WO2022240797A1 - Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders - Google Patents

Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders Download PDF

Info

Publication number
WO2022240797A1
WO2022240797A1 PCT/US2022/028454 US2022028454W WO2022240797A1 WO 2022240797 A1 WO2022240797 A1 WO 2022240797A1 US 2022028454 W US2022028454 W US 2022028454W WO 2022240797 A1 WO2022240797 A1 WO 2022240797A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
cell
car
subject
immunoresponsive cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/028454
Other languages
English (en)
French (fr)
Inventor
Juan C. JAUME
Shahnawaz Imam
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Toledo
Original Assignee
University of Toledo
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Toledo filed Critical University of Toledo
Priority to AU2022272620A priority Critical patent/AU2022272620A1/en
Priority to CA3218583A priority patent/CA3218583A1/en
Priority to CN202280046811.8A priority patent/CN117580594A/zh
Priority to EP22808155.0A priority patent/EP4340895A4/en
Priority to MX2023013487A priority patent/MX2023013487A/es
Priority to JP2023570380A priority patent/JP2024518826A/ja
Priority to KR1020237041987A priority patent/KR20240007197A/ko
Publication of WO2022240797A1 publication Critical patent/WO2022240797A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/22Immunosuppressive or immunotolerising
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/416Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4244Enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4254Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/12Antidiuretics, e.g. drugs for diabetes insipidus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • C12N5/0637Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg

