemplary fusion protein where an ECD of OX40 is fused in tandem to the N-terminus of an ECD of CTLA4 which is then fused to the N-terminus of an Fc domain.
  • FIG.1I is a schematic illustration of an exemplary fusion protein where any tandem ECD combination of FIGs.1E-1H (labelled here as X and Y) are fused to the C-terminus of an Fc domain.
  • FIG.1J is a schematic illustration of an exemplary fusion protein where an ECD of CD28 is fused to the N-terminus of an Fc domain and an anti-OX40L antibody binding domain is fused to the C-terminus of the same Fc domain.
  • FIG.1K is a schematic illustration of an exemplary fusion protein where ECDs of CTLA4 are fused to the N-terminus of an Fc domain and anti-OX40L antibody binding domains are fused to the C-terminus of the same Fc domain.
  • FIG.1L is a schematic illustration of an exemplary fusion protein where an ECD of OX40 is fused to the N-terminus of an Fc domain and anti-CD80 and anti-CD86 antibody binding domains are fused to the C-terminus of the Fc domain.
  • FIG.1M is a schematic illustration of an exemplary fusion protein where anti- OX40L antibody binding domains are fused to the N-terminus of an Fc domain and anti-CD80 and anti-CD86 antibody binding domains are fused to the C-terminus of the Fc domain.
  • FIG.1N is a schematic illustration of an exemplary fusion protein where anti-CD80 and anti-CD86 antibody binding domains are fused to the N-terminus of an Fc domain and anti-OX40L antibody binding domains are fused to the C-terminus of the Fc domain.
  • FIG.1O is a schematic illustration of an exemplary fusion protein where anti-CD80 and anti-CD86 antibody binding domains are fused in tandem to the N-termini of anti-OX40L antibody binding domains which are then fused to the N-terminus of an Fc domain.
  • FIG.1P is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused in tandem to the N-termini of anti-CD80 and anti-CD86 antibody binding domains which are then fused to the N-terminus of an Fc domain.
  • FIG.1Q is a schematic illustration of an exemplary fusion protein where anti-CD80 and anti-CD86 antibody binding domains are fused to the C-terminus of a Fc domain and fused in tandem to the N-termini of anti-OX40L antibody binding domains.
  • FIG.1P is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused in tandem to the N-termini of anti-CD80 and anti-CD86 antibody binding domains which are then fused to the N-terminus of an Fc domain.
  • FIG.1Q is a schematic illustration of an exemplary fusion protein where anti-CD80 and anti-CD86 antibody binding domains are fused to the C-terminus of a
  • FIG. 1R is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused to the C-terminus of an Fc domain and fused in tandem to the N- termini of anti-CD80 and anti-CD86 antibody binding domains.
  • FIG.1S is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused to the N-terminus of an Fc domain and anti-CD80 and anti-CD86 antibody binding domains are fused to each other in tandem and to the C-terminus of the Fc domain.
  • FIG.1T is a schematic illustration of an exemplary fusion protein where anti-CD80 and anti-CD86 antibody binding domains are fused to each other in tandem and to the N-terminus of an Fc domain and anti-OX40L antibody binding domains are fused to the C-terminus of the Fc domain.
  • FIG.1U is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused to the N-terminus of an Fc domain and ECDs of CD28 are fused to the C- terminus of the same Fc domain.
  • FIG.1V is a schematic illustration of an exemplary fusion protein where anti-OX40L antibody binding domains are fused to the N-terminus of an Fc domain and ECDs of CTLA4 are fused to the C-terminus of the same Fc domain.
  • FIG.1W is a schematic illustration of an exemplary fusion protein where ECDs of CTLA4 are fused to the N- terminus of a variant IgG1 Fc domain having mutations that reduce Fc effector function and anti- OX40L Fabs are fused to the C-terminus of the variant IgG1 Fc domain.
  • FIG.2A is a flow chart showing the antibody screening cascade.
  • FIG.2B is a flow chart showing the candidate characterization cascade.
  • FIGs.3A-3C are graphs showing neutralization of OX40L by anti-OX40L in IgG (FIG.3A), FcFab (FIG.3B), and fusion protein (FIG.3C) format using an OX40 Luciferase reporter assay.
  • FIG.4 is a graph showing neutralization of OX40L using a CTLA4_anti OX40L fusion protein (95B06, 98C01, 98E10, 84E11, 68F03, 67B06, 97G07, 89B09, and Ref4_CTLA4_O13), reference monoclonal anti-OX40L antibody (Ref1_Anti_OX40L, Ref2_Anti-OX40L), or isotype control using an OX40 Luciferase reporter assay.
  • a CTLA4_anti OX40L fusion protein 95B06, 98C01, 98E10, 84E11, 68F03, 67B06, 97G07, 89B09, and Ref4_CTLA4_O13
  • Ref1_Anti_OX40L, Ref2_Anti-OX40L reference monoclonal anti-OX40L antibody
  • isotype control using an OX40 Luciferase reporter
  • FIGs.5A-5B are graphs showing expression of proinflammatory cytokines IL-2 (FIG.5A) and TNF ⁇ (FIG.5B) in the presence of varying concentrations of CTLA4_anti OX40L fusion proteins (89B09, 67B06, 98E10, and 98C01), reference single agents (Ref2_Anti- OX40L, Ref3_CTLA4Ig), combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combination), or isotype control using an in vitro mixed lymphocyte reaction (MLR) assay.
  • MLR in vitro mixed lymphocyte reaction
  • FIGs.6A-6B are graphs showing allo-reactive CD4 + OX40 + (FIG.6A) and CD8 + OX40 + (FIG.6B) T cell proliferation in the presence of CTLA4_anti OX40L fusion proteins (89B09, 67B06, 98E10, and 98C01), reference single agents (Ref2_Anti-OX40L, Ref3_CTLA4Ig), combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combination), or isotype control using a monocyte-derived dendritic cells: T cells (MDDC:T) MLR assay.
  • CTLA4_anti OX40L fusion proteins 89B09, 67B06, 98E10, and 98C01
  • Ref2_Anti-OX40L, Ref3_CTLA4Ig combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combination)
  • FIG.7 is a graph showing in vitro Treg induction levels in the presence or absence of CTLA4_anti OX40L fusion proteins (89B09, 67B06, and 98C01), reference single agents (Ref1_Anti-OX40L, Ref2_Anti-OX40L, Ref3_CTLA4Ig), or isotype IgG1 control (Iso) using a Treg induction assay.
  • FIG.8 is a histogram showing Treg:Teff ratio in the presence of CTLA4_anti OX40L fusion proteins (89B09, 67B06, and 98C01), reference single agents (Ref2_Anti-OX40L, Ref3_CTLA4Ig), or isotype control using a MLR assay.
  • FIG.9A is a graph showing Treg:Teff ratio in the presence of varying concentrations of CTLA4_anti OX40L fusion proteins (89B09, 67B06, and 98C01), reference single agents (Ref2_Anti-OX40L, Ref3_CTLA4Ig), combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combination), rapamycin, voclosporin, or isotype control using a MLR Assay.
  • FIG. 10A-10C are graphs showing IC50 values of IL-2 (FIG.10A), TNF ⁇ (FIG.
  • FIG.11A is a graph showing IL-2 concentration levels from a CD80 and OX40L receptor occupancy assay.
  • FIG.11B is a graph showing percent occupancy of human OX40L from a CD80 and OX40L receptor occupancy assay.
  • FIG.11C is a graph showing percent occupancy of human CD80 from a CD80 and OX40L receptor occupancy assay.
  • FIG.12 is a graph showing real-time internalization of CTLA4-Ig (Ref3_CTLA4Ig), anti-OX40L (Ref1_Anti-OX40L), CTLA4_anti OX40L fusion protein (67B06), IgG isotype controls (Isotype Ctl, Isotype IgG1), and non-internalizing anti-CD20 antibody by myeloid- derived dendritic cells (MDDCs).
  • CTLA4-Ig Ref3_CTLA4Ig
  • Anti-OX40L Ref1_Anti-OX40L
  • CTLA4_anti OX40L fusion protein 67B06
  • IgG isotype controls Isotype Ctl, Isotype IgG1
  • MDDCs myeloid- derived dendritic cells
  • FIGs.13A-13D are graphs showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference single agents (Ref1_Anti-OX40L, Ref3_CTLA4Ig), or combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combination) on expression levels of granulocyte- macrophage colony-stimulating factor (GM-CSF) (FIG.13A), IL13 (FIG.13B), Granzyme B (GZMB) (FIG.13C), and IFN ⁇ (FIG.13D) in PBMCs derived from systemic erythematosus (SLE) patients.
  • GM-CSF granulocyte- macrophage colony-stimulating factor
  • FIG.13A granulocyte- macrophage colony-stimulating factor
  • IL13 IL13
  • GZMB Granzyme B
  • IFN ⁇ IFN ⁇
  • FIG.14A is a graph showing the effect of CTLA4_anti OX40L fusion proteins (67B06 and 89B09) or isotype control on suppression of IFN ⁇ responses in a Xenogeneic Graft- Versus-Host Disease (xeno-GVHD) murine model.
  • FIG.14B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference single agents 67B06 (IgG format), Ref3_CTLA4Ig, or isotype control on suppression of IFN ⁇ responses in a xeno-GVHD murine model.
  • FIG.15A is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference monoclonal anti-OX40L antibody (Ref1_Anti_OX40L), or isotype control on weight loss in a xeno-GVHD murine model.
  • FIG.15B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference monoclonal anti-OX40L antibody (Ref1_Anti_OX40L), or isotype control on IFN ⁇ production in a xeno-GVHD murine model.
  • FIG.16A is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference CTLA4Ig (Ref3_CTLA4Ig), or isotype control on weight loss in a xeno- GVHD murine model.
  • FIG.16B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference CTLA4Ig (Ref3_CTLA4Ig), or isotype control on IFN ⁇ production in a xeno-GVHD murine model.
  • FIG.17A is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06) reference CTLA4Ig (Ref3_CTLA4Ig), Anti-OX40L (Ref1_anti-OX40L), Combination (Ref3 and Ref1), or isotype control on weight loss in a xeno-GVHD murine model on day 41.
  • FIG.17B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06) reference CTLA4Ig (Ref3_CTLA4Ig), Anti-OX40L (Ref1_anti-OX40L), Combination (Ref3 and Ref1), or isotype control on IFN ⁇ production in a xeno-GVHD murine model on day 41.
  • FIG.17C is a graph showing effect of CTLA4_anti OX40L fusion protein (89B09) or isotype control on IFN ⁇ production in a xeno-GVHD murine model on day 12.
  • the present application provides proteins that inhibit T cell costimulatory signaling comprising: a polypeptide that specifically binds CD80 and/or CD86, and a polypeptide that specifically binds OX40L.
  • the present application provides antibodies that specifically bind OX40L.
  • the application also provides therapeutic methods for using such proteins in the treatment of autoimmune diseases.
  • Various aspects of the proteins described in the present application are set forth below in sections; however, aspects of the proteins described in one particular section are not to be limited to any particular section.
  • the term “antigen-binding site” refers to the part of the immunoglobulin (Ig) molecule that participates in antigen binding. In human antibodies, the antigen-binding site is formed by amino acid residues of the N-terminal variable (“V”) domains of the heavy (“H”) and light (“L”) chains.
  • FR refers to amino acid sequences which are naturally found between and adjacent to hypervariable regions in immunoglobulins.
  • the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three-dimensional space to form an antigen-binding surface.
  • the antigen-binding surface is complementary to the three-dimensional surface of an antigen to which the antigen-binding site specifically binds, and the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.”
  • CDRs complementarity-determining regions
  • the antigen-binding site is formed by a single antibody chain providing a “single domain antibody.”
  • Antigen-binding sites can exist in an intact antibody, in an antigen-binding fragment of an antibody that retains the antigen-binding surface (for example.
  • the term “functional fragment thereof” refers to a portion of a protein or polypeptide that maintains the ability to perform a biological function of the whole protein or polypeptide.
  • a functional fragment of a polypeptide or protein of the present application maintains its ability to bind its cognate binding partner or ligand.
  • the terms “subject” and “patient” refer to an organism to be treated by the methods and compositions described herein. Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
  • the term “effective amount” refers to the amount of a compound (e.g., a protein of the present application) sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
  • CTLA4 also known as CD152
  • OX40L also known as TNFSF4, or CD252 refers to the protein of SEQ ID NO: 2 and related isoforms and orthologs.
  • OX40 also known as TNFRSF4, or CD134 refers to the protein of SEQ ID NO: 1 and related isoforms and orthologs.
  • CD28 also known as TP44 refers to the protein of SEQ ID NO: 230 and related isoforms and orthologs.
  • CD28 Amino Acid Sequence (underlined amino acids denote signal peptide): MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLF SREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNE SVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLC PSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHS DYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 230) [0110]
  • CD80 also known as B7.1 refers to the protein of SEQ ID NO: 3 and related isoforms and orthologs.
  • CD80 Human Amino Acid Sequence VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGD MNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKRE HLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQ TFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRR NERLRRESVRPV (SEQ ID NO: 3) [0111] As used herein CD86 (also known as B7.2) refers to the protein of SEQ ID NO: 4 and related isoforms and orthologs.
  • the present application provides proteins that specifically bind to CD80 and CD86 and OX40L expressed on antigen presenting cells (APCs). Binding of the proteins to CD80/CD86 and OX40L inhibits T cell activation by blocking costimulatory signaling downstream of CD28 and OX40, respectively.
  • the proteins of the present disclosure include two arms, each arm including two components (e.g., a polypeptide or a complex of two or more polypeptides), one component which specifically binds to CD80 and/or CD86 and another component which specifically binds to OX40L.
  • the components that bind to either CD80 and/or CD86 or OX40L can comprise a single polypeptide.
  • the components that bind to either CD80 and/or CD86 or OX40L can comprise a complex of two or more polypeptides.
  • the complex of two or more polypeptides of the polypeptide complex may be connected by one or more than one covalent linkage (e.g., a disulfide bond) and/or one or more than one non-covalent interaction (e.g., an ionic or hydrophobic interaction). Further description of exemplary proteins is provided below.
  • a protein of the present disclosure includes the first component that is a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, which can include but is not limited to an extracellular domain of CTLA4 or functional fragment thereof.
  • the first component can be but is not limited to an extracellular domain of CD28 or functional fragment thereof.
  • the first component can be but is not limited to one or more antigen-binding site, for example, an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH).
  • a protein of the present disclosure includes the second component, which is a polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the second component can include but is not limited to an antigen-binding site, for example, an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH).
  • the second component can be but is not limited to an extracellular domain of OX40 or functional fragment thereof.
  • a protein of the present disclosure additionally comprises a bridging moiety, which can include but is not limited to: a polypeptide of an immunoglobulin Fc domain or functional fragment thereof, a human serum albumin (HSA) polypeptide or functional fragment thereof, or a polypeptide linker.
  • HSA human serum albumin
