WO2022221746A1 - Il-2 based constructs - Google Patents
Il-2 based constructs Download PDFInfo
- Publication number
- WO2022221746A1 WO2022221746A1 PCT/US2022/025143 US2022025143W WO2022221746A1 WO 2022221746 A1 WO2022221746 A1 WO 2022221746A1 US 2022025143 W US2022025143 W US 2022025143W WO 2022221746 A1 WO2022221746 A1 WO 2022221746A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- chimeric protein
- cancer
- protein complex
- cell
- modified
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- the present invention relates, in part, to chimeric proteins, or chimeric protein complexes (including Fc-based chimeric protein complexes) comprising interleukin 2 (IL-2) or variants thereof and their use as therapeutic agents.
- chimeric proteins or chimeric protein complexes (including Fc-based chimeric protein complexes) comprising interleukin 2 (IL-2) or variants thereof and their use as therapeutic agents.
- IL-2 interleukin 2
- Interleukin 2 is a member of a cytokine family, each member of which has a four alpha helix bundle.
- IL-2 signals through the IL-2 receptor, a complex consisting of two or three polypeptide chains, /. e. , the alpha and/or beta and gamma chains.
- IL-2 has been approved for cancer treatment with a high-dose regimen.
- Illustrative cancers treated with IL-2 include renal cell (kidney) and melanoma, a skin cancer.
- IL-2 stimulates immune cell proliferation and activation through receptor-signaling complexes containing alpha (IL- 2Ra, CD25) and/or beta (IL-2R ⁇ , CD 122), and common gamma receptor polypeptide chains (yc, CD 132), but the effects are pleiotropic and contextual.
- IL-2 binds to heterodimeric IL-2R y receptor leading to desired expansion of tumor killing CD8 + effector, memory T cells, and NK cells.
- IL-2 also binds to its heterotrimeric receptor IL-2Ra y with greater affinity, which expands immunosuppressive CD4 + CD25 + regulatory T cells (Tregs) expressing high constitutive levels of IL-2Ra. Expansion of Tregs represents an undesirable effect of IL-2 for cancer immunotherapy.
- activation of IL-2Ra y on endothelial cells can cause vascular leak syndrome (VLS).
- VLS vascular leak syndrome
- IL-2 vascular leakage syndrome
- Constructs for receptor selective IL-2 have been made (e.g., I L-2 Ra and IL-2RP interaction deficient or attenuated constructs). Flowever, these constructs still have side effect and toxicity issues. Some of the issues could be ameliorated with reducing dose (e.g., via extension of half-life), but the dose reduction alone does not solve cell- selectivity issues.
- IL-2-based agents that have reduced cellular side effects (off-target effects) and lower systemic toxicity for use in IL-2R y targeting (e.g., for CD8 + T cells activation in the treatment of cancer, for Thelp cells activation in the treatment of cancer, and for NK cells activation in the treatment of cancer) and IL-2Ra y targeting (e.g., for Treg stimulation in autoimmune diseases).
- the present invention relates to chimeric proteins and chimeric protein complexes, including Fc-based chimeric protein complexes, comprising a modified IL-2 as a signaling agent.
- the modified IL-2 is a modified wild type IL-2, wherein the wild type IL-2 has the amino acid sequence of SEQ ID NO: 1.
- the modified IL-2 is a modified neoleukin, wherein the neoleukin has the amino acid sequence of SEQ ID NO: 2.
- the modified IL-2 signaling agent comprises: (i) a mutation selected from D20E, D20F, D20G, D20H, D20I, D20K, D20L, and D20V; or (ii) a mutation selected from N88G, N88E, N88K, N88Q, and N88V; or (iii) a mutation selected from Q126G, Q126A, Q126E, Q126F, Q126H, Q126I, Q126K, Q126L, Q126N, Q126P, Q126R, Q126S, Q126T, Q126V, Q126W, and Q126Y; or (iv) a mutation selected from (i) and (iii) or a mutation selected from (ii) and (iii); or (v) one or more mutations selected from: R38A/F42K/N88G/C125A, F42K/C125A, D20E/C125A, D20F/C125A, D20G/C
- N88E/C125A N88H/C125A, N88I/C125A, N88K/C125A, N88Q/C125A, N88R/C125A, N88T/C125A,
- N88V/C125A D20E/R38A/F42K, D20E/R38A/F42K/C125A, D20V/R38A/F42K, D20V/R38A/F42K/C125A, R38A/F42Y/E62A/C 125A, R38A/F42Y/Y45A/E62A, F42Y/Y45A/L72G, R38A/F42Y/Y45A/E62A/C125A,
- the modified IL-2 signaling agent comprises one or more mutations at an amino acid residue selected from R38, F42, E62, C125, Y45, L72, D20, N88, and Q126 relative to SEQ ID NO: 1.