Definitions

  • Tregs regulatory T cells
  • One approach to endow effector T cells with a desired antigen specificity uses chimeric T cell antigen receptors with antibody-type specificity.
  • Cellular therapies with antibody- type specific chimeric antigen receptor (CAR) -redirected cytotoxic T cells have shown efficacy in the treatment of hematologic malignancies.
  • the present disclosure relates to reagents, compositions and methods for modulating the activation of T cells, and for modulating immune responses, including but not limited to type 1 diabetes (T1D), autoimmune tolerance and transplantation tolerance.
  • T1D type 1 diabetes
  • autoimmune tolerance autoimmune tolerance
  • transplantation tolerance transplantation tolerance
  • the present disclosure describes using CAR technology to generate potent, functional, and stable, GAD65 antigen-specific CAR-Tregs that can prevent the development of autoimmune diabetes or T1D.
  • the subject is afflicted with an autoimmune disease, with host versus graft disease (HVGD), or the subject is an organ transplant recipient.
  • HVGD host versus graft disease
  • an immunoresponsive cell comprising a chimeric antigen receptor (CAR) that binds to glutamic acid decarboxylase 65 kDA (GAD65) in the cell; the CAR comprising a) an intracellular signaling domain of a CD3z polypeptide and an intracellular signaling domain of CD28 hinge-transmembrane-intracellular region, and b) an extracellular polypeptide comprising an amino acid sequence of either SEQ ID NO: 7 or SEQ ID NO: 8, or an amino acid sequence having at least 95% identity to either SEQ ID NO: 7 or SEQ ID NO: 8.
  • the extracellular polypeptide comprises SEQ ID NO: 7.
  • the extracellular polypeptide comprises SEQ ID NO: 8. In certain embodiments, the extracellular polypeptide consists of SEQ ID NO: 7. In certain embodiments, the extracellular polypeptide consists of SEQ ID NO: 8.
  • SEQ ID NO: 7 has the amino acid sequence of MDMRVPAQLLGLLLLWLPGAKCDIQLTQSPTFLSASVGDRVTITCRASQGISSYLAWYQQ KPGKAPNLLIYVASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNNYPLTFGG GTKVEIKRPPPPRPPPPPPPRQLQLQESGPGLLKPSETLSLTCSVSGGSIGSSSYSWGWIR QPPGKGLEYIGIIYHSGRTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAMYYCARQV P Y QPLLDGGNWFDPWGQGTLVTV S S .
  • SEQ ID NO: 8 has the amino acid sequence of MAWTVLLLGLLSHCTGSVTSYVLTHPPSVSVAPGKTGTITCGGSNIGSKSVHWYQQKPGQ APKLVIYYDSDRPSGIPERFSGSTSGNTATLTISSVEAGDEADYYCQVWDSSGDHMVVFFG GTKLTVLPPPPRPPPPPPPRQVQLVESGGGVVQPGRSLRLSCAASGLTFSHHGMHWVR QAPGKGLEWVAFISYDETKKYYVKSVMGRFTIARDNSKNTLYLHLKSLRPDDAAVYYCA KAFSTTIFG V VT Y GMD VW GQGTTVIV S S .
  • the immunoresponsive cell further comprises a spacer between the intracellular signaling domain of CD28 hinge-transmembrane-intracellular region and the extracellular polypeptide.
  • the spacer comprises glycine, serine, or threonine.
  • the intracellular signaling domain of CD28 hinge- transmembrane-intracellular region is linked to the spacer by a peptide bond.
  • the extracellular polypeptide is linked to the spacer by a peptide bond.
  • the O ⁇ 3z polypeptide is linked to the intracellular signaling domain of CD28 hinge- transmembrane-intracellular region by a peptide bond.
  • the extracellular polypeptide comprises SEQ ID NO: 7. In particular embodiments, the extracellular polypeptide comprises SEQ ID NO: 8. In particular embodiments, the extracellular polypeptide consists of SEQ ID NO: 7. In particular embodiments, the extracellular polypeptide consists of SEQ ID NO: 8.
  • the immunoresponsive cell is selected from the group consisting of: T cells, cytotoxic T cells, regulatory T cells, and combinations thereof.
  • the cell comprises a pancreatic beta cell-specific chimeric antigen receptor (CAR) regulatory T cell (Treg) that expresses at least one extracellular polypeptide and is capable of affecting Teff cells.
  • CAR pancreatic beta cell-specific chimeric antigen receptor
  • Teff cells pancreatic beta cell-specific chimeric antigen receptor regulatory T cell
  • the extracellular polypeptide enhances an immune response in a subject by binding specific antigens in a target cell.
  • the target cell is a cell in a subject that is affected by an autoimmune endocrinopathy, an organ- specific autoimmune disease, or an alloimmune transplant intolerance.
  • a pharmaceutical composition comprising an effective amount of an immunoresponsive cell as described herein and a pharmaceutically acceptable excipient.
  • the immunoresponsive cell is a T cell.
  • a kit for the prevention or therapeutic treatment of Type 1 diabetes (T1D) comprising: a) a pharmaceutical composition as described herein, and, b) instructions for use in the therapeutic treatment of T1D.
  • T1D type 1 diabetes
  • the method comprising administering to the subject an effective amount of an immunoresponsive cell described herein, thereby lengthening survival of the subject.
  • the subject is a human.
  • the immunoresponsive cell is selected from the group consisting of: T cells, cytotoxic T cells, regulatory T cells, and combinations thereof.
  • T1D type 1 diabetes
  • the method comprising administering to the subject an effective amount of an immunoresponsive cell described herein, thereby treating or preventing the T1D in the subject.
  • the subject is a human.
  • the immunoresponsive cell is selected from the group consisting of: T cells, cytotoxic T cells, regulatory T cells, and combinations thereof.
  • an immunoresponsive cell having a chimeric antigen receptor (CAR) that binds to glutamic acid decarboxylase 65 kDA (GAD65) in the cell.
  • CAR chimeric antigen receptor
  • the CAR comprises: a) an intracellular signaling domain of a CD3z polypeptide and an intracellular signaling domain of CD28 hinge-transmembrane-intracellular region, and b) an extracellular polypeptide recognizing: at least a part of an amino acid sequence selected from the amino acids having SEQ ID Nos: 1-6; or, at least one complete amino acid sequence selected the amino acids having SEQ ID Nos: 1-6
  • the immunoresponsive cell is selected from the group consisting of: T cells, cytotoxic T cells, regulatory T cells, and combinations thereof.
  • the cell comprises a pancreatic beta cell-specific chimeric antigen receptor (CAR) regulatory T cell (Treg) that expresses at least one extracellular polypeptide and is capable of affecting Teff cells.
  • CAR pancreatic beta cell-specific chimeric antigen receptor
  • the extracellular polypeptide is a GAD65 MAb antigen binding domain which recognizes at least a part of an amino acid sequence selected from the amino acids having SEQ ID Nos: 1-6; or, at least one complete amino acid sequence selected the amino acids having SEQ ID Nos: 1-6.
  • composition comprising an effective amount of an immunoresponsive cell described herein and a pharmaceutically acceptable excipient.
  • kits for the prevention or therapeutic treatment of Type 1 diabetes comprising: a) the pharmaceutical composition described herein; and, b) instructions for use in the therapeutic treatment of T1D.
  • T1D type 1 diabetes
  • T1D type 1 diabetes
  • the subject is a human.
  • an immunoresponsive cell for treating an autoimmune endocrinopathy having a chimeric antigen receptor (CAR) that binds to at least one antigen.
  • the CAR includes: a) an intracellular signaling domain, and b) an extracellular polypeptide comprising an antigen binding region MAb which recognizes an amino acid sequence of the at least one antigen.
  • the autoimmune endocrinopathy and the antigen can be selected as described herein.
  • a method of treating or preventing an autoimmune endocrinopathy in a subject comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby treating or preventing the autoimmune endocrinopathy in the subject.
  • a method of lengthening survival of a subject having an autoimmune endocrinopathy comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby lengthening survival of the subject.
  • an immunoresponsive cell for treating an organ- specific autoimmune disease having a chimeric antigen receptor (CAR) that binds to at least one antigen.
  • the CAR includes: a) an intracellular signaling domain, and b) an extracellular polypeptide comprising an antigen binding region MAb which recognizes an amino acid sequence of the at least one antigen.
  • the organ-specific autoimmune disease and the antigen can be selected as described herein.
  • a method of treating or preventing an organ-specific autoimmune disease in a subject comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby treating or preventing the organ-specific autoimmune disease in the subject.
  • a method of lengthening survival of a subject having an organ-specific autoimmune disease comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby lengthening survival of the subject.
  • an immunoresponsive cell for treating an alloimmune transplant intolerance having a chimeric antigen receptor (CAR) that binds to at least one antigen.
  • the CAR includes: a) an intracellular signaling domain, and b) an extracellular polypeptide comprising an antigen binding region MAb which recognizes an amino acid sequence of the at least one antigen.