  • the bridging moiety is a polypeptide of an immunoglobulin Fc domain.
  • a protein of the present disclosure further comprises a polypeptide hinge immediately N-terminal to the polypeptide of the immunoglobulin Fc domain or functional fragment thereof.
  • a protein of the present disclosure further comprises a linker polypeptide, which connects a polypeptide or complex of two or more polypeptides that specifically binds OX40L to the bridging moeity.
  • a protein of the present disclosure further comprises a linker polypeptide, which connects a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the bridging moiety.
  • linker polypeptide which connects a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the bridging moiety.
  • one protein format comprises: (i) a first arm comprising, from N-terminus to C-terminus, a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, a first polypeptide of an immunoglobulin Fc domain, and a first polypeptide or complex of two or more polypeptides that specifically binds OX40L; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, a second polypeptide of the immunoglobulin Fc domain, and a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, wherein the first and second polypeptides of the immunoglobulin Fc-domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.1A and FIG 1J); an extracellular domain of CTLA4 or functional fragment thereof (FIG.1C, FIG 1K, and FIG.1W); or wherein the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80, and the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2,
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1A and FIG 1C); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1J, FIG.1K, and FIG 1N).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • HC Fab heavy chain
  • LC Fab light chain
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide of the immunoglobulin Fc domain, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, respectively.
  • Another protein format comprises: (i) a first arm comprising, from N-terminus to C- terminus, a first polypeptide or complex of two or more polypeptides that specifically binds OX40L, a first polypeptide of an immunoglobulin Fc domain, and a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, a second polypeptide of the immunoglobulin Fc domain, and a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, wherein the first and second polypeptides of the immunoglobulin Fc- domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1B, FIG 1D, and FIG.1L); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1M, FIG.1U, and FIG.1V).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • HC Fab heavy chain
  • LC Fab light chain
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.1B and FIG.1U); an extracellular domain of CTLA4 or functional fragment thereof (FIG.1D and FIG.1V); or wherein the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80, and the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 ,
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds OX40L to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively. Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide of the immunoglobulin Fc domain, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, respectively.
  • a protein format comprises: (i) a first arm comprising, from N- terminus to C-terminus, a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, a first polypeptide or complex of two or more polypeptides that specifically binds OX40L, and a first polypeptide of an immunoglobulin Fc domain; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, and a second polypeptide of the immunoglobulin Fc domain, wherein the first and second polypeptides of the immunoglobulin Fc-domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.1E); an extracellular domain of CTLA4 or functional fragment thereof (FIG.1F); or wherein the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80, and the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1E and FIG 1F); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1O).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds OX40L to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, respectively.
  • Another protein format comprises: (i) a first arm comprising, from N-terminus to C- terminus, a first polypeptide or complex of two or more polypeptides that specifically binds OX40L, a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, and a first polypeptide of an immunoglobulin Fc domain; and (ii) a second arm comprising, from N-terminus to C-terminus, a second complex of two or more polypeptides that specifically binds OX40L, a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, and a second polypeptide of the immunoglobulin Fc domain, wherein the first and second polypeptides of the immunoglobulin Fc-domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1G and FIG 1H); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1P).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.
  • the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80
  • the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD86 (FIG.
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, respectively.
  • a protein format comprises: (i) a first arm comprising, from N- terminus to C-terminus, a first polypeptide of an immunoglobulin Fc domain, a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, and a first polypeptide or complex of two or more polypeptides that specifically binds OX40L; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide of the immunoglobulin Fc domain, a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, and a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, wherein the first and second polypeptides of the immunoglobulin Fc-domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.1I); an extracellular domain of CTLA4 or functional fragment thereof; or wherein the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80, and the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1I); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1Q).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms N-terminal of the first or second polypeptides of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide of the immunoglobulin Fc domain to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, respectively.
  • Another protein format comprises: (i) a first arm comprising, from N-terminus to C- terminus, a first polypeptide of an immunoglobulin Fc domain, a first polypeptide or complex of two or more polypeptides that specifically binds OX40L, and a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide of the immunoglobulin Fc domain, a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, and a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, wherein the first and second polypeptides of the immunoglobulin Fc- domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof (FIG.1I); or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1R).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • HC Fab heavy chain
  • LC Fab light chain
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an extracellular domain of CD28 or functional fragment thereof (FIG.1I); an extracellular domain of CTLA4 or functional fragment thereof; or wherein the first polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80, and the second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a mini
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms N-terminal of the first or second polypeptide of the immunoglobulin Fc domain, respectively. Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide of the immunoglobulin Fc domain to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, to the N- terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, respectively.
  • Another protein format comprises: (i) a first arm comprising, from N-terminus to C- terminus, a first polypeptide or complex of two or more polypeptides that specifically binds OX40L, a first polypeptide of an immunoglobulin Fc domain, and a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and CD86; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, a second polypeptide of the immunoglobulin Fc domain, and a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and CD86, wherein the first and second polypeptides of the immunoglobulin Fc- domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof; or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1S).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • HC Fab heavy chain
  • LC Fab light chain
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 include: an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80 connected, with or without a linker polypeptide, to an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD86 (FIG.1S), or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds OX40L to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C- terminus of the first and/or second polypeptide of the immunoglobulin Fc domain, to the N- terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86, respectively.
  • Another protein format comprises: (i) a first arm comprising, from N-terminus to C- terminus, a first polypeptide or complex of two or more polypeptides that specifically binds CD80 and CD86, a first polypeptide of an immunoglobulin Fc domain, and a first polypeptide or complex of two or more polypeptides that specifically binds OX40L; and (ii) a second arm comprising, from N-terminus to C-terminus, a second polypeptide or complex of two or more polypeptides that specifically binds CD80 and CD86, a second polypeptide of the immunoglobulin Fc domain, and a second polypeptide or complex of two or more polypeptides that specifically binds OX40L, wherein the first and second polypeptides of the immunoglobulin Fc-domain dimerize.
  • first and second polypeptides or complexes of two or more polypeptides that specifically bind OX40L include: an extracellular domain of OX40 or functional fragment thereof; or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) (FIG.1T).
  • an antigen-binding site e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)
  • the first and second complexes of two or more polypeptides that specifically bind OX40L comprise a Fab, wherein a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336
  • HC Fab heavy chain
  • LC Fab light chain
  • first and second polypeptides or polypeptide complexes that specifically bind CD80 and/or CD86 include: an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD80 connected, with or without a linker polypeptide, to an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH)) that specifically binds CD86 (FIG.1T), or an antigen-binding site (e.g., an antibody, a Fab, a Fab’, a F(ab’)2, a single-chain variable fragment (scFv), a minibody, or
  • Proteins of this format may optionally comprise a polypeptide hinge in each of the first and second arms connecting the C-terminus of the first or second polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N-terminus of the first or second polypeptide of the immunoglobulin Fc domain, respectively.
  • Proteins of this format may also optionally comprise a linker polypeptide in one or both of the first and/or second arms connecting the C-terminus of the first and/or second polypeptide of the immunoglobulin Fc domain, to the N-terminus of the first and/or second polypeptide or complex of two or more polypeptides that specifically binds OX40L, respectively.
  • a first and/or second polypeptide may be a single polypeptide chain. In some embodiments, a first and/or second polypeptide may be a complex of two or more polypeptide chains. [0128] Individual components of the proteins are described in more detail below. I.A Polypeptides or Complexes of Two or More Polypeptides that Specifically Bind CD80 and/or CD86 [0129] Polypeptides of complexes of two or more polypeptides that specifically bind CD80 and/or CD86 on the surface of antigen presenting cells (APCs), such as B cells, monocytes, macrophages and dendritic cells, block binding of endogenous CD80 and/or CD86 to CD28 on the surface of T cells.
  • APCs antigen presenting cells
  • polypeptides that specifically bind CD80 and/or CD86 can inhibit T cell costimulatory receptor signaling, resulting in decreased T cell activation, proliferation and induction of an anergic, immunosuppressive, tolerogenic T cell response.
  • a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is a polypeptide or complex of two or more polypeptides that binds to a protein having a sequence of SEQ ID NO: 3 and related isoforms and orthologs and/or a protein having a sequence of SEQ ID NO: 4 and related isoforms and orthologs.
  • a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 include, but is not limited to, a CTLA4 extracellular domain or functional fragment thereof, an antibody, a Fab, a Fab’, a F(ab’) 2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH).
  • a polypeptide that specifically binds CD80 and/or CD86 is an extracellular domain of CTLA4 or functional fragment thereof.
  • the extracellular domain of CTLA4 can comprise a sequence derived from a wildtype sequence of human CTLA4 (e.g., Genbank Accession number NP_005205).
  • the CTLA4 polypeptide sequence may be a variant CTLA4 sequence as described in Larsen et al. Am J Transplant.2005 Mar;5(3):443-53.; Xu et al. J Immunol.2012 Nov 1;189(9):4470-7.; Bernett et al., MAbs.2013 May-Jun;5(3):384-96.; Oshima et al. Protein Eng Des Sel.2016 May;29(5):159-67.; Douthwaite et al.
  • a CTLA4 sequence may comprise one or more mutation selected from mutations at positions 16, 24, 25, 27, 28, 29, 30, 32, 49, 50, 51, 53, 54, 55, 56, 58, 61, 64, 65, 70, 80, 85, 93, 96, and 104 (numbering relative to SEQ ID NO: 174).
  • Polypeptides that specifically bind CD80 and/or CD86 polypeptides of the present invention may comprise an amino acid sequence selected from any wildtype or variant sequence, or functional fragment thereof, listed in TABLE 1.
  • a polypeptide that specifically binds CD80 and/or CD86 is an extracellular domain of CTLA4 or functional fragment thereof comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to a sequence listed in TABLE 1.
  • a polypeptide that specifically binds CD80 and/or CD86 comprises an extracellular domain of CD28 (SEQ ID NO: 236) or functional fragment thereof.
  • a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 comprises an antibody, a Fab, a Fab’, a F(ab’)2, a single- chain variable fragment (scFv), a minibody, and a nanobody (VHH).
  • polypeptides or heavy chains of complexes of two or more polypeptides that specifically bind CD80 and/or CD86 can be connected to a polypeptide or heavy chain of a complex of two or more polypeptides that specifically binds OX40L (for example, a polypeptide comprising an amino acid sequence listed in TABLE 3) to form a contiguous polypeptide chain.
  • OX40L for example, a polypeptide comprising an amino acid sequence listed in TABLE 3
  • polypeptides or complexes of two or more polypeptides that specifically bind CD80 and/or CD86 are connected to a polypeptide or complex of two or more polypeptides that specifically binds OX40L via a bridging moiety (for example, a polypeptide comprising an amino acid sequence listed in TABLE 4), wherein the bridging moiety connects the C-terminus of the polypeptide or heavy chain of a complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N-terminus of the polypeptide or heavy chain of a complex of two or more polypeptides that specifically binds OX40L to form a contiguous polypeptide chain.
  • a bridging moiety for example, a polypeptide comprising an amino acid sequence listed in TABLE 4
  • polypeptides or heavy chains of complexes of two or more polypeptides that specifically bind CD80 and/or CD86 are connected to the bridging moiety via a hinge polypeptide (for example, a polypeptide comprising an amino acid sequence listed in TABLE 5), wherein the hinge polypeptide connects the C-terminus of the polypeptide or heavy chain of the complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N- terminus of the bridging moiety to form a contiguous polypeptide chain I.