- the modified IL-2 signaling agent comprises one or more mutations selected from R38A, F42K, F42Y, E62A, C125A, Y45A, L72G, D20E, D20F, D20G, D20H, D20I, D20K, D20L, D20N, D20V, N88G, N88E, N88I, N88K, N88Q, N88R, N88V, R38A/F42Y/E62A/C125A, F42Y/Y45A/L72G/C125A, F42K/C125A, R38A/F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T
- the modified IL-2 signaling agent comprises one or more mutations selected from D20V, D20E, N88G, F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A, N88D/C125A, N88G/C125A, N88H/C125A, N88Q/C125A, N88T/C125A, D20E/R38A/F42K, D20E/R38A/F42K/C 125A, D20V/R38A/F42K, D20V/R38A/F42K/C125A, D20V/R38A/F42K/E62A,
- the modified IL-2 signaling agent comprises one or more mutations selected from R38A/F42Y/E62A/C 125A, F42Y/Y45A/L72G/C125A, F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A, N88D/C125A, N88G/C125A, N88H/C125A, N88Q/C125A, N88T/C125A, D20E/R38A/F42K/C125A, D20V/R38A/F42K/C125A, and R38A/F42K/N88G/C125A, relative to SEQ ID NO: 1.
- the modified IL-2 signlaing agent is modified neoleukin, which comprises the amino acid sequence of SEQ ID NO: 2.
- the modified IL-2 signaling agent comprising SEQ ID NO: 2 has one or more mutations at amino acid residues D15 and/or N40.
- the modified IL-2 signaling agent comprising SEQ ID NO: 2 comprises D15T, D15H, N40I, N40G, or N40R.
- the one or more mutations or modifications improve the safety profile of the modified IL-2, relative to, for example, wild type IL-2. In some embodiments, the one or more mutations or modifications reduce the biological activity of the modified IL-2, relative to, for example, wild type IL-2. For example, the one or more mutations or modifications may reduce the affinity of the modified IL-2 for a target receptor.
- the target receptor is the heterotrimeric receptor IL-2Ra y, which is composed of the IL-2Ra, IL-2RP, and IL-2Ry subunits. In some embodiments, the target receptor is the heterodimeric receptor IL-2R y, which is composed of the IL-2R ⁇ and IL-2Ry subunits.
- the modified IL-2 comprises one or more mutations or modifications that reduce its affinity for I L-2 Ra subunit. In another embodiment, the modified IL-2 comprises one or more mutations or modifications that reduce its affinity for IL-2R ⁇ . In yet another embodiment, the modified IL- 2 comprises one or more mutations or modifications that reduce its affinity for IL-2Ry.
- the modified IL-2 comprises one or more mutations or modifications that reduce its affinity for any combination of IL- 2Ra, IL-2R ⁇ , and I L-2 Ry (e.g ., one or more mutations or modifications that reduce the modified IL-2’s affinity for IL-2Ra, IL-2R ⁇ , and IL-2Ry or for I L-2 Ra and IL-2R or for I L-2 Ry and IL-2R or for I L-2 Ra and IL-2Ry).