  • the alloimmune transplant and the antigen can be selected as described herein.
  • a method of treating or preventing an alloimmune transplant intolerance in a subject comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby treating or preventing the alloimmune transplant intolerance in the subject.
  • a method of lengthening survival of a subject having an alloimmune transplant intolerance comprising: administering, to the subject, an effective amount of the immunoresponsive cell, thereby lengthening survival of the subject.
  • the MAb variable region of the CAR enhances an immune response in a subject by binding specific antigens in a target cell.
  • the target cell is a cell in a subject that is affected by the autoimmune endocrinopathy, the organ-specific autoimmune disease, or the alloimmune transplant intolerance.
  • FIG. 1A CAR-Treg design scheme.
  • FIG. IB Schematic illustration of down-regulation of Teffs.
  • FIG. 3 Flow cytometry tracking of GFP-GAD65 CAR-Treg cells in Blood
  • PPN Pancreatic Lymph Nodes
  • PN Pancreas
  • Spleen Single cells were acquired using Flow Cytometer (BD FACSCANTO) for detecting GFP in FITC channel.
  • Spontaneous humanized mouse model was infused with 5 million GFP-GAD65 CAR-Treg cells (co-expressing Green Fluorescent Protein (GFP), 24 hrs before sacrifice).
  • GFP Green Fluorescent Protein
  • FIGS. 5A-5E Flow Cytometry. Immune cell profiling of different CAR-Tregs and normal Treg cells treated animals.
  • FIG. 6 Glucose tolerance test (GTT) readings after one month of CAR-M Treg/CAR- N Treg/Normal Treg/Non islet specific CAR-Treg (EPCAM) treatment. 30-day follow up GTT. Glucose tolerances significantly improved in GAD65 specific CAR Treg treated groups as compared to Normal Treg and non-specific EPCAM (control CAR-Treg) group. Normal Treg treatment shows no difference when compared to non-islet specific EPCAM (control CAR-Treg) group. .
  • FIG. 7C Percent Treg proliferation.
  • FIG. 7D Percent Tresp proliferation.
  • FIG. 7E Table of summarized data of in vitro suppression assay at different ratios of Tresp and CAR-Treg, and their proliferative/replicative index from FIGS. 7C-7D.
  • FIGS. 8A-8B Analysis of in vivo proliferation assay: EPCAM specific CAR-Tregs cells (FIG. 8A) and GAD65 specific CAR-Tregs cells (FIG. 8B).
  • FIGS. 8C-8D Analysis of an in vitro proliferation assay: Treg cells (FIG. 8C) and CAR-Treg cells (FIG. 8D).
  • administering refers to the placement of an agent into a subject by a method or route which results in at least partial localization of such agents at a desired site, such as a site of inflammation or tumor, such that a desired effect(s) is produced.
  • modulating or “modulate” generally means either reducing or inhibiting the expression and/or activity of, or alternatively increasing the expression and/activity of, a target molecule, e.g., as measured using a suitable in vitro, cellular, or in vivo assay.
  • modulating can mean either reducing or inhibiting the expression and/or activity of, or alternatively increasing a (relevant or intended) biological activity and or expression of, a target molecule, as measured using a suitable in vitro, cellular or in vivo assay (which will usually depend on the target involved), by at least 5%, at least 10%, at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or more, inclusive, compared to activity of the target in the same assay under the same conditions but without the presence of an agent.
  • the term “modulating” can refer to an increase or decrease in the expression and/or activity relative to a subject not treated with an agent that modulates the expression and/or activity.
  • an “increase” or “decrease” refers to a statistically significant increase or decrease respectively.
  • an increase or decrease will be at least 10% relative to a reference, such as at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, or more, up to and including at least 100% or more, inclusive, in the case of an increase, for example, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 50-fold, at least 100-fold, or more.
  • composition as used herein is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product that results, directly or indirectly, from combinations of the specified ingredients in the specified amounts.
  • composition/method/kit By “comprising” it is meant that the recited elements are required in the composition/method/kit, but other elements may be included to form the composition/method/kit etc. within the scope of the claim.
  • treatment means obtaining a desired pharmacologic and/or physiologic effect.
  • the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease.
  • Treatment covers any treatment of a disease in a mammal, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; or (c) relieving the disease, i.e., causing regression of the disease.
  • the therapeutic agent may be administered before, during or after the onset of disease or injury.
  • the treatment of ongoing disease, where the treatment stabilizes or reduces the undesirable clinical symptoms of the patient, is of particular interest. Such treatment is desirably performed prior to complete loss of function in the affected tissues.
  • the subject therapy may be administered during the symptomatic stage of the disease, and in some cases after the symptomatic stage of the disease.
  • a “therapeutically effective amount” is intended for an amount of active agent which is necessary to impart therapeutic benefit to a subject.
  • a “therapeutically effective amount” is an amount which induces, ameliorates or otherwise causes an improvement in the pathological symptoms, disease progression or physiological conditions associated with a disease or which improves resistance to a disorder.
  • genetic modification means any process that adds, deletes, alters, or disrupts an endogenous nucleotide sequence and includes, but is not limited to viral mediated gene transfer, liposome mediated transfer, CRISPER CAS9 mediated gene transformation, transfection and transduction.
  • the term “antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab')2, and Fab. F(ab')2, and Fab fragments that lack the Fe fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody.
  • the antibodies can whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
  • antigen recognizing receptor refers to a receptor that is capable of activating an immune cell (e.g., a T-cell) in response to antigen binding.
  • exemplary antigen recognizing receptors may be native or endogenous T cell receptors or chimeric antigen receptors in which an antigen-binding domain is fused to an intracellular signaling domain capable of activating an immune cell (e.g., a T-cell).
  • chimeric antigen receptor refers to an antigen binding domain that is fused to an intracellular signaling domain capable of activating or stimulating an immune cell.
  • the CAR's extracellular binding domain is composed of a single chain variable fragment (scFv) derived from fusing the variable heavy and light regions of a murine or humanized monoclonal antibody.
  • scFvs may be used that are derived from Fab's (instead of from an antibody, e.g., obtained from Fab libraries).
  • this scFv is fused to a transmembrane domain and then to an intracellular signaling domain.
  • First-generation CARs include those that solely provide CD3z signals upon antigen binding
  • second-generation CARs include those that provide both costimulation (e.g. CD28 or CD137) and activation (0O3z).
  • second-generation CARs include those that provide multiple costimulation (e.g. CD28 and CD 137) and activation (CD3).
  • the CAR is selected to have high affinity or avidity for the antigen.
  • single-chain variable fragment or "scFv” is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an immunoglobulin covalently linked to form a VH::VL heterodimer.
  • the heavy (VH) and light chains (VL) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N-terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N- terminus of the VL.
  • the linker/ spacer can be glycine for flexibility, as well as serine or threonine for solubility. Despite removal of the constant regions and the introduction of a linker, scLv proteins retain the specificity of the original immunoglobulin.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
  • a reference amino acid sequence for example, any one of the amino acid sequences described herein
  • nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
  • sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.
  • BLAST Altschul et al.
  • BESTFIT Altschul et al.
  • GAP Garnier et al.
  • PILEUP/PRETTYBOX programs Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
  • exogenous is meant a nucleic acid molecule or polypeptide that is not endogenously present in the cell, or not present at a level sufficient to achieve the functional effects obtained when over-expressed.
  • exogenous would therefore encompass any recombinant nucleic acid molecule or polypeptide expressed in a cell, such as foreign, heterologous, and over-expressed nucleic acid molecules and polypeptides.