  • APCs antigen presenting cells
  • polypeptides that specifically bind OX40L can inhibit T cell costimulatory receptor signaling, resulting in decreased T cell activation, proliferation and induction of an anergic, immunosuppressive, tolerogenic T cell response.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L is a polypeptide that binds to a protein of Genbank Accession No. NP_003317 (SEQ ID NO: 2) and related isoforms and orthologs.
  • OX40L (underlining denotes transmembrane region, bold denotes position 1 of the extracellular domain) MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFS ALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINC DGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTY KDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL (SEQ ID NO: 2) [0141]
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L as described herein binds to position 17, 18, 19, 20, 21, 23, 26, 28, 60, 83, 110, 111, 112, 113 and 114 of the extracellular domain of human OX40L.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L as described herein binds to position 58, 59, 60, 61, 62, 63, 81, 82, and 83 of the extracellular domain of human OX40L.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L binds position 60 and/or 83 of the extracellular domain of human OX40L.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L include, but is not limited to: an antigen-binding site, for example an antibody, a Fab, a Fab’, a F(ab’)2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH); or an extracellular domain of OX40 or functional fragment thereof.
  • an antigen-binding site for example an antibody, a Fab, a Fab’, a F(ab’)2 , a single-chain variable fragment (scFv), a minibody, or a nanobody (VHH); or an extracellular domain of OX40 or functional fragment thereof.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L comprises an antigen-binding site.
  • the antigen-binding site is a Fab.
  • VH consensus heavy chain variable domain
  • VL light chain variable domain
  • CDRs complementarity-determining regions
  • the heavy chain variable domain and the light chain variable domain are arranged in Fab format having VH and VL CDR sequences selected from the consensus VH and VL sequences in TABLE 2.
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336 is connected to the C-terminus of the Fab heavy chain (HC) CH1 domain and forms a disulfide bond with the Fab light chain (LC).
  • HC Fab heavy chain
  • LC Fab light chain
  • the antigen-binding site that specifically binds to OX40L comprises an amino acid sequence selected from the consensus sequence of SEQ ID NO: 220 or SEQ ID NO: 221.
  • the antigen-binding site that specifically binds to OX40L comprises: a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of SEQ ID NO: 222; a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of SEQ ID NO: 223, SEQ ID NO: 224, or SEQ ID NO: 225); and a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of: SEQ ID NO: 220 or SEQ ID NO: 221.
  • VHCDR1 heavy chain variable complementarity-determining region 1
  • VHCDR2 heavy chain variable complementarity-determining region 2
  • VHCDR3 heavy chain variable complementarity-determining region 3
  • the antigen-binding site that specifically binds to OX40L comprises: a light chain variable complementarity determining region 1 (VLCDR1) comprising an amino acid sequence of SEQ ID NO: 226 or SEQ ID NO: 227; a light chain variable complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of SEQ ID NO: 82, SEQ ID NO: 228 or SEQ ID NO: 90; and a light chain variable complementarity- determining region 3 (VLCDR3) comprising an amino acid sequence of SEQ ID NO: 231 or SEQ ID NO: 232.
  • VLCDR1 light chain variable complementarity determining region 1
  • VLCDR2 light chain variable complementarity-determining region 2
  • VLCDR3 light chain variable complementarity- determining region 3
  • the antigen-binding site that specifically binds to OX40L comprises: a VHCDR1 comprising an amino acid sequence of SEQ ID NO: 222; a VHCDR2 comprising an amino acid sequence of SEQ ID NO: 223; a VHCDR3 comprising an amino acid sequence of SEQ ID NO: 220; a VLCDR1 comprising an amino acid sequence of SEQ ID NO: 226; a VLCDR2 comprising an amino acid sequence of SEQ ID NO: 82; and a VLCDR3 comprising an amino acid sequence of SEQ ID NO: 231.
  • the antigen-binding site that specifically binds to OX40L comprises: a VHCDR1 comprising an amino acid sequence of SEQ ID NO: 222; a VHCDR2 comprising an amino acid sequence of SEQ ID NO: 224; a VHCDR3 comprising an amino acid sequence of SEQ ID NO: 221; a VLCDR1 comprising an amino acid sequence of SEQ ID NO: 227; a VLCDR2 comprising an amino acid sequence of SEQ ID NO: 228; and a VLCDR3 comprising an amino acid sequence of SEQ ID NO: 232.
  • the antigen-binding site that specifically binds to OX40L comprises, according to the IMGT unique numbering scheme, VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 each comprising an amino acid sequence corresponding to the VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 sequences of a VHCDR and VLCDR consensus sequences of TABLE 2, respectively.
  • a polypeptide or complex of two or more polypeptides that specifically binds OX40L comprises an antigen-binding site.
  • the antigen-binding site is a Fab.
  • TABLE 3 lists polypeptide sequences of heavy chain variable domains (VH) and light chain variable domains (VL) that, in combination, can specifically bind to OX40L.
  • the heavy chain variable domain and the light chain variable domain are arranged in Fab format having VH and VL sequences selected from the VH and VL sequences in TABLE 3.
  • TABLE 3 additionally lists polypeptide sequences of heavy chains (HC) and light chains (LC) that, in combination, can specifically bind to OX40L.
  • the heavy chain and the light chains are arranged in Fab format having HC and LC sequences selected from the HC and LC sequences in TABLE 3.
  • the antigen-binding site that specifically binds OX40L comprises an antibody heavy chain (HC) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC of an antibody disclosed in TABLE 3, and an antibody light chain (LC) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC of the same antibody
  • HC antibody heavy chain
  • LC antibody light chain
  • the antigen-binding site that specifically binds OX40L comprises an antibody heavy chain variable domain (VH) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in TABLE 3, and an antibody light chain variable domain (VL) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in TABLE 3.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • the antigen- binding site comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3, determined under IMGT unique numbering scheme, Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No.91-3242, Bethesda), Chothia (see, e.g., Chothia C & Lesk A M, (1987), J. Mol. Biol.196: 901-917), MacCallum (see MacCallum R M et al., (1996) J. Mol. Biol.262: 732-745), or any other CDR determination method known in the art, of the VH and VL sequences disclosed in TABLE 3.
  • Kabat see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No.91-3242, Bethesda
  • Chothia see, e.g., Chothia C & Lesk A M
  • the antigen-binding site that specifically binds to OX40L comprises a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain complementarity- determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of RDN (SEQ ID NO: 82), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of QVRDSNIVV (SEQ ID NO: 83).
  • VHCDR1 comprising an amino acid sequence
  • the antigen-binding site that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a VHCDR2 comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a VHCDR3 comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a VLCDR1 comprising an amino acid sequence of SVRRFF (SEQ ID NO: 97), a VLCDR2 comprising an amino acid sequence of GKD (SEQ ID NO: 98), and a VLCDR3 comprising an amino acid sequence of NSRDSSGYLVL (SEQ ID NO: 99).
  • the antigen-binding site that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a VHCDR2 comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a VHCDR3 comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • the antigen-binding site that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101), a VHCDR2 comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a VHCDR3 comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • the antigen-binding site that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GFTFSNYA (SEQ ID NO: 133), a VHCDR2 comprising an amino acid sequence of ISGSGGAT (SEQ ID NO: 113), a VHCDR3 comprising an amino acid sequence of TKDRLIMATVRGPYYYGMDV (SEQ ID NO: 114), a VLCDR1 comprising an amino acid sequence of QSISSY (SEQ ID NO: 121), a VLCDR2 comprising an amino acid sequence of AAS (SEQ ID NO: 146), and a VLCDR3 comprising an amino acid sequence of QQSHSVSFT (SEQ ID NO: 154).
  • the antigen-binding site that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of SYAMS (SEQ ID NO: 105), a VHCDR2 comprising an amino acid sequence of IISGSGGFTYYADSVK (SEQ ID NO: 106), a VHCDR3 comprising an amino acid sequence of DRLVAPGTFDY (SEQ ID NO: 107), a VLCDR1 comprising an amino acid sequence of RASQGISSWLA (SEQ ID NO: 169), a VLCDR2 comprising an amino acid sequence of AASSLQS (SEQ ID NO: 170), and a VLCDR3 comprising an amino acid sequence of QQYNSYPYT (SEQ ID NO: 171).
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 76, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 80.
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 92, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 96.
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 84, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 88.
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 100, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 104.
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 31, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97% at least 98% at least 99% or 100%) identical to SEQ ID NO: 30 [0167] In certain embodiments, the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 97%, at
  • the antigen-binding site that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 8, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 7.
  • the antigen-binding site that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 16, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 15.
  • the antigen-binding site that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 14, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 13.
  • the antigen-binding site that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 18, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 17.
  • the antigen-binding site that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e g at least 91% at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 252, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 253.
  • the antigen-binding site that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 254, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 255.
  • proteins of the present disclosure further comprise a bridging moiety.
  • the bridging moiety may be non-functional, i.e. merely serves as a structural connection and/or appendage and does not perform a biological function or have a biological purpose.
  • the bridging moiety is functional and has a biological function in the context of the protein.
  • the N-terminus of the bridging moiety is connected to the C- terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 and the C-terminus of the bridging moiety is connected to the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the bridging moiety connects the polypeptide or heavy chain of a complex of two or more polypeptides that specifically binds CD80 and/or CD86 and the polypeptide or heavy chain of a complex of two or more polypeptides that specifically binds OX40L to form a contiguous polypeptide chain.
  • the bridging moiety is connected to the C-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L. In other embodiments, the bridging moiety is connected to the C-terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86. In some embodiments, the bridging moiety is connected to the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the bridging moiety is connected to the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 [0177]
  • the bridging moiety comprises, but is not limited to, a polypeptide of an immunoglobulin Fc domain or functional fragment thereof, a human serum albumin (HSA) polypeptide or functional fragment thereof, a polypeptide linker, or a polypeptide hinge.
  • the bridging moiety comprises a polypeptide of an immunoglobulin Fc domain.
  • the bridging moiety is a polypeptide of an IgG, IgM, IgA, IgD, or IgE Fc domain.
  • the bridging moiety is a polypeptide of an IgG1, IgG2, IgG3, or IgG4 Fc domain.
  • the bridging moiety is a polypeptide of an IgG1 Fc domain.
  • the bridging moiety is a polypeptide of a human IgG1 Fc domain.
  • proteins of the present disclosure comprise a first polypeptide of an immunoglobulin Fc domain and a second polypeptide of an immunoglobulin Fc domain which dimerize with each other.
  • Human IgG Fc Within the polypeptide of the Fc domain, CD16 binding is mediated by the hinge region and the CH2 domain. For example, within human IgG1, the interaction with CD16 is primarily focused on amino acid residues Asp 265 – Glu 269, Asn 297 – Thr 299, Ala 327 – Ile 332, Leu 234 – Ser 239, and carbohydrate residue N-acetyl-D-glucosamine in the CH2 domain (see, Sondermann et al., Nature, 406 (6793):267-273), numbered according to the EU index as in Kabat.
  • a polypeptide of the immunoglobulin Fc domain or the portion thereof comprises a hinge polypeptide and a CH2 domain.
  • the bridging moiety is a polypeptide of a human IgG1 Fc domain comprising one or more mutation(s) to reduce binding to an Fc ⁇ receptor (e.g., Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIA, or Fc ⁇ RIIIB) or a complement component (e.g., C1q) in the first and/or second polypeptides of the human IgG1 Fc domain.
  • Fc ⁇ receptor e.g., Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIA, or Fc ⁇ RIIIB
  • complement component e.g., C1q
  • a protein of the present disclosure includes LALA (L234A and L235A) mutations, LALAPA (L234A, L235A, and P329A) mutations, LALAPG (L234A, L235A, and P329G) mutations, or LALEGAASPS (L234A, L235E, G237A, A330S, and P331S) mutations.
  • LALA L234A and L235A
  • LALAPA L234A, L235A, and P329A
  • LALAPG L234A, L235A, and P329G mutations
  • LALEGAASPS L234A, L235E, G237A, A330S, and P331S mutations.
  • the terminal lysine residue of human IgG1 Fc domain is mutated (K447A) or deleted (K447 ⁇ ).
  • amino acids at any one or more of positions 322, 330, 331, 355, and 358 may be mutated.
  • TABLE 4 lists exemplary wildtype and mutant polypeptides of human immunoglobulin Fc domains.
  • the bridging moiety comprises an amino acid sequence selected from any one of the human immunoglobulin Fc sequences listed in TABLE 4.
  • TABLE 4 Exemplary human IgG Fc domain sequences
  • proteins of the present invention comprise a polypeptide of a human IgG Fc domain bridging moiety that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to a wildtype or variant human IgG Fc domain sequence listed in TABLE 4, numbered according to the EU index as in Kabat.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 178.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 237.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 238.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 214.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 216.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 179.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 180.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 239.