  • nucleic acid molecule or polypeptide a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell.
  • This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
  • immunoresponsive cell is meant a cell that functions in an immune response or a progenitor, or progeny thereof.
  • alteration is meant to alter positively by at least 5%.
  • An alteration may be by 5%, 10%, 25%, 30%, 50%, 75%, or even by 100%.
  • isolated cell is meant a cell that is separated from the molecular and or cellular components that naturally accompany the cell.
  • isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
  • a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated.
  • Such polynucleotides could be part of a vector and or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of its natural environment.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials like endotoxin free such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • Linker or “spacer”, as used herein, shall mean a functional group (e.g., chemical or polypeptide) that covalently attaches two or more polypeptides or nucleic acids so that they are connected to one another.
  • a “peptide linker” refers to one or more amino acids used to couple two proteins together (e.g., to couple VH and VL domains).
  • Variant refers to polypeptides having amino acid sequences that differ to some extent from a native sequence polypeptide. Ordinarily, amino acid sequence variants will possess at least about 80% sequence identity, more preferably, at least about 90% homologous by sequence. The amino acid sequence variants may possess substitutions, deletions, and/or insertions at certain positions within the reference amino acid sequence.
  • a “variant" of a protein of interest refers to an amino acid sequence that is altered by one or more amino acids.
  • the variant may have "conservative” changes, wherein a substituted amino acid has similar structural or chemical properties, (e.g., replacement of leucine with isoleucine). More rarely, a variant may have "nonconservative” changes (e.g., replacement of a glycine with a tryptophan). Similar minor variations may also include amino acid deletions or insertions, or both.
  • Guidance in determining which amino acid residues may be substituted, inserted, or deleted without abolishing biological or immunological activity may be found using computer programs well known in the art, for example, DNASTAR software.
  • graft refers to organs and or tissues which can be obtained from a first mammal (or donor) and transplanted into a second mammal (a recipient), preferably a human.
  • the term "graft” encompasses, for example, skin, organs such as heart, lung, heart-lung (e.g., heart and a single lung, heart and both lungs), liver, kidney, pancreas (e.g., islet cells, b- cells), parathyroid, bowel (e.g., colon, small intestine, duodenum).
  • a graft can be obtained from a suitable mammal (e.g., human, pig, baboon, chimpanzee), or under certain circumstances a graft can be produced in vitro by culturing cells which were obtained from a suitable mammal.
  • a graft is preferably obtained from a human.
  • the term "subject” denotes a mammal, such as canines; felines; equines; bovines; ovines; etc. and primates, particularly humans. Animal models, particularly small mammals, e.g. murine, etc. can be used for experimental investigations. Preferably a subject is a human.
  • Non-immunogenic refers to a material that does not initiate, provoke or enhance an immune response where the immune response includes the adaptive and/or innate immune responses.
  • the term "gene” means the segment of DNA involved in producing a polypeptide chain; it includes regions preceding and following the coding region “leader and trailer” as well as intervening sequences (introns) between individual coding segments (exons). Some genes may be developed which lack, in whole or in part, introns. Some leader sequences may enhance translation of the nucleic acid into polypeptides.
  • nucleic acid refers to polynucleotides such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA).
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • the term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single (sense or antisense) and double-stranded polynucleotides.
  • polypeptide and "protein” are used interchangeably herein.
  • preventing is art-recognized, and when used in relation to a condition, is well understood in the art, and includes administering, prior to onset of the condition, a composition that reduces the frequency of, reduces the severity of, or delays the onset of symptoms of a medical condition in a subject relative to a subject which does not receive the composition.
  • type 1 diabetes comprises one or more of type 1 diabetes, insulin- dependent diabetes mellitus, idiopathic diabetes, juvenile type 1 diabetes, latent autoimmune diabetes in adults.
  • Conditions relating to type 1 diabetes include, neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, and/or retinopathy; kidney complications: diabetic nephropathy.
  • Prevention of an infection includes, for example, reducing the number of diagnoses of the infection in a treated population versus an untreated /control population, and/or delaying the onset of symptoms of the infection in a treated population versus an untreated control population.
  • the immunoresponsive cell includes a chimeric antigen receptor (CAR) having an extracellular polypeptide that recognizes an epitope of a recognition domain.
  • the extracellular polypeptide is a MAb (monoclonal antibody) Variable region.
  • the extracellular peptide GAD65 MAb is the part of the CAR that recognizes at least a part of an amino acid sequence (epitope) of one of SEQ ID Nos: 1-6.
  • the term “extracellular” is used herein to differentiate from intracellular ⁇ 3z and CD28, as shown in FIG. 1A).
  • the GAD65 MAb Variable region is the extracellular recombinant polypeptide expressed by the immunoresponsive (Treg) cells.
  • the extracellular polypeptide (GAD65 MAb Variable region of CAR) is a GAD65 antigen binding domain which recognizes at least a part of one amino acid sequence selected from one of SEQ ID NOs: 1-6.
  • the extracellular polypeptide has the sequence of MDMRVPAQLLGLLLLWLPGAKCDIQLTQSPTFLSASVGDRVTITCRASQGISSYLAWYQQ KPGKAPNLLIYVASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNNYPLTFGG GTKVEIKRPPPPRPPPPPRQFQFQESGPGFFKPSETFSFTCSVSGGSIGSSSYSWGWIR QPPGKGLEYIGIIYHSGRTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAMYYCARQV P Y QPLLDGGNWFDPWGQGTLVTV S S (SEQ ID NO: 7).
  • the CAR-Treg may be referred to as CAR-N.
  • the extracellular polypeptide has the sequence of
  • the CAR- Treg may be referred as CAR-M.
  • the MAb Variable region of any CAR (including GAD65 CAR) of immunoresponsive cells will be activated (enhanced immune response) by binding specific antigens (either GAD65 or any of the desired antigens for other autoimmune diseases and solid organ transplant rejection)
  • the GAD65 CAR-Treg cell is basically made of a Treg cell (for example, isolated from the peripheral blood of the subject) and a construct (CAR) that recognizes a specific antigen via a MAb variable region.
  • the CAR components include intracellular (O ⁇ 3z and CD28), spacer, and extracellular (MAb variable region) components.
  • the expression of the CAR follows the pathway of expression of any cellular protein (DNA->RNA- >Protein).
  • the different components polypeptides E ⁇ 3z, CD8, spacer, and MAb variable region are linked together by peptide bonds.
  • the MAb variable regions that recognize GAD65 epitopes are assembled together with the other components (CD3 z, CD8, spacer).
  • selected autoantigens are used to create CAR-Tregs to treat autoimmune diseases and solid organ transplant rejection.
  • Non-limiting examples of such antigens for which humans make antibodies against are listed in Tables 1-3 below.
  • the epitopes of those antigens are selected (as like in GAD65) in order to create epitope- specific CAR-Tregs.
  • an isolated soluble paratope polypeptide, or fragment or variant or homolog or a fusion protein or conjugate containing same or a polypeptide comprising the extracellular domain of any one of amino acids binding SEQ ID Nos. 1-6, or fragments or variants or homologs thereof or a fusion protein or conjugate containing same, or a pharmaceutical composition containing any of the foregoing, adapted for treatment of immune related disorder including T1D.
  • the paratope polypeptide comprises a sequence of amino acid residues having at least 95% sequence identity with amino acid residues binding to any of SEQ ID NOs: 1- 6, or a fragment, or a variant, or a homolog thereof, adapted for treatment.
  • the polypeptide is attached to a detectable or therapeutic moiety.
  • the paratope polypeptide comprises the sequence of
  • paratope polypeptide comprises the sequence of
  • a method for preventing and/or treating immune related disorder comprising administering to a subject in need thereof a pharmaceutical composition comprising a paratope polypeptide binding amino acid residues depicted in any of SEQ ID NOs 1-6, or a fragment or a variant or a homolog thereof, optionally provided as a pharmaceutical composition thereof.
  • a method for preventing and/or treating immune related disorder comprising administering to a subject in need thereof a pharmaceutical composition comprising a paratope polypeptide having the amino acid sequence of either SEQ ID No. 7 or SEQ ID No. 8, or a fragment or a variant or a homolog thereof, optionally provided as a pharmaceutical composition thereof.
  • treating comprises one or more of curing, managing, reversing, attenuating, alleviating, minimizing, suppressing, managing, or halting the deleterious effects of the above-described diseases.
  • the Tregs that have been modified with the desired construct(s) are grown in culture under selective conditions and cells that are selected as having the construct may be expanded and further analyzed, using, for example; the polymerase chain reaction/western blot for determining the presence of the construct in the host cells. Once the modified host cells have been identified, they may then be used as planned, e.g., expanded in culture or introduced into a host organism.
  • the cells may be introduced into a host organism, e.g., a mammal, including humans, in a wide variety of ways.
  • the cells may be introduced at the site of the inflammatory lesion.
  • various aspects of the present embodiments provide for methods and compositions for treatment of immune -related diseases or disorders and/or therapy monitoring.
  • the methods and compositions described herein are directed to treatment and/or therapy monitoring of Type 1 diabetes (T1D).
  • T1D Type 1 diabetes
  • the methods and compositions described herein are directed to treatment and/or therapy monitoring of autoimmune diseases and/or transplant rejections.
  • the subject is a recipient of an allogenic transplant.
  • the transplant can be any organ or tissue transplant, including but not limited to pancreas, kidney, heart, lung, liver, intestine, bone, cartilage or skin.
  • Transplantation tolerance refers to a lack of rejection of the donor organ by the recipient's immune system.
  • the agents can be used for preventing or reducing the likelihood of being afflicted with rejection of tissue or cell transplants.
  • Table 1 below provides non-limiting examples useful antigens for specific autoimmune endocrinopathy.
  • Table 2 below provides non-limiting examples useful antigens for various organ-specific autoimmune diseases.
  • Table 3 below provides non-limiting examples useful antigens for various allogenic transplanted organs.
  • Table 5 below provides non-limiting examples of amino acid sequences of useful GAD65 epitope recognizing paratopes for the extracellular polypeptides of the CAR-Tregs described herein.
  • one or more of the CAR GAD65 epitope recognizing paratopes may be comprised in a vector, which may be the same vector (bicistronic) or separate vectors.
  • the amino acid encoding the CAR GAD65 paratopes may each be operably linked to a promoter which may be the same or different promoters.
  • one or more may be comprised in a vector, which may be the same vector (bicistronic) or separate vectors.
  • the CAR GAD65 paratopes may each be operably linked to a promoter which may be the same or different promoters.
  • CAR-N N- terminal
  • CAR-M Middle
  • T cell receptors CD28 hinge-transmembrane-intracellular regions and CD3z intracellular domain
  • GAD65 CAR-Tregs were used to prevent/treat diabetes in a humanized mouse model of T1D.
  • FIG. 1A provides a CAR Treg design scheme.
  • FIG. IB schematically illustrates that, in order to down-regulate Teffs, antigen-specific regulatory T cells, (CAR-Tregs) need to be abundantly present and in close proximity of beta cells. Once CAR-Tregs are activated against GAD65, the CAR-Tregs silence nearby Teffs cells and rescue the pancreatic islet beta cells.
  • CAR-Tregs antigen-specific regulatory T cells
  • FIG. 2 shows the characteristics of a humanized mouse model of T1D.
  • the top panel of FIG. 2 is a comparison between of human and mouse model genetic predisposition and target antigen availability.
  • the bottom panel of FIG. 2 is the confocal microscopy of humanized T1D mouse pancreatic frozen sections (8 pm).
  • Red insulin
  • Blue GAD65
  • Green HLA- DQ8.
  • Left picture shows pancreatic islet.
  • GAD65 is present in and around insular area, but also is in close contact with APCs (HLA-DQ8).
  • APCs HLA-DQ8
  • the right pictures show progressively higher magnification (from right to left) of T1D mice peri-islet area.
  • White arrows indicate GAD65 (beta cells) and APC HLA-DQ8 interaction.
  • FIG. 3 shows the flow cytometry tracking of GFP-GAD65 CAR-Treg cells in Blood, Pancreatic Lymph Nodes (PLN), Pancreas (PN), and Spleen. Single cells were acquired using Flow Cytometer (BD FACSCANTO) for detecting GFP in FITC channel. Spontaneous humanized mouse model was infused with 5 million GFP-GAD65 CAR-Treg cells (co-expressing Green Fluorescent Protein (GFP), 24 hrs before sacrifice).
  • GFP Green Fluorescent Protein
  • FIG. 4 shows 3D iDISCO and the morphology of pancreatic islets and localization of GFP-GAD65 CAR-Treg cells.
  • Humanized mice (T1D model) were injected with CAR-Treg cells (expressing Green Fluorescent Protein, GFP) and euthanized 24 hours after.
  • CAR-Treg cells expressing Green Fluorescent Protein, GFP
  • FIG. 4 From top to bottom (three different magnifications of pancreas 100X, 10X and 4X): Islets were individually recorded at 3 different locations (lower panel, 4X magnification). [00140] In FIG. 4, from left to right (stains):
  • FIGS. 5A-5E contain a series of graphs showing flow cytometry of immune cells.
  • Immune cell profiling of different CAR-Tregs and control cells treated animals Autologous Tregs were isolated from spleen and amplified in vitro using IL-2 (2000 ng/ml). Autologous, amplified Tregs were then transduced with CAR-M and CAR-N Treg constructs. Treg expression of CAR- M/N constructs was confirmed by PCR and western blot.
  • Humanized mice (T1D model) were treated with 5 million GAD65 specific CAR-M Treg/CAR-N Treg cells, Normal Treg cells, and EPCAM (control CAR-Treg cells). The mice were euthanized after 30 days post-treatment. Pancreas (PN), Pancreatic Lymph Nodes (PLN), and Spleens were processed into single cell suspensions.
  • FIG 5A shows Treg cell population at Pancreatic Lymph nodes (PLN), Pancreas (PN), and Spleens 30 days post-treatment with either Normal Treg, EPCAM (control CAR-Treg), or GAD65 CAR-M or CAR-N Treg cells.
  • Statistical significance was determined at P ⁇ 0.05.
  • FIG. 5B shows T helper (Thl) cell population at Pancreatic Lymph Nodes (PLN), Pancreas (PN), and Spleens 30 days post-infusion. Statistical significance (* and **) was determined at P ⁇ 0.05.
  • FIG. 5C shows T helper (Thl7) cell population at Pancreatic Lymph Nodes (PLN), Pancreas (PN), and Spleens 30 days post-infusion. Statistical significance (* and **) was determined at P ⁇ 0.05.
  • FIG. 5D shows interferon gamma (IFNg) producing T cells (CD3) cell population at Pancreatic Lymph Nodes (PLN), Pancreas (PN), and Spleens 30 days post-infusion. Statistical significance (* and **) was determined at P ⁇ 0.05.
  • IFNg interferon gamma
  • FIG. 5E shows interferon gamma (IFNg) producing CD8 T cell (CTLs) population at Pancreatic Lymph Nodes (PLN), Pancreas (PN), and Spleens 30 days post-infusion. Statistical significance (* and **) was determined at P ⁇ 0.05.
  • FIG. 6 shows glucose tolerance test (GTT) readings after one month of CAR-M Treg/CAR-N Treg/Normal Treg/EPCAM (control CAR-Treg) treatment. 30-day follow up GTT : Glucose tolerances significantly improved in GAD65 specific CAR Treg treated group as compared to Normal Treg and non-specific EPCAM (control CAR-Treg) group. Normal Treg treatment shows no difference when compared to EPCAM (control CAR-Treg).
  • FIG. 7A Treg. (CD4 + CD25 + );
  • FIG. 7B CAR-Treg (CD25 + ).
  • Flow cytometry analysis of an in vitro suppression assay Naive CD4 T cells used as responder T cells (Tresp CD4 + CD25 ) and GAD65 CAR-Treg cells (CD25 + ) were co-cultured in different ratios (Table in FIG. 7C) with recombinant hGAD65 antigen (4 pg/ml).
  • CD4 and CD25 antibodies were immunofluorescently stained with CD4 and CD25 antibodies. Lymphocytes were gated according to FSC and SSC. CD4 T cells were gated according to CD4 (y-axis) and FSC (x-axis). CAR- Treg cells (CD25 + ) were distinguished from the CD4 + CD25 Tresp cells according to CD25 (y- axis). Both cell populations were incubated in CellTrace (CFSE-FITC, x-axis). Histogram plots show proliferation index/replication index as analyzed by using FLOW JO_V10 proliferation assay software.
  • FIG. 7C is a summarized data of in vitro suppression assay.
  • Tresp cells CD4 + CD25 ⁇ isolated from mouse spleen by using CD4 T Cell Isolation Kit
  • GAD65 specific CAR-Treg cells CD25 +