  • proteins of the present invention comprise a polypeptide of a human IgG1 Fc domain bridging moiety that comprises an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 240.
  • Hinge Polypeptide [0192]
  • the bridging moiety comprises at least a portion of a hinge polypeptide.
  • the hinge polypeptide can be derived from an immunoglobulin heavy chain, e.g., IgG1, IgG2, IgG3, IgG4, or other classes.
  • the hinge region is derived from human IgG1, IgG2, IgG3, or IgG4. More preferably the hinge region is derived from a human IgG1 heavy chain.
  • at least a portion of hinge polypeptide is connected to the N- terminus of the heavy chain constant domain 2 (CH2) of a polypeptide of a human immunoglobulin Fc domain.
  • the hinge polypeptide connects the C- terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 to the N-terminus of the CH2 domain of a polypeptide of a human immunoglobulin Fc domain.
  • the hinge polypeptide connects the C-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L to the N- terminus of the CH2 domain of a polypeptide of a human immunoglobulin Fc domain.
  • a partial hinge (for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of a CH1 domain of a Fab heavy chain (HC) that specifically binds OX40L and forms a disulfide bond with the Fab light chain (LC) that specifically binds OX40L.
  • a partial hinge for example, a polypeptide having the sequence of SEQ ID NO: 336) is connected to the C-terminus of a CH1 domain of a Fab heavy chain (HC) that specifically binds CD80 or CD86 and forms a disulfide bond with the Fab light chain (LC) that specifically binds CD80 or CD86, respectively.
  • amino acids at any one or more of positions C220, E233, L234 or L235 may be mutated in the hinge region of human IgG1. The positions of the amino acid substitutions are all numbered according to the EU index as in Kabat, unless otherwise stated.
  • TABLE 5 lists exemplary wildtype and mutant human immunoglobulin hinge polypeptides.
  • the bridging moiety comprises an amino acid sequence selected from any one of the human immunoglobulin Fc hinge polypeptide sequences listed in TABLE 5. [0196] TABLE 5: Hinge Polypeptides of Human Immunoglobulin
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to a wildtype or variant human immunoglobulin Fc hinge sequence listed in TABLE 5, numbered according to the EU index as in Kabat.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 175.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e g at least 91% at least 92% at least 93% at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 242.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 176.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 249.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 177.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 243.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 212.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 244.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 213.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 245.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 247.
  • bridging moieties of the present invention comprise a hinge polypeptide comprising an amino acid at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 248.
  • Human Serum Albumin [0210]
  • bridging moieties of the present invention comprise a human serum albumin (HSA) polypeptide of functional fragment thereof.
  • HSA human serum albumin
  • a bridging moiety of the present may comprise an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 219.
  • the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is connected to the C- terminus of a bridging moiety via a linker polypeptide. In some embodiments, the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is connected to the C-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L via a linker polypeptide.
  • the N-terminus of a polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected to the C-terminus of a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 via a linker polypeptide.
  • linker polypeptide sequences are selected with properties that confer flexibility, and for minimal interference with the structure and function of the other domains and/or polypeptides of the proteins described in the present application. Linker polypeptide sequences are also selected to be resistant to proteolytic cleavage. For example, glycine and serine residues generally provide protease resistance.
  • proteins described herein comprise a (GlyGlyGlyGlySer)4 ((G4S)4) linker (SEQ ID NO: 111).
  • the length of the linker e.g., flexible linker
  • the linker is 10-50, 10-40, 10-30, 10-25, 10-20, 15-50, 15-40, 15-30, 15-25, 15-20, 20-50, 20-40, 20-30, or 20-25 amino acid residues in length.
  • proteins of the present invention comprise one or more polypeptide linker comprising or consisting of an amino acid sequence listed in Table 6.
  • proteins of the present invention comprising a polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 and a polypeptide or complex of two or more polypeptides that specifically binds OX40L.
  • the polypeptide that specifically binds CD80 and/or CD86 can comprise a wildtype or variant extracellular domain of CTLA4 selected from any one of the sequences listed in TABLE 1.
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 can comprise a wildtype or variant extracellular domain of CD28 or functional fragment thereof, or an antigen binding site (e.g.
  • the polypeptide or complex of two or more polypeptides that specifically binds OX40L is an antigen binding site (e.g. an antibody, a Fab; a Fab’, a F(ab’)2, a single-chain variable fragment (scFv); a minibody; or a nanobody (VHH)).
  • an antigen binding site e.g. an antibody, a Fab; a Fab’, a F(ab’)2, a single-chain variable fragment (scFv); a minibody; or a nanobody (VHH)).
  • antigen binding sites that specifically bind OX40L can comprise a Fab comprising the VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 sequences selected from any of the VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 sequences listed in TABLE 2, the VH and VL sequences listed in TABLE 3, and/or the HC and LC sequences listed in TABLE 3.
  • the polypeptide that binds OX40L can comprise an extracellular domain of OX40, or functional fragment thereof.
  • proteins of the present invention may comprise a bridging moiety.
  • the polypeptide or complex of two or more polypeptides that specifically binds CD80 and/or CD86 is connected at its C-terminus to the N-terminus of a bridging moiety and the polypeptide or complex of two or more polypeptides that specifically binds OX40L is connected at its N-terminus to the C-terminus of the bridging moiety.
  • the bridging moiety can be a polypeptide of a wildtype human IgG1 Fc domain optionally comprising one or more mutation and comprising a sequence selected from any one of the sequences listed in TABLE 4.
  • the bridging moiety can also comprise a hinge polypeptide at its N-terminus optionally comprising one or more mutation such as a sequence selected from any one of the sequences listed in TABLE 5.
  • the polypeptide or complex of two or more polypeptides that specifically binds OX40L can be connected to the C-terminus of the bridging moiety via a linker polypeptide.
  • the linker polypeptide can comprise a polypeptide comprising a sequence selected from any one of the sequences listed in TABLE 6.
  • Proteins of the present invention can comprise a heavy chain and a light chain.
  • a heavy chain of the present invention can comprise, from N-terminus to C-terminus: an extracellular domain of CTLA4 or functional fragment thereof, a bridging moiety comprising at least a portion of a hinge polypeptide at its N-terminus and the CH2 and CH3 domains of polypeptide of a human IgG1 Fc; a linker polypeptide; and a heavy chain of an anti-OX40L Fab comprising a VH domain and CH1 domain.
  • the heavy chain can additionally comprise at the C- terminus of the CH1 domain, a partial IgG1 hinge sequence (for example, a polypeptide comprising the amino acid sequence of SEQ ID NO: 336) comprising a cysteine residue capable of forming a disulfide bond with a cysteine residue in a light chain constant domain (CL).
  • a partial IgG1 hinge sequence for example, a polypeptide comprising the amino acid sequence of SEQ ID NO: 336) comprising a cysteine residue capable of forming a disulfide bond with a cysteine residue in a light chain constant domain (CL).
  • a light chain of the present invention can comprise, from N-terminus to C-terminus: a VL domain and CL domain of the anti-OX40L Fab. TABLE 7 lists exemplary light chain sequences of the present invention.
  • heavy chains and light chains as listed in TABLE 7 associate, for example linked by a disulfide bond, and can specifically bind to CD80 and CD86, and OX40L.
  • the hinge polypeptide and CH3 domain of the polypeptide of the human IgG1 Fc can facilitate dimerization of two heavy chains resulting in a protein comprising of two heavy chains and two light chains.
  • a heavy chain selected from any of the amino acid sequences listed in TABLE 7 in the preparation of a protein wherein the heavy chain is associated (e.g., via a disulfide bond) with a light chain selected from any of the amino acid sequences listed in TABLE 7.
  • nucleic acids encoding the proteins of the present invention may be codon optimized for optimal expression using standard bioinformatic methods.
  • Cells comprising one or more nucleic acid encoding a protein of the present invention are also contemplated and can be produced by a standard transfection or transduction method (e.g., electroporation, calcium chloride transfection, lipofection, lentiviral deliver, or adeno-associated virus delivery).
  • a standard transfection or transduction method e.g., electroporation, calcium chloride transfection, lipofection, lentiviral deliver, or adeno-associated virus delivery.
  • I.E Characteristics of the Proteins Proteins of the present invention are capable of specifically binding CD80 and/or CD86 and OX40L. In some embodiments, proteins of the present invention bind to CD80 and/or CD86, and OX40L with high affinity as measured by any one of a variety of assays known in field.
  • CTLA4-Ig (Ref3_CTLA4Ig) AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTE VCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICK VELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAP ELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQQ
  • proteins of the present invention have an IC 50 of less than 12 nM, as measured in an OX40L neutralization/OX40-HEK reporter assay as described in EXAMPLE 3 below. In some embodiments, proteins of the present invention have an IC50 of 5 nM to 12 nM, 5nM to 11.5 nM, 5 nM to 11 nM, 5 nM to 11.5nM, 5 nM to 10 nM, 5 nM to 10.5nM, or 5 nM to 9 nM as measured in an OX40L neutralization/OX40-HEK reporter assay.
  • proteins of the present invention have an IC50 of 2 nM to 12 nM, 2 nM to 11.5 nM, 2 nM to 11 nM, 2 nM to 10.5 nM, 2 nM to 10 nM, or 2 nM to 9.5 nM as measured in a primary T cell activation assay.
  • proteins of the present invention bind to OX40L with a KD if less than 75 nM as measured in a Biacore assay (described in EXAMPLE 3 below).
  • OX40L binding has a KD of 20 nM to 75 nM, 20 nM to 70 nM, 20 nM to 65 nM, 20 nM to 60 nM, 25 nM to 75 nM, 25 nM to 70 nM, 25 nM to 65 nM, 25 nM to 60 nM, 30 nM to 75 nM, 30 nM to 70 nM, 30 nM to 65 nM, and 30 nM to 60 nM as measured in a Biacore assay.
  • Blocking of T cell costimulatory signaling inhibits T cell activation and the production of pro-inflammatory mediators.
  • proteins described herein significantly inhibit the production of at least one or more pro-inflammatory cytokines including, but not limited to, IL-2, IFN ⁇ , IL-6, or TNF ⁇ .
  • pro-inflammatory cytokine production can be measured using an in vitro mixed lymphocyte reaction assay and comparing cells treated with protein described herein with cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti-OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • an anti-OX40L antibody SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and
  • proteins described herein inhibit production of at least one proinflammatory cytokine by cells in a mixed lymphocyte reaction assay by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% as compared to cells treated under the same conditions but in the absence of protein.
  • T cell costimulatory blockade also results in the inhibition of T cell proliferation.
  • proteins described herein significantly inhibit alloreactive CD4 + and CD8 + T cell proliferation in an in vitro mixed lymphocyte reaction assay as compared to alloreactive CD4 + and CD8 + T cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti-OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • an anti-OX40L antibody SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31
  • proteins described herein inhibit CD4 + and CD8 + T cell proliferation in a mixed lymphocyte reaction assay by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50% as compared to cells treated under the same conditions but in the absence of protein.
  • proteins described herein preferentially inhibit alloreactive CD4 + and CD8 + T cell proliferation as compared to regulatory T cell (Treg or Treg) proliferation in an in vitro mixed lymphocyte reaction assay as compared to alloreactive CD4 + and CD8 + T cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti-OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • an anti-OX40L antibody SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31
  • mixed lymphyocyte reaction assays treated with proteins described herein causes an increase in the T reg :T effector cell ratio by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% as compared to cells treated under the same conditions but in the absence of protein.
  • Inhibition of costimulatory CD28 and OX40 activation can promote differentiation of Treg cells.
  • proteins described herein significantly enhance Treg suppressive function in an in vitro mixed lymphocyte reaction assay as compared to Treg cells treated under the same conditions but in the absence of protein, or in the presence of a CTLA4- Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti-OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4- Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • an anti-OX40L antibody SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31
  • mixed lymphyocyte reaction assays treated with proteins described herein causes a decrease in the number of proliferating T effector (Teff or T eff ) cells in co-culture with T regs at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% as compared to cells treated under the same conditions but in the absence of protein.
  • Teff or T eff proliferating T effector
  • proteins of the present invention significantly inhibit alloreactive CD4 + and CD8 + T cell proliferation in an adoptive transfer assay in humanized mice as compared to alloreactive CD4 + and CD8 + T cells in mice treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti- OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • mice treated with proteins described herein causes a decrease in the number of proliferating alloreactive CD4 + and CD8 + T cells in an adoptive transfer assay by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% as compared to mice treated under the same conditions but in the absence of protein.
  • proteins described herein significantly inhibit serum IFN ⁇ levels in an adoptive transfer assay in humanized mice as compared to mice treated under the same conditions but in the absence of protein, or in the presence of a CTLA4-Ig (extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain; SEQ ID NO: 34) and an anti-OX40L antibody (SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31), presented individually or in combination of the two proteins presented separately.
  • CTLA4-Ig extracellular domain of human CTLA4 fused at the N-terminus of human IgG1 Fc domain
  • an anti-OX40L antibody SEQ ID NO: 35 and SEQ ID NO: 36; SEQ ID NO: 30 and SEQ ID NO: 31
  • mice treated with proteins described herein causes a decrease in serum IFN ⁇ levels in an adoptive transfer assay by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, or at least 60% as compared to mice treated under the same conditions but in the absence of protein.
  • proteins described herein are not significantly internalized into myeloid-derived dendritic cells (MDDCs).
  • proteins described herein are cross reactive with cynomolgus OX40L.
  • a protein of the present invention can bind cynomolgus OX40L with a KD of 20 nM to 120 nM, 40 nM to 120 nM, 60 nM to 120 nM, 80 nM to 120 nM, 20 nM to 100 nM, 40 nM to 100 nM, 60 nM to 100 nM, 80 nM to 100 nM, 20 nM to 80 nM, 40 nM to 80 nM, or 60 nM to 80 nM as measured by a steady-state affinity assay by Surface Plasmon Resonance (SPR).
  • SPR Surface Plasmon Resonance
  • proteins of the present invention are not cross-reactive with mouse, rabbit, or rat OX40L.
  • a protein of the present invention has a K D of greater than 200 nM, greater that 250 nM , or greater than 500 nM when measured by a steady-state affinity assay by Surface Plasmon Resonance (SPR) for binding to mouse, rabbit, or rat OX40L.
  • proteins of the present invention are cross reactive with cynomolgus CD80 and CD86.
  • a protein of the present invention can bind cynomolgus CD80 and CD86 with a K D of 20 nM to 120 nM, 40 nM to 120 nM, 60 nM to 120 nM, 80 nM to 120 nM, 20 nM to 100 nM, 40 nM to 100 nM, 60 nM to 100 nM, 80 nM to 100 nM, 20 nM to 80 nM, 40 nM to 80 nM, or 60 nM to 80 nM as measured by a steady-state affinity assay by Surface Plasmon Resonance (SPR).
  • SPR Surface Plasmon Resonance
  • an antibody that specifically binds OX40L comprises a heavy chain variable domain (VH) and light chain variable domain (VL) selected from the sequences listed in TABLE 2.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • the heavy chain variable domain and the light chain variable domain of antibodies described herein comprise VH and VL CDR sequences selected from the consensus VH and VL sequences listed in TABLE 2.
  • the CDR sequences provided in TABLE 2 are determined under the IMGT unique numbering scheme
  • antibodies of the present invention may be IgG, IgM, IgA, IgD, or IgE.
  • antibodies described herein are IgG1, IgG1, IgG3, or IgG4.
  • antibodies of the present invention are human IgG1 antibodies.
  • antibodies that specifically bind to OX40L comprise a VHCDR3 sequence selected from the consensus sequence of SEQ ID NO: 220 or SEQ ID NO: 221.
  • antibodies that specifically binds to OX40L comprise: a heavy chain variable complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of SEQ ID NO: 222; a heavy chain variable complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of SEQ ID NO: 223, SEQ ID NO: 224, or SEQ ID NO: 225); and a heavy chain variable complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of: SEQ ID NO: 220 or SEQ ID NO: 221.
  • VHCDR1 heavy chain variable complementarity-determining region 1
  • VHCDR2 heavy chain variable complementarity-determining region 2
  • VHCDR3 heavy chain variable complementarity-determining region 3
  • antibodies that specifically bind to OX40L comprise: a light chain variable complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of SEQ ID NO: 226 or SEQ ID NO: 227; a light chain variable complementarity- determining region 2 (VLCDR2) comprising an amino acid sequence of SEQ ID NO: 82, SEQ ID NO: 228 or SEQ ID NO: 90; and a light chain variable complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of SEQ ID NO: 231 or SEQ ID NO: 232.
  • VLCDR1 light chain variable complementarity-determining region 1
  • VLCDR2 light chain variable complementarity-determining region 2
  • VLCDR3 light chain variable complementarity-determining region 3
  • antibodies that specifically bind to OX40L comprise: a VHCDR1 comprising an amino acid sequence of SEQ ID NO: 222; a VHCDR2 comprising an amino acid sequence of SEQ ID NO: 223; a VHCDR3 comprising an amino acid sequence of SEQ ID NO: 220; a VLCDR1 comprising an amino acid sequence of SEQ ID NO: 226; a VLCDR2 comprising an amino acid sequence of SEQ ID NO: 82; and a VLCDR3 comprising an amino acid sequence of SEQ ID NO: 231.
  • antibodies that specifically bind OX40L comprise: a VHCDR1 comprising an amino acid sequence of SEQ ID NO: 222; a VHCDR2 comprising an amino acid sequence of SEQ ID NO: 224; a VHCDR3 comprising an amino acid sequence of SEQ ID NO: 221; a VLCDR1 comprising an amino acid sequence of SEQ ID NO: 227; a VLCDR2 comprising an amino acid sequence of SEQ ID NO: 228; and a VLCDR3 comprising an amino acid sequence of SEQ ID NO: 232.
  • antibodies that specifically bind to OX40L comprise, according to the IMGT unique numbering scheme, VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 each comprising an amino acid sequence corresponding to the VHCDR1, VHCDR2, VHCDR3, VLCDR1, VLCDR2, and VLCDR3 sequences of a VHCDR and VLCDR consensus sequences of TABLE 2, respectively.
  • the antibody that specifically binds OX40L comprises an antibody heavy chain (HC) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the HC of an antibody disclosed in TABLE 3, and an antibody light chain (LC) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the LC of the same antibody disclosed in TABLE 3.
  • HC antibody heavy chain
  • LC antibody light chain
  • the antibody that specifically binds OX40L comprises an antibody heavy chain variable domain (VH) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VH of an antibody disclosed in TABLE 3, and an antibody light chain variable domain (VL) that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to the VL of the same antibody disclosed in TABLE 3.
  • VH antibody heavy chain variable domain
  • VL antibody light chain variable domain
  • the antibody comprises the heavy chain CDR1, CDR2, and CDR3 and the light chain CDR1, CDR2, and CDR3, determined under IMGT unique numbering scheme, Kabat (see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No 91-3242 Bethesda) Chothia (see e g Chothia C & Lesk A M (1987) J Mol Biol.196: 901-917), MacCallum (see MacCallum R M et al., (1996) J. Mol. Biol.262: 732-745), or any other CDR determination method known in the art, of the VH and VL sequences disclosed in TABLE 3.
  • Kabat see Kabat et al., (1991) Sequences of Proteins of Immunological Interest, NIH Publication No 91-3242 Bethesda
  • Chothia see e g Chothia C & Lesk A M (1987) J Mol Biol.196: 901-917
  • the antibody that specifically binds to OX40L comprises a heavy chain complementarity-determining region 1 (VHCDR1) comprising an amino acid sequence of GGSISTSSYY (SEQ ID NO: 77), a heavy chain complementarity-determining region 2 (VHCDR2) comprising an amino acid sequence of IYYSGST (SEQ ID NO: 78), a heavy chain complementarity-determining region 3 (VHCDR3) comprising an amino acid sequence of ARHRGSYFFDI (SEQ ID NO: 79), a light chain complementarity-determining region 1 (VLCDR1) comprising an amino acid sequence of DIENKN (SEQ ID NO: 81), a light chain complementarity-determining region 2 (VLCDR2) comprising an amino acid sequence of RDN (SEQ ID NO: 82), and a light chain complementarity-determining region 3 (VLCDR3) comprising an amino acid sequence of QVRDSNIVV (SEQ ID NO: 83).
  • VHCDR1 comprising an amino acid sequence of GGSISTSSY
  • the antibody that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GVSIRSNGYY (SEQ ID NO: 93), a VHCDR2 comprising an amino acid sequence of MDYSGT (SEQ ID NO: 94), a VHCDR3 comprising an amino acid sequence of ARERSNNWYPIDY (SEQ ID NO: 95), a VLCDR1 comprising an amino acid sequence of SVRRFF (SEQ ID NO: 97), a VLCDR2 comprising an amino acid sequence of GKD (SEQ ID NO: 98), and a VLCDR3 comprising an amino acid sequence of NSRDSSGYLVL (SEQ ID NO: 99).
  • the antibody that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GASVSSSSYY (SEQ ID NO: 85), a VHCDR2 comprising an amino acid sequence of INYGGST (SEQ ID NO: 86), a VHCDR3 comprising an amino acid sequence of ARHRGIYHFDY (SEQ ID NO: 87), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • the antibody that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GGSISSSSYY (SEQ ID NO: 101), a VHCDR2 comprising an amino acid sequence of IGSVDYSGNT (SEQ ID NO: 102), a VHCDR3 comprising an amino acid sequence of ARHRGIYFFDY (SEQ ID NO: 103), a VLCDR1 comprising an amino acid sequence of NIENKN (SEQ ID NO: 89), a VLCDR2 comprising an amino acid sequence of RDS (SEQ ID NO: 90), and a VLCDR3 comprising an amino acid sequence of QVWDSNTVV (SEQ ID NO: 91).
  • the antibody that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of GFTFSNYA (SEQ ID NO: 133), a VHCDR2 comprising an amino acid sequence of ISGSGGAT (SEQ ID NO: 113), a VHCDR3 comprising an amino acid sequence of TKDRLIMATVRGPYYYGMDV (SEQ ID NO: 114), a VLCDR1 comprising an amino acid sequence of QSISSY (SEQ ID NO: 121), a VLCDR2 comprising an amino acid sequence of AAS (SEQ ID NO: 146), and a VLCDR3 comprising an amino acid sequence of QQSHSVSFT (SEQ ID NO: 154).
  • the antibody that specifically binds to OX40L comprises a VHCDR1 comprising an amino acid sequence of SYAMS (SEQ ID NO: 105), a VHCDR2 comprising an amino acid sequence of IISGSGGFTYYADSVK (SEQ ID NO: 106), a VHCDR3 comprising an amino acid sequence of DRLVAPGTFDY (SEQ ID NO: 107), a VLCDR1 comprising an amino acid sequence of RASQGISSWLA (SEQ ID NO: 169), a VLCDR2 comprising an amino acid sequence of AASSLQS (SEQ ID NO: 170), and a VLCDR3 comprising an amino acid sequence of QQYNSYPYT (SEQ ID NO: 171).
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 76, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 80.
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 92, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 96.
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 84 and a VL that comprises an amino acid sequence at least 90% (e g at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 88.
  • VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 88.
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 100, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 104.
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 31, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 30.
  • the antibody that specifically binds OX40L comprises a VH that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 33, and a VL that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 32.
  • the antibody that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 8, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 7.
  • the antibody that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 16, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% at least 99% or 100%) identical to SEQ ID NO: 15 [0264] In certain embodiments, the antibody that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
  • the antibody that specifically binds OX40L comprises a HC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 18, and a LC that comprises an amino acid sequence at least 90% (e.g., at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100%) identical to SEQ ID NO: 17.
  • the present disclosure also provides pharmaceutical formulations that contain a therapeutically effective amount of a protein disclosed herein.
  • the pharmaceutical formulation comprises one or more excipients and is maintained at a certain pH.
  • excipient means any non-therapeutic agent added to the formulation to provide a desired physical or chemical property, for example, pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption, or penetration.
  • the present application provides methods for treating autoimmune disease using a protein described herein and/or a pharmaceutical formulation described herein.
  • the methods may be used to treat a variety of autoimmune diseases including, but not limited to, rheumatoid arthritis, juvenile idiopathic arthritis, psoriatic arthritis, atopic dermatitis, Achalasia, Addison’s disease, Adult Still's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome, Autoimmune angioedema, Autoimmune dysautonomia, Autoimmune encephalomyelitis, Autoimmune hepatitis, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune orchitis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune urticaria, Axonal & neuronal neuropathy (AMAN), Baló disease,
  • EXAMPLE 1 Reagent Preparation, Immunization Method, and Screening Assays
  • HEK293 EBNA-NFkb-Luc cell line was transfected with a plasmid vector for stable expression of full-length human OX40 (SEQ ID NO: 250). Stable mini-pools were selected with hygromycin and screened for induction of luciferase activity after incubation of cells with recombinant His-tag human OX40L protein (R&D systems).
  • Human OX40 (underlining denotes signal peptide) MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHEC RPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGS ERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQA CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPIT VQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLA LYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI (SEQ ID NO: 250) 1.1.2 Production of multi-valent human OX40L recombinant protein [0272] Human OX40L extracellular domain (ECD) (amino acids 51-183 of SEQ ID NO: 2) was expressed fused to Avi-GST-6His-tag domains (“6His” disclosed as S
  • OX40L ECD fusion protein “AVI-GST-His6-hOX40L” (“His6" disclosed as SEQ ID NO: 338) is a soluble protein reagent that is multi-valent for OX40L ECD.
  • CHO-S cells expressing human, cynomolgus monkey or mouse OX40L [0273] CHO-S cells were transfected with a plasmid vector for stable expression of full- length human OX40L (SEQ ID NO: 2), full-length cynomolgus monkey OX40L (SEQ ID NO: 337), or full-length mouse OX40L (SEQ ID NO: 251).
  • Antibody binding to the CHO-S-OX40L cells was detected with fluorescently labelled anti-rat-IgG or anti-human IgG Fc secondary antibody as appropriate and measured by flow cytometry.
  • 1.1.5 ELISA screen for binding to recombinant human, cynomolgus monkey, or mouse OX40L [0275] ELISA assay plates were coated with recombinant human (Novoprotein cat.# CJ45), cynomolgus monkey (Novoprotein cat.# CP72) or mouse OX40L (R&D systems cat.# 1236-OX) proteins followed by incubation with a dilution series prepared from immunized rat serum or with recombinant anti-OX40L antibodies.
  • Antibody binding to the coated ELISA plates containing recombinant OX40L was detected with peroxidase conjugated anti-rat-IgG or IgM or anti-human IgG Fc secondary antibody as appropriate.
  • 1.1.6 ELISA screen for anti-OX40L antibodies that block OX40L:OX40 protein binding interaction [0276] Recombinant OX40-Fc fusion protein (R&D Systems) was coated onto 384-well ELISA assay plates and then blocked with BSA.
  • Soluble recombinant OX40L-His protein (R&D Systems or in-house produced) was added to OX40-Fc coated assay plates and after incubation and washing, binding of soluble OX40L-His to coated OX40-Fc was detected with peroxidase- conjugated anti-His antibody. This condition gives the maximum signal of OX40L binding to OX40 without inhibition.
  • soluble OX40L-His protein was mixed with anti-OX40L antibodies, incubated, added to OX40- Fc coated assay plates and binding of OX40L to OX40 detected as above.
  • CD80 proteins human CD80, Novoprotein cat.# CK61; cynomolgus monkey CD80, Novoprotein cat.# CP54
  • CD86 proteins human CD86, Novoprotein cat.# C404
  • the response at steady state was measured with a Biacore T200 instrument (GE Healthcare) and plotted against the concentration of antibody and fit to a 1:1 binding model.