  • the suppressive/proliferative capacity of the cells was determined by analyzing the proliferation of GAD65 CAR-Treg and Tresp cells under different co-culture ratios.
  • FIG. 7D shows a table of summarized data of proliferative /replicative index in vitro suppression/proliferation assay at different ratios of Tresp and CAR-Treg, as depicted in FIGS. 7A-7B.
  • FIGS. 8A-8B show an analysis of in vivo proliferation assay: EPCAM specific CAR- Tregs cells and GAD65 specific CAR-Tregs cells co-expressing green fluorescent protein (GFP) were infused into the humanized T1D mice. Mice were sacrificed after 48 hrs. CAR-Tregs (EPCAM and GAD65) were isolated on the basis of GFP co-expression. Both cell populations were incubated in (Cell Proliferation Dye eFluor 670). These cells were analyzed in BD Canto flow cytometry, lymphocytes were gated according to FSC and SSC. CAR-Treg cells were further gated on the basis of CD25 +ve cells (y-axis) and cell proliferation dye eFluor 670 (x-axis).
  • GFP green fluorescent protein
  • FIGS. 8C-8D show an analysis of an in vitro proliferation assay: Normal Treg cells (FIG. 8C) and GAD65 CAR-Treg cells (FIG. 8D) proliferated under high concentration of IL-2 (2000 ng/ml) and recombinant hGAD65 (4 pg/ml). Lymphocytes were gated according to FSC and SSC. Treg cells (CD25 +ve) were distinguished from the CD25 -ve cells (y-axis). Both cell populations were incubated in CellTrace (CFSE-FITC, x-axis).
  • CFSE-FITC CellTrace
  • antigen-specific Treg re-direction and expansion using antigen-specific CAR- Tregs and consequent Teff downregulation allows for recovery and reconstitution of beta cells and would behave similarly in humans as well.
  • Teff includes: CD4, T helper 1, T helper 17, CD8, and cytotoxic lymphocytes (CTLs).
  • CTLs cytotoxic lymphocytes
  • the subject has been diagnosed with T1D or IDDM, or pre- IDDM or pre-TID.
  • T1D or IDDM or pre- IDDM or pre-TID.
  • One of skill in the art can determine the patients who would potentially benefit from a therapeutic agent that would reduce or prevent the development of overt diabetes.
  • One of skill in the art can determine the therapeutically effective amount of the composition to be administered to a subject based upon several considerations, such as local effects, pharmacodynamics, absorption, metabolism, method of delivery, age, weight, disease severity, and response to the therapy.
  • An improvement in diabetic parameters may be any observable or measurable improvement.
  • a treatment may improve the patient or subject's condition, but may not be a complete cure of the disease.
  • the composition is administered in an effective amount to decrease, reduce, inhibit, or abrogate levels of immune responses against the host’s tissues and or the donor’s organs rejections.
  • Efficacy may be monitored in a patient during treatment, e.g., by monitoring weight, where weight gain of at least about 5%, at least about 10%, at least about 15% or more can indicate successful treatment.
  • Measurement of insulin is another relevant marker for monitoring efficacy, where an increase in value may be at least about 10%, at least about 25%, or at least about 50% or more with successful therapy.
  • the engineered Treg composition is administered in an effective amount to decrease, reduce, inhibit, or abrogate inflammation and toxicity.
  • the composition is given in a single dose or multiple doses.
  • the single dose may be administered daily, or multiple times a day, or multiple times a week, or monthly or multiple times a month, or once in a month/year.
  • a series of doses may be administered daily, or multiple times a day, weekly, or multiple times a week, or monthly, or multiple times a month.
  • the improvement is any observable or measurable improvement.
  • a treatment may improve the patient or subject's condition, but may not be a complete cure of the disease.
  • the composition is administered in an effective amount to decrease, reduce, inhibit, or abrogate levels of an immune response of the recipient.
  • the composition of the present invention may precede, be co-current with, and/or follow the other agent(s) by intervals ranging from minutes to weeks.
  • compositions and other agent(s) are applied separately to a cell, tissue or organism, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the composition and agent(s) would still be able to exert an advantageously combined effect on the cell, tissue, or organism.
  • compositions and one or more agents may be employed.
  • One of skill in the art is aware that the composition of the present disclosure and agents can be administered in any order or combination.
  • compositions comprising genetically modified immunoresponsive cells described herein can be provided systemically or directly to a subject for the treatment of autoimmune disorders or diseases.
  • such cells are directly injected into an organ of interest (e.g., transplanted organ, organ affected by autoimmune disorder, etc.).
  • compositions comprising genetically modified immunoresponsive cells are provided indirectly to the organ of interest, for example, by administration into the circulatory system (e.g., the vasculature).
  • Expansion and differentiation agents can be provided prior to, during or after administration of the cells to increase production of cells in vitro or in vivo.
  • the modified cells can be administered in any physiologically acceptable vehicle, normally intravascularly, although they may also be introduced into bone or other convenient site where the cells may find an appropriate site for regeneration and differentiation (e.g., thymus).
  • genetically modified immunoresponsive cells can comprise a purified population of cells. Those skilled in the art can readily determine the percentage of genetically modified immunoresponsive cells in a population using various well-known methods, such as fluorescence activated cell sorting (FACS).
  • FACS fluorescence activated cell sorting
  • Preferable ranges of purity in populations comprising genetically modified immunoresponsive cells are about 50% to about 55%, about 55% to about 60%, and about 65% to about 70%. More preferably the purity is about 70% to about 75%, about 75% to about 80%, about 80% to about 85%; and still more preferably the purity is about 85% to about 90%, about 90% to about 95%, and about 95% to about 100%.
  • Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage).
  • the cells can be introduced by injection, catheter, or the like.
  • factors can also be included, including, but not limited to, interleukins, e.g., IL-2, IL-3, IL-6, IL-10, IL12, IL13, IL21, IL1S, as well as the other interleukins, the colony stimulating factors, such as G-, M- and GM-CSF, interferons, e.g., g-interferon and erythropoietin.
  • interleukins e.g., IL-2, IL-3, IL-6, IL-10, IL12, IL13, IL21, IL1S, as well as the other interleukins
  • the colony stimulating factors such as G-, M- and GM-CSF
  • interferons e.g., g-interferon and erythropoietin.
  • compositions of the present disclosure include pharmaceutical compositions comprising genetically modified immunoresponsive cells or their progenitors and a pharmaceutically acceptable carrier.
  • Administration can be autologous or heterologous.
  • immunoresponsive cells, or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
  • Peripheral blood derived immunoresponsive cells of the present disclosure or their progeny e.g., in vivo, ex vivo, or in vitro derived
  • can be administered via localized injection including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration.
  • a therapeutic composition e.g., a pharmaceutical composition containing genetically modified immunoresponsive cells
  • it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
  • compositions of the present disclosure comprise an effective amount of a compound disclosed herein, and/or additional agents, dissolved or dispersed in a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable refers to molecular entities and compositions that produce no adverse, allergic, or other untoward reaction when administered to an animal, such as, for example, a human.
  • the preparation of a pharmaceutical composition that contains at least one compound or additional active ingredient will be known to those of skill in the art in light of the present disclosure, as exemplified by Remington’s Pharmaceutical Sciences, 2003, incorporated herein by reference.
  • preparations should meet sterility, pyrogenicity, general safety, and purity standards as required by FDA Office of Biological Standards.
  • compositions disclosed herein may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it need to be sterile for such routes of administration as injection.
  • Compositions disclosed herein can be administered intravenously, intradermally, transdermally, intrathecally, intraarterially, intraperitoneally, intranasally, intravaginally, intrarectally, intraosseously, periprosthetically, topically, intramuscularly, subcutaneously, mucosally, intraosseosly, periprosthetically, in utero, orally, topically, locally, via inhalation (e.g., aerosol inhalation), by injection, by infusion, by continuous infusion, by localized perfusion bathing target cells directly, via a catheter, via a lavage, in cremes, in lipid compositions (e.g., liposomes), or by other method or any combination of the forgoing as would be known to one of ordinary skill in the art (see, for example,