  • the steady state KD was determined as the antibody concentration at a response equal to half the maximal response (Rmax).
  • Cynomolgus monkey CD86 Novoprotein cat.# CP41
  • steady-state affinity was measured with an Octet RED96 instrument (ForteBio) in a BLI assay.
  • the Fc region of experimental CTLA4_ anti-OX40L fusion proteins or of CTLA4-Ig reference protein was captured using anti-human IgG Fc Capture (AHC) Biosensors (ForteBio, cat.# 18-5060).
  • Recombinant cynomolgus monkey CD86 was bound to this surface at a range of concentrations.
  • the response at steady state was plotted against the concentration of recombinant protein and fit to a 1:1 binding model.
  • the steady state KD was determined as the recombinant protein concentration at a response equal to half the maximal response (Rmax).
  • HEK293 NFkB-Luc hOX40 reporter cells (as described in 1.1.1) were plated at 0.5 x 10 6 cells/mL in serum-free media (Life Technologies: DMEM, Hygromycin B, Blasticidin and L-Glutamine), 50,000 cells/60 ⁇ l/well in a tissue culture treated clear bottom 96 well plate (Falcon) and incubated overnight at 37 °C, 5% CO2.
  • a dilution series from immunized rat serum, or anti-OX40L antibodies was prepared in culture media in a 96 well plate (NUNC).30 ⁇ l of the titration series were transferred to a 96 well plate (NUNC) containing 30 ⁇ L of 10 ⁇ g/mL recombinant human OX40L (described in 1.1.2) in each well. The antibody and recombinant OX40L mixture was incubated for 30 min. at room temperature, 20 ⁇ L of the mixture/well was added to the reporter cells and incubated overnight at 37 °C, 5% CO 2 .
  • CD4 + T cells were isolated using RosetteSep Human T Cell Enrichment Kit (StemCell Technologies 15062) 96 well plates were coated with 5 ⁇ g/mL anti CD3 (BD Biosciences 555338) and 5 ⁇ g/mL Anti-CD28 (BD Biosciences, 555725) for 1 hr at room temperature. Plates were washed with 200 ⁇ L 1X PBS, twice.
  • Antibodies were prepared in 1:3.5 serial titration from 100 nM and then incubated with 10 ⁇ g/mL recombinant human OX40L (R&D Systems, 1054- OX) for 30 min at 37 °C, 5% CO2. Cells were resuspended at 1 x 10 6 cells/mL and 600 ⁇ L of cells were added to a 0.5 mL 96 well deep well plate with 120 ⁇ L of the antibody/rhOX40L mixture.200 ⁇ L of the cells/antibody/rhOX40L mixture was added to each well of the anti- CD3/anti-CD28 coated plate. Plates were incubated for 48 hrs at 37 °C, 5% CO2.
  • EXAMPLE 2 Identification, Generation, and Characterization of Anti-OX40L Antibodies [0282] This example describes the identification, generation, and characterization of anti- OX40L antibodies. In order to generate the anti-OX40L antibodies, OmniRat® rodents (a transgenic animal, purchased from Open Monoclonal Technology, Inc.
  • OmniRats® were identified with serum immune response for binding to human and cynomolgus OX40L. Sera were subsequently screened for neutralizing activity against soluble recombinant OX40L in the blocking ELISA assay described in 1.1.6 of Example 1 and human OX40L neutralization assay described in 1.1.9 of Example 1. Rats whose sera demonstrated good neutralizing activity and high titer to bind cell surface OX40L and soluble recombinant OX40L were selected.
  • Single OX40L-binding B cells were sorted with a FACS Aria III (BD Biosciences) into each well of a 96 well plate.
  • FACS Aria III BD Biosciences
  • single OX40L-binding B cells were sorted directly into wells containing lysis buffer (0.1M DTT, 40 U/ml RNAse Inhibitor, Invitrogen, Cat# 10777-019) and plates were sealed and immediately frozen on dry ice before storage at -80 °C.
  • lysis buffer 0.1M DTT, 40 U/ml RNAse Inhibitor, Invitrogen, Cat# 10777-019
  • plates were sealed and immediately frozen on dry ice before storage at -80 °C.
  • B cell culture and screening OX40L-binding B cells were sorted into wells with B cell culture medium containing cytokines and irradiated in-house generated feeder cells.
  • RNA from single sorted B cells was reverse transcribed in a final volume of 14 ⁇ l/well in the original 96- well sorting plate with nuclease-free water (Invitrogen, Cat# AM9935) using final amounts/concentrations of 150 ng random hexamer primer (pd(N)6, Applied Biosystems, P/N N808-0127) and 50U Superscript IV reverse transcriptase (Invitrogen, Cat#18090050) following the manufacturer’s protocol.
  • PCR reactions were performed in 96-well plates in a total volume of 50 ⁇ l per well by using Platinum Multiplex PCR Reaction (Invitrogen, Cat#4464269) for first round of PCR, then by AccuPrime Taq DNA Polymerase High Fidelity kit, (Invitrogen, Cat#.12346-094) for nested PCR following the manufacturer’s protocol.
  • the first round of PCR was performed at 95 °C for 2 min followed by 30 cycles of 94 °C for 30 sec, 50 °C for 30 sec, 72 °C for 40 sec, and final incubation at 72 °C for 5 min.
  • Nested second round PCR was performed with 5 ⁇ l of unpurified first round PCR product at 95 °C for 2 min followed by 5 cycles of 94 °C for 30 sec, 42 °C for 30 sec, 72 °C for 45 sec, and then 35 cycles of 94 °C for 30 sec, 55 °C for 30 sec, 72 °C for 45 sec, and final incubation at 72 °C for 5 min.
  • Paired V H and V L antibody sequences were obtained from 360 OX40L-binding B cells from direct B cell sorting and cloning, and 54 paired VH and VL antibody sequences were obtained from B cell culture, screening and cloning.
  • IgG Format Recombinant anti-OX40L antibodies were produced with the Ig expression vectors constructed with the paired V H and VL sequences obtained through direct B cell cloning and B cell culture approaches as described in section 2.1 of this example.
  • Purified candidate anti-OX40L antibodies were compared as described above and further selected, with criteria that included clone sequence analysis, neutralization assay IC 50 ⁇ 20 nM (reporter cell and primary cell assays) and steady-state SPR binding KD ⁇ 60 nM. All selected candidates bound to human and cynomolgus OX40L and none were cross-reactive for binding to mouse OX40L.22 out of 85 candidates met the above criteria. Antibody sequences of these 22 candidates were analyzed and 12 candidate clones that represented the antibody clonal sequence diversity were selected for further studies.
  • Anti-OX40L antibody clones were tested for OX40L blocking function with the OX40L neutralization assay. Briefly, test antibodies, isotype control and known anti-OX40L reference antibody (positive controls) were serially titrated in culture media, incubated with recombinant human OX40L, and added to OX40 receptor expressing HEK-luciferase reporter cells as described in 1.1.9 of Example 1. Data were plotted with GraphPad Prism 8 software.
  • Clones 30F02 (IgG), 88B06 (IgG), 85F10 (IgG) and 84E11 (IgG) had IC50 values of 17.7 to 72.7nM. TABLE 8 summarizes data from this reporter assay.
  • FIG.2A is a flow chart providing the antibody screening cascade for anti-OX40L antibodies.
  • the flow chart shows the assays that were used to screen and shortlist the anti- OX40L antibody clones to obtain twelve candidates.
  • FIG.2B is a flow chart providing the candidate characterization cascade.
  • Example 3 Generation and Characterization of Anti-OX40L FcFab Antibodies and CTLA4_antiOX40L Fusion Proteins
  • FcFab Format and CTLA4_antiOX40L Fusion protein Format This example describes how the twelve anti-OX40L clones were generated in FcFab and fusion with CTLA4 formats followed by characterization assays.
  • the N-terminus of the heavy chain of the antibody clone consisting of VH-CH1-and partial IgG1 hinge (EPKSC) sequence, was fused to the C-terminus of a 16 amino acid linker sequence that was fused to the C-terminus of the Fc polypeptide.
  • the heavy chain polypeptides of these protein formats were co-expressed with the antibody clone light chain polypeptides, which associated with the heavy chain polypeptide of the Fab, and a disulfide bond was formed between the light chain and the C-terminal partial IgG1 hinge of the heavy chain.
  • the anti-OX40L FcFab antibodies heavy chain N-terminus began with the first amino acid of the IgG1 hinge element E216 (Kabat EU index numbering), as represented in sequence of SEQ ID NO: 73.
  • the heavy chain and light chain amino acid sequences of the twelve CTLA4_anti OX40L fusion proteins are represented in SEQ ID NOs: 37-60.
  • Heavy chain DNA expression vectors for each of the anti-OX40L FcFab antibodies were produced by PCR amplification of the anti-OX40L antibody VH sequence and the PCR products were cloned into a FcFab heavy chain expression vector using 5’ BamHI and 3’NheI restriction enzyme sites that flanked the VH sequence and are part of the codon sequence of the 16-amino acid linker and the CH1 domain, respectively.
  • the FcFab heavy chain expression vector was generated by gene synthesis (Quintara Biosciences) and then cloning the gene synthesis product into the transient expression vector pTT5 (Durocher et al., Nucleic Acids Res. 2002 Jan 15;30(2):E9.).
  • the CTLA4_anti OX40L heavy chain expression vector was generated by gene synthesis (Genewiz) and then cloning the gene synthesis product into the transient expression vector pTT5.
  • the clone specific VH sequence was cloned to be located between 5’ BamHI and 3’NheI restriction enzyme sites that flanked the VH sequence and are part of the codon sequence of the 16-amino acid linker and the CH1 domain, respectively.
  • Exemplary DNA sequences constructed in these CTLA4_antiOX40L expression vectors are shown in SEQ ID NO: 74 (light chain sequence) and SEQ ID NO: 75 (heavy chain sequence).
  • the anti-OX40L FcFab antibodies were produced in a 15-ml scale transient transfection of ExpiCHO cells and affinity purified with protein A beads and characterized.
  • the CTLA4_anti OX40L proteins were produced in a 1000-ml scale transient transfection of ExpiCHO cells and affinity purified with a protein A column (Hi-Trap MAbSelect SuRe, GE Healthcare) on an Akta Avant 25 chromatography system (GE Healthcare). Final protein concentrations were measured and proteins were characterized by analytical size exclusion chromatography (SEC), SDS-PAGE gels and tested for endotoxin before use in the planned studies.
  • SEC analytical size exclusion chromatography
  • Anti-OX40L FcFAb antibody clones were tested for OX40L blocking function with the OX40L neutralization assay. Briefly, test antibodies, isotype control and known anti-OX40L reference antibody (positive controls) were serially titrated in culture media, incubated with recombinant human OX40L, and added to OX40 receptor expressing HEK-luciferase reporter cells as described in 1.1.9 of Example 1. Data were plotted with GraphPad Prism 8 software.
  • FcFab antibody clones 84E11 (FcFab), 88B06 (FcFab), 95B06 (FcFab), 30F02 (FcFab), 85F12 (FcFab) and 85F10 (FcFab) demonstrated a considerable decrease in potency, increasing their IC 50 by at least two-fold compared to their IgG counterpart.
  • IC 50 values for anti-OX40L FcFab antibodies were determined with GraphPad Prism by curve fitting using the log (inhibitor) vs normalized response – variable slope equation. TABLE 9 summarizes data from duplicates from 1 experiment.
  • CTLA4_anti OX40L fusion proteins were tested for OX40L blocking function with the OX40L neutralization assay. Briefly, test fusion proteins, isotype control and known anti- OX40L reference antibody (positive controls) were serially titrated in culture media, incubated with recombinant human OX40L, and added to OX40 receptor expressing HEK-luciferase reporter cells as described in 1.1.9 of Example 1. Data were plotted with GraphPad Prism 8 software.
  • FIG.4 is a graph showing neutralization of OX40L for CTLA4_anti OX40L fusion proteins 95B06, 98C01, 98E10, 84E11, 68F03, 67B06, 97G07, 89B09, and Ref4_CTLA4_O13, for the reference anti-OX40L monoclonal antibodies Ref1_Anti_OX40L and Ref2_Anti-OX40L, or for isotype control, using OX40 luciferase reporter assay.
  • CTLA4_anti OX40L fusion proteins As shown in FIG.4, seven CTLA4_anti OX40L fusion proteins (97G07, 68F03, 67B06, 98E10, 89B09, 98C01, 95B06) retained similar potency to a reference anti-OX40L monoclonal antibody.
  • fusion protein 84E11 similar to its FcFab counterpart, lost binding affinity to human OX40L. TABLE 10 summarizes data from this assay.
  • CTLA4_anti OX40L fusion proteins 89B09, 67B06 and 98C01 and a reference anti-OX40L antibody were evaluated for binding to human and cynomolgus monkey OX40L expressed on CHO-S cells by flow cytometry as described in section 1.1.4 of Example 1.
  • Binding affinity to cynomolgus monkey OX40L was determined for fusion proteins 67B06 and 89B09 and compared to the reference anti-Ox40L antibody. The K D of the fusion protein (85nM) was found to be similar to that of the reference anti-OX40L antibody (57nM). [0309] Binding affinity to human and cynomolgus CD80 and CD86 was determined for CTLA4_anti OX40L fusion proteins and reference CTLA4-Ig proteins using steady state affinity assays as described in section 1.1.8 of Example 1.
  • CTLA4_ anti OX40L fusion proteins retained binding to and demonstrated excellent cross-reactivities between human and cynomolgus OX40L, CD80 and CD86.
  • the seven CTLA4_anti OX40L fusion proteins were rank ordered and four clonally diverse sequences were selected based on highly potent neutralization activity and affinity closest to the monoclonal anti-OX40L IgG reference antibodies.
  • FIGs.3A-3C are graphs showing neutralization of OX40L by anti-OX40L (97G07 and 67B06) in IgG (FIG.3A), FcFab (FIG.3B), and fusion protein (FIG.3C) format using OX40 luciferase reporter assay.
  • Monoclonal anti-OX40L antibodies (Ref1_Anti-OX40L and/or Ref2_Anti-OX40L) were used as reference controls.
  • Anti-HEL IgG1 was used as isotype control (Isotype-IgG1).
  • Example 4 Mechanism of Action of CTLA4_anti OX40L Fusion Proteins Using In Vitro Assays
  • This example elucidates the mechanism of action of CTLA4_anti OX40L fusion proteins utilizing in vitro assays.
  • MLR T mixed lymphocyte reaction
  • the CTLA4_anti OX40L fusion proteins that retained good human OX40L neutralization and binding were tested for their bifunctional activities.
  • a human allogenic MDDC T mixed lymphocyte reaction (MLR) was set up.
  • This assay utilized activated primary monocyte derived dendritic cells (MDDC) as antigen presenting cells that express all three targets CD80, CD86, and OX40L, allowing the assessment of both CD28 and OX40 pathways contributing to T cell proinflammatory cytokine release and T proliferation.
  • MDDC monocyte derived dendritic cells
  • iMMDCs were treated with 1 ⁇ g/ml of Prostaglandin E2 (PGE2), and 20 ng/ml TNF ⁇ , 10 ng/mL IL-1b, 20 ng/mL IL-6 for 2 days to generate matured MDDC.
  • PGE2 Prostaglandin E2
  • TNF ⁇ 10 ng/mL IL-1b
  • IL-6 20 ng/mL IL-6
  • Cell surface expression of CD86, CD80, and OX40L on the matured MDDC were confirmed by flow cytometry.
  • fresh PBMCs were isolated from buffy coat using a Ficoll gradient.
  • Total T cells were isolated from the PBMCs using a pan-T cell isolation kit (Miltenyi Biotec, 130-096-535).
  • CTLA4_anti OX40L fusion proteins 89B09, 67B06, 98E10, and 98C01 were tested at three concentrations (0.8 nM, 6.25 nM, and 50 nM) compared to equimolar concentrations of single reference agents (Ref2_Anti-OX40L, Ref3_CTLA4Ig), and combination of monoclonal anti-OX40L antibody and CTLA4-Ig (combinaton).
  • the fusion protein (67B06, 98E10, and 98C01) demonstrated superior suppression of IL-2 (FIG.5A) and TNF ⁇ (FIG.5B) cytokines at all concentrations tested compared to the single reference agents.
  • the fusion proteins potently suppressed the cytokines better than the combination of CTLA4-Ig and anti-OX40L, suggesting a synergistic effect by a bifunctional fusion protein compared to single agents in combination.
  • Data shown was normalized from 4 donor MLR pairs. IC 50 values for all tested fusion proteins were determined by curve fitting using the log(inhibitor) vs normalized response – variable slope equation.
  • T MLR assay T MLR assay.
  • T cells were labelled with Cell Trace Violet dye (Invitrogen) and cultured with matured MDDCs as described above with the addition of 0.35 ⁇ L/mL anti-CD3 beads (StemCell, 10309).
  • Fusion proteins (89B09, 67B06, 98E10, and 98C01), CTLA4-Ig (Ref3_CTLA4Ig), anti-OX40L (Ref2_Anti-OX40L), or combination of CTLA4-Ig and anti-OX40L (combination) were tested at equimolar concentrations of either 6.25nM or 50nM.
  • the cells were subsequently cultured at 37 ° C and 5% CO2 for 4 days, stained with fluorescent labelled antibodies against the following markers CD3, CD4, and OX40 for FACS analysis on BD LSR Fortessa X-20 and analyzed for percent proliferating CD4 + OX40 + and proliferating CD4-OX40 + or CD8 + OX40 + cells by FlowJo.
  • the fusion proteins (89B09, 67B06, 98E10, and 98C01) potently reduced proliferation of allo-reactive CD4 + OX40 + and CD8 + OX40 + cells better than the combination of CTLA4-Ig and anti-OX40L (combination) in a statistically significant manner.
  • fusion proteins (89B09, 67B06, and 98C01) were assessed for OX40L neutralizing function and their ability to restore Treg generation in a Treg inducing assay compared to reference anti-OX40L (Ref1_Anti- OX40L and Ref2_Anti-OX40L) and CTLA4-Ig (Ref3_CTLA4Ig) controls.
  • Reference anti-OX40L Ref1_Anti- OX40L and Ref2_Anti-OX40L
  • CTLA4-Ig Ref3_CTLA4Ig
  • Complete RPMI1640 medium (supplemented with 10% heat-inactivated FBS, 2mM L-glutamine, 50 IU Penicillin/ 50 ug/ml of Streptomycin, 1 mM Na Pyruvate, 55 ⁇ M ⁇ -mercaptoethanol, and 0.01M of HEPES) was used for the in vitro T cell culture.100,000 na ⁇ ve T cells were placed in each well of a 96-well tissue culture plate and stimulated with plate-bound anti-CD3 (5 ug/ml) and soluble anti-CD28 (1 ug/ml), plus 5 ng/ml of TGF- ⁇ and 50 U/ml of IL- 2. The cells were cultured for 5 days at 37 ° C in CO2 incubator.
  • Treg Teff MLR Assay
  • Freshly isolated monocytes were cultured in the presence of 50 ng/ml GM-CSF and 50 ng/ml IL-4 (in AIM-V media with 5% human AB serum, 50 U/ml Penicillin, 50 ⁇ g/ml Streptomycin) for 5 days to become immature monocyte-derived dendritic cells and treated with 1 ⁇ g/ml of PGE2, 20 ng/ml TNF ⁇ , 20 ng/ml IL-6 and 10 ng/ml IL-1 ⁇ for 2 days to become matured MDDC (MDDC).
  • MDDC matured MDDC
  • CD4 + T cells were isolated from the PBMCs using a human CD4 T cell isolation kit (Miltenyi). Freshly isolated CD4 + T cells were then sorted into CD4 + CD25 hi CD127 low Treg and non-Treg CD4 + T (or Teff, Teff, or Teffector) cells by flow cytometry. The sorted Tregs were labelled with 2 ⁇ M of CellTrace Violet, and Teff CD4 + T cells were labelled with 2 ⁇ M CellTrace CFSE.
  • 25,000 MDDC and 50,000 Teff CD4 + T cells were plated in each well and cultured in complete AIM-V medium ((supplemented with 5% human AB serum, soluble anti-CD3 (0.6 ⁇ l/ml) (StemCell), 50 IU Penicillin/ 50 ⁇ g/ml of Streptomycin)).
  • AIM-V medium (supplemented with 5% human AB serum, soluble anti-CD3 (0.6 ⁇ l/ml) (StemCell), 50 IU Penicillin/ 50 ⁇ g/ml of Streptomycin)).
  • 12,500 Treg were added.
  • the cultured cells were also treated with either media control, isotype control Ab, CTLA4-Ig, anti- OX40L reference antibody, CTLA4_anti OX40L fusion proteins (89B09, 67B06, and 98C01) at 10 nM.
  • fusion protein 89B09 and associated controls were tested at 10 nM in the presence of various Treg:Teff ratio conditions. Then the cells were cultured at 37 ° C, 5% CO2 for 4 to 5 days before the cells were analyzed with BD LSR Fortessa X-20. Effector T cell proliferation was determined by CFSE dilution. The histograms were analyzed by FlowJo, the ratio of Treg to Teff, and absolute cell counts of proliferating Teff cells were plotted using Graphpad PRISM8.
  • the fusion proteins (89B09, 67B06, 98C01) demonstrated an even greater suppression of Teff proliferation compared to the control agents in the presence of Tregs (1:4 Treg:Teff condition). This result indicated that the fusion proteins can more effectively dampen Teffs and can work together with Tregs to affect further Teff suppression.
  • Rapamycin is an mTOR inhibitor and a general T cell immunosuppressant used in transplantation to effectively suppress Teff while increasing Tregs, thereby increasing the Treg:Teff ratio.
  • Voclosporin a second generation cyclosporin, is a calcineurin inhibitor and known T cell immunosuppressant that recently received FDA approval to treat lupus nephritis.
  • the same MLR assay as described above was performed with varying concentrations of fusion proteins, single agents, combination, and 100 nM rapamycin or volcopsorin.
  • CTLA4_anti OX40L fusion proteins (89B09, 67B06, 98C01) increased Treg: Teff ratio in a concentration dependent manner compared to single agents or the combination. Rapamycin or voclosporin did not increase Treg: Teff ratio in this invitro assay although clinically efficacious concentrations were tested.
  • Tregs also require CD28 signaling for activation and proliferation, it was essential to address whether the fusion proteins may inhibit Tregs and negatively impact their suppressive function on Teff.
  • the effect of fusion protein treatment on inhibiting T effector proliferation in the presence of increasing Tregs was also tested.
  • FIG.9B cultures treated with isotype control, the increasing Treg: Teff ratios decreased Teff proliferation as expected.
  • CTLA4-Ig treatment did not provide additional modulation of Teff suppression on top of the Tregs while anti-OX40L and combination provided modest modulation of Teff proliferation.
  • the fusion protein 89B09 suppressed the Teff proliferation better than the other treatments in the presence of increasing Tregs, indicating that the fusion protein did not negatively impact Treg function but worked synergistically with Tregs to more effectively dampen Teff proliferation.
  • the observation that the fusion protein but not the combination of single agents worked synergistically with Tregs to preferentially decrease Teff proliferation was a surprising finding and uncovered potentially interesting mechanistic differences between treatment with CTLA4_anti OX40L fusion proteins with dual co-stimulation blocking properties compared to treatment with the combination of single agents.
  • Example 5 Characterization of the Potency of CTLA4_anti OX40L Fusion Proteins [0331] This example describes the facts that contribute to the superior potency of CTLA4_anti OX40L fusion proteins.
  • CTLA4-Ig Internalization of 67B06, CTLA4-Ig, and anti-OX40L agents were tracked by leveraging pH rodo dyes which fluoresce at low pH when internalized into endocytic compartments of the cell. Negative controls for internalization such as pHrodo labelled isotype control and anti-CD20 antibody Rituxumab were tested in the same assay. Internalization of the test agents and the detected pHrodo signals were followed over time and recorded. CTLA4-Ig has been reported to be internalized upon binding to its target, while that may be an efficient way to block the targets CD80 and CD86 by removing them from the cell surface, the target mediated drug clearance may affect its potency.
  • CTLA4-Ig (Ref3_CTLA4Ig) was rapidly internalized within 6h and is continually internalized over 20h as indicated by increased pHrodo signal in the MDDCs (FIG.12).
  • anti-CD20 antibody Rituxumab Anti-CD20-IgG1
  • Isotype controls Isotype Ctl and Isotype-IgG1
  • anti-OX40L reference control Ref1_Anti-OX40L
  • CTLA4_anti OX40L fusion protein (67B06) bound the same CD80 and CD86 targets as CTLA4-Ig, it strikingly did not share the same internalization profile, and in fact, showed limited internalization into MDDCs over a 20h period (FIG.12). This may allow the fusion to block the targets CD80, CD86 and OX40L over a longer period of time, without being internalized or cleared, which could explain its enhanced potency compared to single agent comparators in the MDDC: T MLR assay.
  • MDDC SLE PBMC MLR Assay
  • lupus PBMCs when co-cultured with MDDCs induced elevated levels of IL-2 (data not shown), TNF ⁇ (data not shown), GMCSF (FIG.13A), IL-13 (FIG.13B), and GZMB (FIG.13C) in the culture supernatant and these cytokines can be potently suppressed by 1 nM of fusion protein (67B06) compared to the single agents or combination. At 50 nM both fusion and combination treatment are equally efficacious in dampening these cytokines. Allo-reactive IFN ⁇ producing cells were greatly reduced by the fusion protein and combination treatment at 50 nM compared to single agents.
  • FIGs.13A-13C show normalized data from 3 donors.
  • Example 6 In Vivo Pharmacodynamic Effects of CTLA4_anti OX40L Fusion Protein [0338] This example describes the in vivo pharmacodynamic effects of CTLA4_anti OX40L fusion proteins using humanized MLR PD model. 6.1 In vivo Humanized MLR PD Model [0339] Since none of the CTLA4_anti OX40L fusion proteins cross-react with mouse OX40L, a humanized in vivo pharmacodynamic (PD) model to evaluate the fusion proteins was developed. Briefly, monocyte derived dendritic cells were activated as previously described in the invitro MDDC: T MLR assay in Section 3.1.
  • NOD.Cg-Prkdc scid Il2rg tm1Wjl /SzJ or NSG mice (Jackson Labs) were treated i.v. with various concentrations of fusion proteins (67B06, 89B09), single arm controls or isotype control, followed by transfer of mixed activated MDDC (1 x 10 6 cells) and freshly isolated allogenic T cells (1 x 10 7 cells) via i.p. on Day 0.
  • serum was collected for human cytokine measurements using MSD kit (human u- Plex proinflammatory combo kit, cat #K15049K-2).
  • the levels of IFN ⁇ and statistical analysis (one-way ANOVA) was performed using GraphPad PRISM 8.
  • mice were treated with a single equal molar (2.88 nmol/kg or 0.58 nmol/kg) dose of 67B06 fusion protein, each single agent control CTLA4-Ig, or anti-OX40L 67B06 (IgG) compared to isotype control to evaluate whether the enhanced potency of the fusion protein observed in vitro was reflected in vivo.
  • fusion protein 67B06 at 2.88 nmol/kg offered superior suppression of human IFN ⁇ production compared to the comparators at the same equimolar concentration tested.
  • Example 7 In vivo Efficacy of CTLA4_anti OX40L Fusion Proteins [0341] This example describes the in vivo efficacy of CTLA4_anti OX40L fusion proteins using xenotransplant, acute, and chronic-graft vs host disease (xeno-GVHD) models.
  • the xeno-GVHD model is a well characterized model that is dependent on the infused human PBMCs generating a strong xeno-reactive response to the host mice that lack the murine immune system.
  • the xeno-GVHD model has well known limitations in the immune subsets that populate the animal and induce disease. For example, human B cells and myeloid cells do not survive longer than 7-10 days in the mice due to lack of survival factors. Human T cells, however, survive and expand well in the mice such that at Day 7 most of the engrafted cells in the mice are T cells.
  • the expanded T cells are xeno-reactive, infiltrating target organs such as the liver, lung and gut, causing tissue damage with increased inflammatory cytokines like IFN ⁇ , leading to reduction in body weight. If untreated, the mice succumb to the GVHD. Therefore, this model has been useful to evaluate many T cell targeting biologics which can suppress the T cells and alleviate the GVHD, by assessing their effects on reducing GVHD-mediated body weight loss and IFN ⁇ production.
  • PBMCs peripheral blood mononuclear cells
  • FIG.15A is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference monoclonal anti-OX40L antibody (Ref1_Anti_OX40L), or isotype control on weight loss in xeno-GVHD murine model.
  • FIG.15B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference monoclonal anti-OX40L antibody (Ref1_Anti_OX40L), or isotype control on IFN ⁇ production in xeno-GVHD murine model.
  • 67B06 CTLA4_anti OX40L fusion protein
  • Ref1_Anti_OX40L reference monoclonal anti-OX40L antibody
  • isotype control on IFN ⁇ production in xeno-GVHD murine model.
  • CTLA4_anti OX40L fusion protein (67B06) and CTLA4-Ig were compared.
  • CTLA4_anti OX40L fusion protein (67B06), CTLA4-Ig (Ref3_CTLA4Ig) or isotype control were administered at a dose of 20 ⁇ g/ mouse or of 1 ⁇ g/mouse (equivalent to 1mg/kg or 0.05mg/kg respectively) intraperitoneally once a week (Q1W).
  • FIG.16A is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference CTLA4Ig (Ref3_CTLA4Ig), or isotype control administered i.p.1mg/kg or 0.05mg/kg Q1W on weight loss in xeno-GVHD murine model.
  • FIG.16B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06), reference CTLA4Ig (Ref3_CTLA4Ig), or isotype control on IFN ⁇ production in xeno-GVHD murine model.
  • CTLA4_anti-OX40L fusion proteins (67B06), Ref3_CTLA4Ig, Ref1_Anti-Ox40L, and the combination of Ref3_CTLA4Ig and Ref1_Anti-OX40L were administered at a dose of 20 ⁇ g/ mouse (1mg/kg) intraperitoneally once a week (Q1W). The study was terminated at day 41.
  • FIG.17A is a graph showing the effect of CTLA4_anti OX40L fusion proteins (67B06) reference CTLA4Ig (Ref3_CTLA4Ig), anti-OX40L (Ref1_Anti-OX40L), combination (Ref3 and Ref1), or isotype control on weight loss in a xeno-GVHD murine model.
  • FIG.17B is a graph showing the effect of CTLA4_anti OX40L fusion protein (67B06) reference CTLA4Ig (Ref3_CTLA4Ig), anti-OX40L (Ref1_Anti-OX40L), combination (Ref3 and Ref1) or isotype control on IFN ⁇ production in a xeno-GVHD murine model.
  • mice In a further acute GVHD model, severe combined immunodeficient (SCID) mice (aged 5 to 10 weeks) are injected with 20 ⁇ g rat anti mouse IL 2R ⁇ antibody to deplete endogenous NK cells. The next day, mice receive 2.5 Gy of irradiation using a cesium source. Four hours later, each mouse receives 10 million total human PBMCs by intraperitoneal (IP) injection followed immediately by intravenous (IV) injection of CTLA4_anti OX40L fusion protein, reference monoclonal anti-OX40L antibody or isotype control at various dosages.
  • IP intraperitoneal
  • IV intravenous
  • CTLA4_anti OX40L fusion protein a monoclonal anti- OX40L antibody or isotype control at various dosages can be delayed until day 3 or day 6 post- IP injection of PBMCs.
  • Mice are weighed every 3 to 4 days and received anti-IL-2R ⁇ antibody weekly. At day 12, mice are sacrificed for assessment of gross pathology, flow cytometry analysis of splenocytes, liver and intestine histology, and serum collection for cytokine and antibody analysis.
  • INCORPORATION BY REFERENCE The entire disclosure of each of the patent documents and scientific articles referred to herein is incorporated by reference for all purposes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Transplantation (AREA)
  • Cell Biology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2022/032482 2021-06-08 2022-06-07 Proteins that bind cd80 and/or cd86, and ox40l Ceased WO2022261079A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
MX2023014695A MX2023014695A (es) 2021-06-08 2022-06-07 Proteinas que unen cd80 y/o cd86 y ox40l.
BR112023025553A BR112023025553A2 (pt) 2021-06-08 2022-06-07 Proteínas que se ligam a cd80 e/ou cd86 e ox40l
EP22820886.4A EP4351644A4 (en) 2021-06-08 2022-06-07 CD80 AND/OR CD86 BINDING PROTEINS AND OX40L
KR1020247000142A KR20240019224A (ko) 2021-06-08 2022-06-07 Cd80 및/또는 cd86, 및 ox40l에 결합하는 단백질
CN202280055594.9A CN117794575A (zh) 2021-06-08 2022-06-07 结合cd80和/或cd86,以及ox40l的蛋白质
IL309119A IL309119A (en) 2021-06-08 2022-06-07 Proteins that bind cd80 and/or cd86, and ox40l
JP2023575897A JP2024524880A (ja) 2021-06-08 2022-06-07 Cd80および/またはcd86とox40lに結合するタンパク質
CA3218785A CA3218785A1 (en) 2021-06-08 2022-06-07 Proteins that bind cd80 and/or cd86, and ox40l
AU2022290257A AU2022290257A1 (en) 2021-06-08 2022-06-07 Proteins that bind cd80 and/or cd86, and ox40l
US18/530,536 US20240262922A1 (en) 2021-06-08 2023-12-06 Proteins that bind cd80 and/or cd86, and ox40l