  • the actual dosage amount of a composition disclosed herein administered to an animal or human patient can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient, and on the route of administration. Depending upon the dosage and the route of administration, the number of administrations of a preferred dosage and/or an effective amount may vary according to the response of the subject. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
  • compositions may comprise, for example, at least about 0.1% of an active compound (e.g., cell mixture).
  • an active compound may comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein.
  • the amount of active compound(s) in each therapeutically useful composition may be prepared is such a way that a suitable dosage will be obtained in any given unit dose of the compound.
  • a dose may also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 micro gram/kg/body weight, about 50 micro gram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 micro gram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein.
  • a range of about 5 mg/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight, etc. can be administered, based on the numbers described above.
  • a composition herein and/or additional agent is formulated to be administered via an alimentary route.
  • Alimentary routes include all possible routes of administration in which the composition is in direct contact with the alimentary tract.
  • the pharmaceutical compositions disclosed herein may be administered orally, buccally, rectally, or sublingually.
  • compositions described herein may be administered via a parenteral route.
  • parenteral includes routes that bypass the alimentary tract.
  • the pharmaceutical compositions disclosed herein may be administered, for example but not limited to, intravenously, intradermally, intramuscularly, intraarterially, intrathecally, subcutaneous, or intraperitoneally (U.S. Patents 6,753,514, 6,613,308, 5,466,468, 5,543,158; 5,641,515; and 5,399,363 are each specifically incorporated herein by reference in their entirety).
  • compositions disclosed herein may be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose.
  • Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof, and in oils. Under ordinary conditions of storage and use, these preparations may contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions (U.S. Patent 5,466,468, specifically incorporated herein by reference in its entirety).
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (i.e., glycerol, propylene glycol, liquid polyethylene glycol, and the like), suitable mixtures thereof, and or vegetable oils.
  • a coating such as lecithin
  • surfactants for example, water, alcohol, glycol, glycerol, propylene glycol, liquid polyethylene glycol, and the like
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, such as, but not limited to, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • various antibacterial and antifungal agents such as, but not limited to, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption such as, for example, aluminum monostearate or gelatin.
  • aqueous solution for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose for the cell mixture.
  • aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous, and intraperitoneal administration.
  • sterile aqueous media that can be employed is known to those of skill in the art in light of the present disclosure.
  • one dosage may be dissolved in 1 mL of isotonic NaCl solution and either added to 1000 mL of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, “Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety, and purity standards as required by FDA Office of Biologies standards.
  • Sterile injectable solutions are prepared by incorporating the compositions in the required amount in the appropriate solvent with various other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the various sterilized compositions into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • some methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • a powdered composition is combined with a liquid carrier such as, e.g., water or a saline solution, with or without a stabilizing agent.
  • compositions may be formulated for administration via various miscellaneous routes, for example, topical (i.e., transdermal) administration, mucosal administration (intranasal, vaginal, etc.) and/or via inhalation.
  • topical i.e., transdermal
  • mucosal administration intranasal, vaginal, etc.
  • inhalation via inhalation.
  • compositions for topical administration may include the compositions formulated for a medicated application such as an ointment, paste, cream, or powder.
  • Ointments include all oleaginous, adsorption, emulsion, and water-soluble based compositions for topical application, while creams and lotions are those compositions that include an emulsion base only.
  • Topically administered medications may contain a penetration enhancer to facilitate adsorption of the active ingredients through the skin. Suitable penetration enhancers include glycerin, alcohols, alkyl methyl sulfoxides, pyrrolidones, and luarocapram.
  • compositions for topical application include polyethylene glycol, lanolin, cold cream and petrolatum as well as any other suitable absorption, emulsion or water-soluble ointment base.
  • Topical preparations may also include emulsifiers, gelling agents, and antimicrobial preservatives as necessary to preserve the composition and provide for a homogenous mixture.
  • Transdermal administration of the compositions may also comprise the use of a “patch.”
  • the patch may supply one or more compositions at a predetermined rate and in a continuous manner over a fixed period of time.
  • the compositions may be delivered by eye drops, intranasal sprays, inhalation, and/or other aerosol delivery vehicles.
  • compositions disclosed herein may be delivered via an aerosol.
  • aerosol refers to a colloidal system of finely divided solid or liquid particles dispersed in a liquefied or pressurized gas propellant.
  • the typical aerosol for inhalation consists of a suspension of active ingredients in liquid propellant or a mixture of liquid propellant and a suitable solvent.
  • Suitable propellants include hydrocarbons and hydrocarbon ethers.
  • Suitable containers will vary according to the pressure requirements of the propellant.
  • Administration of the aerosol will vary according to subject’s age, weight, and the severity and response of the symptoms.
  • kits could house two containers, the first container comprising a CAR- Treg cell as described herein, and the second container comprising a pharmaceutically acceptable carrier, excipient, diluent, or adjuvant.
  • the kits typically further include instructions for using the components of the kit to practice the subject methods.
  • the instructions for practicing the subject methods are generally recorded on a suitable recording medium.
  • the instructions may be present in the kits as a package insert or in the labeling of the container of the kit or components thereof.
  • the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, such as a flash drive or CD-ROM.
  • the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, such as via the internet, are provided.
  • An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Diabetes (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Wood Science & Technology (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Endocrinology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Transplantation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2022/028454 2021-05-14 2022-05-10 Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders Ceased WO2022240797A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
AU2022272620A AU2022272620A1 (en) 2021-05-14 2022-05-10 Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders
CA3218583A CA3218583A1 (en) 2021-05-14 2022-05-10 Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders
CN202280046811.8A CN117580594A (zh) 2021-05-14 2022-05-10 用于预防和/或治疗自身免疫和同种免疫病症的免疫抑制性抗原特异性嵌合抗原受体Treg细胞
EP22808155.0A EP4340895A4 (en) 2021-05-14 2022-05-10 Immunosuppressive antigen-specific chimeric antigen receptor TREG cells for the prevention and/or treatment of autoimmune and alloimmune diseases
MX2023013487A MX2023013487A (es) 2021-05-14 2022-05-10 Células t reguladoras (treg) con receptor quimérico de antígeno específicas de antígeno inmunosupresoras para la prevención y/o tratamiento de trastornos autoinmunes y aloinmunes.
JP2023570380A JP2024518826A (ja) 2021-05-14 2022-05-10 自己免疫障害および同種免疫障害の予防および/または治療のための免疫抑制性抗原特異的キメラ抗原受容体Treg細胞
KR1020237041987A KR20240007197A (ko) 2021-05-14 2022-05-10 자가면역 및 동종면역 질환의 예방 및/또는 치료를 위한 면역억제성 항원-특이적 키메릭 항원 수용체 조절 t 세포