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163208478P 2021-06-08 2021-06-08
US63/208,478 2021-06-08
US202263343268P 2022-05-18 2022-05-18
US63/343,268 2022-05-18

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/530,536 Continuation US20240262922A1 (en) 2021-06-08 2023-12-06 Proteins that bind cd80 and/or cd86, and ox40l

Publications (2)

Publication Number Publication Date
WO2022261079A2 true WO2022261079A2 (en) 2022-12-15
WO2022261079A3 WO2022261079A3 (en) 2023-01-19

Family

ID=84426420

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/032482 Ceased WO2022261079A2 (en) 2021-06-08 2022-06-07 Proteins that bind cd80 and/or cd86, and ox40l

Country Status (11)

Country Link
US (1) US20240262922A1 (enExample)
EP (1) EP4351644A4 (enExample)
JP (1) JP2024524880A (enExample)
KR (1) KR20240019224A (enExample)
AU (1) AU2022290257A1 (enExample)
BR (1) BR112023025553A2 (enExample)
CA (1) CA3218785A1 (enExample)
IL (1) IL309119A (enExample)
MX (1) MX2023014695A (enExample)
TW (1) TW202315890A (enExample)
WO (1) WO2022261079A2 (enExample)

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008007648A1 (fr) * 2006-07-10 2008-01-17 Institute For Antibodies Co., Ltd. Procédé de classification d'antigène, procédé d'identification d'antigène, procédé d'obtention d' un ensemble d'antigènes ou d'anticorps, procédés de construction d'un panel d'anticorps, anticorps et ens
US9574002B2 (en) * 2011-06-06 2017-02-21 Amgen Inc. Human antigen binding proteins that bind to a complex comprising β-Klotho and an FGF receptor
US20140370012A1 (en) * 2012-01-27 2014-12-18 Gliknik Inc. Fusion proteins comprising igg2 hinge domains
US9512229B2 (en) * 2015-03-03 2016-12-06 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GVHD
WO2016142768A1 (en) * 2015-03-10 2016-09-15 Eureka Therapeutics, Inc. Ror2 antibody
JP7628764B2 (ja) * 2015-09-29 2025-02-12 アムジエン・インコーポレーテツド Asgr阻害剤
WO2020192709A1 (en) * 2019-03-27 2020-10-01 Wuxi Biologics (Shanghai) Co., Ltd. Novel bispecific polypeptide complexes

Also Published As

Publication number Publication date
EP4351644A2 (en) 2024-04-17
TW202315890A (zh) 2023-04-16
BR112023025553A2 (pt) 2024-02-20
AU2022290257A1 (en) 2023-11-30
WO2022261079A3 (en) 2023-01-19
MX2023014695A (es) 2024-01-15
AU2022290257A9 (en) 2023-12-14
CA3218785A1 (en) 2022-12-15
EP4351644A4 (en) 2025-04-30
KR20240019224A (ko) 2024-02-14
IL309119A (en) 2024-02-01
US20240262922A1 (en) 2024-08-08
JP2024524880A (ja) 2024-07-09

Similar Documents

Publication Publication Date Title
US20250026850A1 (en) Anti-cd39 antibodies, compositions comprising anti-cd39 antibodies and methods of using anti-cd39 antibodies
KR102926972B1 (ko) Pd-l1 및 cd137에 결합하는 항체 분자
CN112424229B (zh) 结合cd137和ox40的抗体分子
KR102943539B1 (ko) 인터류킨-2 작용제 및 이의 용도
JP2022126847A (ja) Tigitに対する抗体
JP7489316B2 (ja) Pd-li抗原結合部位を有するfc結合断片
JP7588068B2 (ja) 抗hla-g抗体、抗hla-g抗体を含む組成物、および抗hla-g抗体を使用する方法
JP2019530434A (ja) アゴニスト活性を有する多価及び多重エピトープ抗体ならびに使用方法
KR20230008157A (ko) 항체 표적화 clec12a 및 이의 사용
US10988545B2 (en) Anti-GITR antigen-binding proteins and methods of use thereof
KR20230147072A (ko) 인터류킨-2 돌연변이체 및 이의 용도
WO2025054328A1 (en) Bispecific binding construct capable of binding to ackr4, compositions comprising a bispecific binding construct capable of binding to ackr4, and methods of using bispecific binding construct capable of binding to ackr4
US20240262922A1 (en) Proteins that bind cd80 and/or cd86, and ox40l
HK40111520A (zh) 结合cd80和/或cd86,以及ox40l的蛋白质
CN117794575A (zh) 结合cd80和/或cd86,以及ox40l的蛋白质
RU2826084C2 (ru) МОЛЕКУЛЫ АНТИТЕЛА, КОТОРЫЕ СВЯЗЫВАЮТ PD-L1 и CD137
RU2795625C2 (ru) Антигенсвязывающие белки против gitr и способы их применения
JP2024536716A (ja) PD-L1、CD137及び/又はTGFβへの二重特異性及び三重特異性結合タンパク質ならびにそれらの使用
HK40078517B (zh) 4-1bb和ox40结合蛋白及相关组合物和方法、抗-4-1bb抗体、抗-ox40抗体
HK40014601A (en) Anti-gitr antigen-binding proteins and methods of use thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 3218785

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2022290257

Country of ref document: AU

Ref document number: 805559

Country of ref document: NZ

Ref document number: AU2022290257

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2022290257

Country of ref document: AU

Date of ref document: 20220607

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 309119

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 202317083542

Country of ref document: IN

Ref document number: MX/A/2023/014695

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2023575897

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023025553

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 11202309000V

Country of ref document: SG

ENP Entry into the national phase

Ref document number: 20247000142

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020247000142

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2022820886

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2023135361

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2022820886

Country of ref document: EP

Effective date: 20240108

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22820886

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 202280055594.9

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023025553

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231205