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US17/320,663 2021-05-14
US17/320,663 US11766457B2 (en) 2021-05-14 2021-05-14 Immunosuppressive antigen-specific chimeric antigen receptor Treg cells for prevention and/or treatment of autoimmune and alloimmune disorders

Publications (1)

Publication Number Publication Date
WO2022240797A1 true WO2022240797A1 (en) 2022-11-17

Family

ID=83999123

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/028454 Ceased WO2022240797A1 (en) 2021-05-14 2022-05-10 Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders

Country Status (9)

Country Link
US (3) US11766457B2 (https=)
EP (1) EP4340895A4 (https=)
JP (1) JP2024518826A (https=)
KR (1) KR20240007197A (https=)
CN (1) CN117580594A (https=)
AU (1) AU2022272620A1 (https=)
CA (1) CA3218583A1 (https=)
MX (1) MX2023013487A (https=)
WO (1) WO2022240797A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4434539A1 (en) * 2023-03-20 2024-09-25 Medizinische Hochschule Hannover Chimeric antigen receptor
WO2024194355A1 (en) * 2023-03-20 2024-09-26 Medizinische Hochschule Hannover Chimeric antigen receptor
WO2026008994A1 (en) 2024-07-04 2026-01-08 Quell Therapeutics Limited Expression construct

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2026010984A1 (en) * 2024-07-01 2026-01-08 The University Of Toledo Islet antigen-specific car-t therapy

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180318349A1 (en) * 2015-11-05 2018-11-08 Juno Therapeutics, Inc. Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy
US20180360884A1 (en) * 2015-12-09 2018-12-20 Memorial Sloan Kettering Cancer Center Immune cell compositions and methods of using same
WO2020150702A1 (en) * 2019-01-18 2020-07-23 University Of Southern California Methods and compositions to improve the safety and efficacy of cellular therapies
WO2021019386A1 (en) * 2019-07-26 2021-02-04 Janssen Biotech, Inc. Anti-hk2 chimeric antigen receptor (car)

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016174652A1 (en) 2015-04-30 2016-11-03 Technion Research & Development Foundation Limited Chimeric antigen receptors and methods of their use
AU2019377867B2 (en) * 2018-11-08 2026-03-12 The University Of Toledo Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180318349A1 (en) * 2015-11-05 2018-11-08 Juno Therapeutics, Inc. Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy
US20180360884A1 (en) * 2015-12-09 2018-12-20 Memorial Sloan Kettering Cancer Center Immune cell compositions and methods of using same
WO2020150702A1 (en) * 2019-01-18 2020-07-23 University Of Southern California Methods and compositions to improve the safety and efficacy of cellular therapies
WO2021019386A1 (en) * 2019-07-26 2021-02-04 Janssen Biotech, Inc. Anti-hk2 chimeric antigen receptor (car)

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
JACOBSEN LAURA M.; POSGAI AMANDA; SEAY HOWARD R.; HALLER MICHAEL J.; BRUSKO TODD M.: "T Cell Receptor Profiling in Type 1 Diabetes", CURRENT DIABETES REPORTS, CURRENT SCIENCE, PHILADELPHIA, VA, US, vol. 17, no. 11, 11 October 2017 (2017-10-11), US , pages 1 - 21, XP036347683, ISSN: 1534-4827, DOI: 10.1007/s11892-017-0946-4 *
JOHNNY LUDVIGSSON, DAVID KRISKY, ROSAURA CASAS, TADEJ BATTELINO, LUIS CASTAÑO, JAMES GREENING, OLGA KORDONOURI, TIMO OTONKOSKI, PA: "GAD65 antigen therapy in recently diagnosed type 1 diabetes mellitus", THE NEW ENGLAND JOURNAL OF MEDICINE, MASSACHUSETTS MEDICAL SOCIETY, vol. 366, no. 5, 2 February 2012 (2012-02-02), pages 433 - 442, XP055434070, DOI: 10.1056/NEJMoa1107096 *
QUNFANG ZHANG, WEIHUI LU, CHUN-LING LIANG, YUCHAO CHEN, HUAZHEN LIU, FEIFEI QIU, ZHENHUA DAI: "Chimeric Antigen Receptor (CAR) Treg: A Promising Approach to Inducing Immunological Tolerance", FRONTIERS IN IMMUNOLOGY, vol. 9, 1 January 2018 (2018-01-01), pages 2359, XP055591405, DOI: 10.3389/fimmu.2018.02359 *
See also references of EP4340895A4 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4434539A1 (en) * 2023-03-20 2024-09-25 Medizinische Hochschule Hannover Chimeric antigen receptor
WO2024194355A1 (en) * 2023-03-20 2024-09-26 Medizinische Hochschule Hannover Chimeric antigen receptor
WO2026008994A1 (en) 2024-07-04 2026-01-08 Quell Therapeutics Limited Expression construct

Also Published As

Publication number Publication date
AU2022272620A9 (en) 2023-11-30
US12144829B2 (en) 2024-11-19
CN117580594A (zh) 2024-02-20
KR20240007197A (ko) 2024-01-16
EP4340895A1 (en) 2024-03-27
EP4340895A4 (en) 2025-04-16
US20220362294A1 (en) 2022-11-17
AU2022272620A1 (en) 2023-11-23
US20240100094A1 (en) 2024-03-28
JP2024518826A (ja) 2024-05-07
US20250059252A1 (en) 2025-02-20
CA3218583A1 (en) 2022-11-17
MX2023013487A (es) 2024-02-28
US11766457B2 (en) 2023-09-26

Similar Documents

Publication Publication Date Title
US12144829B2 (en) Immunosuppressive antigen-specific chimeric antigen receptor Treg cells for prevention and/or treatment of autoimmune and alloimmune disorders
US20250099562A1 (en) Immunosuppressive antigen-specific chimeric antigen receptor treg cells for prevention and/or treatment of autoimmune and alloimmune disorders
US10864259B2 (en) Methods and compositions for the treatment of melanoma
US12103956B2 (en) Suicide module compositions and methods
TW201825122A (zh) 用精胺酸耗盡劑進行之組合癌症免疫療法
TW202241937A (zh) 用於追踪基因工程細胞的肽標記
CN109641032B (zh) 用于治疗黑素瘤的方法和组合物
AU2023228683B2 (en) Method of treating pancreatic cancer
HK40103104A (zh) 用於预防和/或治疗自身免疫和同种免疫病症的免疫抑制性抗原特异性嵌合抗原受体treg细胞
CN111094328A (zh) 用于治疗癌症的方法和组合物
EP4403580A1 (en) Anti-entpd3 chimeric antigen receptor
EP4420676A1 (en) Chimeric antigen receptor
HK40068518A (en) Methods and compositions for the treatment of melanoma
WO2024175805A1 (en) Chimeric antigen receptor
CN121586582A (zh) 嵌合抗原受体
HK40007510A (en) Methods and compositions for the treatment of melanoma
HK40007510B (en) Methods and compositions for the treatment of melanoma

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22808155

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2022272620

Country of ref document: AU

Ref document number: AU2022272620

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 3218583

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/013487

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2023570380

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2022272620

Country of ref document: AU

Date of ref document: 20220510

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20237041987

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020237041987

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 202347083746

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2022808155

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022808155

Country of ref document: EP

Effective date: 20231214

WWE Wipo information: entry into national phase

Ref document number: 11202308406U

Country of ref document: SG

Ref document number: 202280046811.8

Country of ref document: CN