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ra and IL2R , optionally wherein the modified IL-2 comprises one or more mutations selected from D20E/R38A/F42K, D20E/R38A/F42K/C 125A, D20V/R38A/F42K, D20V/R38A/F42K/C125A, D20V/R38A/F42K/E62A, D20V/R38A/F42K/E62A/C125A, R38A/F42K/N88G, R38A/F42K/N88G/C125A, R38A/F42K/E62A/N88G, and R38A/F42K/E62A/N88G/C125A.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ra and IL-2Ry, optionally wherein the modified IL-2 comprises one or more mutations selected from R38A/F42K/Q126G, R38A/F42K/Q126I, and R38A/F42K/Q126Y.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2R ⁇ , optionally wherein the modified IL-2 comprises one or more mutations selected from D20E, D20F, D20G, D20H, D20I, D20K, D20L, D20V, N88G, N88E, N88K, N88Q, N88V, D20E/C125A, D20F/C125A, D20G/C125A, D20H/C125A, D20I/C125A, D20L/C125A, D20K/C125A, D20N/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A,
- N88R/C125A, N88T/C125A, and N88V/C125A are examples of N88R/C125A, N88T/C125A, and N88V/C125A.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ry, optionally wherein the modified IL-2 comprises one or more mutations selected from Q126A, Q126E, Q126F, Q126G, Q126H, Q126I, Q126K, Q126L, Q126N, Q126P, Q126R, Q126S, Q126T, Q126V, Q126W, and Q126Y.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2R y, optionally wherein the modified IL-2 comprises one or more mutations selected from D20E/Q126A, D20E/Q126D, D20E/Q126E, D20E/Q126F, D20E/Q126G, D20E/Q126H, D20E/Q126I, D20E/Q126K, D20E/Q126L, D20E/Q126M,
- N88A/Q126M N88A/Q126N, N88A/Q126P, N88A/Q126R, N88A/Q126S, N88A/Q126T, N88A/Q126V,
- N88G/Q126H N88G/Q126I, N88G/Q126K, N88G/Q126L, N88G/Q126M, N88G/Q126N, N88G/Q126P,
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2R y and exhibits increased selectivity toward activated CD8 cells.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2RP and comprises a single mutation relative to a wild type signaling agent having SEQ ID NO: 1 selected from D20E, D20F, D20G, D20H, D20I, D20K, D20L, D20N, D20V, N88G, N88E, N88I, N88K, N88Q, N88R and N88V, D20E/C125A, D20F/C125A, D20G/C125A, D20H/C125A, D20I/C125A, D20K/C125A, D20L/C125A, D20N/C125A, D20S/C125A,
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2RP and exhibits increased selectivity toward activated CD8 cells and decreased selectivity toward Tregs.
- the target receptor is the heterotrimeric receptor IL-2Ra y, which is composed of the IL- 2Ra, IL-2R ⁇ , and I L-2 Ry subunits. In some embodiments, the target receptor is the heterodimeric receptor IL- 2R y, which is composed of the I L-2 R ⁇ and IL-2Ry subunits.
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce or ablate the activity or affinity of the modified IL-2 for an IL-2Ra chain; and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R lacking an a chain.
- the mutations or modifications that reduce the activity or affinity of the modified IL-2 and/or attenuate the modified IL-2 are restorable at a target cell or site of therapeutic action through a targeting moiety that is linked to the modified IL-2.
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduces the activity or affinity of the modified I L-2 for an IL-2R lacking an a chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R comprising an a chain, such mutation or modification being an attenuation mutation for which the activity or affinity is restorable by induced proximity at/to a target or a site of therapeutic action (e.g., a cell or the extracellular matrix) through a targeting moiety.
- a target or a site of therapeutic action e.g., a cell or the extracellular matrix
- the present invention contemplates a chimeric protein, a chimeric protein complex, or a Fc-based chimeric protein complex comprising a modified IL-2-signaling agent that comprises a glycosylation mutation.
- the glycosylation mutation decreases or eliminates glycosylation of the modified IL-2 signaling agent.
- the glycosylation mutation is a T3 substitution, wherein the mutation is one of T3A, T3F, T3H, T3L, T3V, and T3Y.
- the glysosylation mutation is a deletion of the first 3, 4, 5, 6, 7, or 8 residues of the modified IL-2.
- the chimeric protein comprises one or more additional signaling agents, e.g., without limitation, an interferon, an interleukin, and a tumor necrosis factor, that may be modified.
- additional signaling agents e.g., without limitation, an interferon, an interleukin, and a tumor necrosis factor, that may be modified.
- the chimeric protein comprises one or more targeting moieties which allow for a restoration of the weakened or attenuated activity described herein (e.g. on IL-2).
- the chimeric protein comprises one or more targeting moieties which have recognition domains (e.g. antigen recognition domains, including without limitation various antibody formats, inclusive of single-domain antibodies) that specifically bind to a target (e.g. antigen, receptor) of interest.
- the targeting moieties have recognition domains that specifically bind to a target (e.g.
- antigen, receptor of interest, including those found on one or more immune cells, which can include, without limitation, T cells, Tregs, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor or tumor macrophages (e.g. M1 or M2 macrophages, respectively), B cells, and dendritic cells.
- the immune cell is a T cell and the targeting moiety targets CD8.
- the immune cell is a Treg and the targeting moiety targets CTLA4.
- the immune cell is an NK cell and the targeting moiety is NKp46.
- the recognition domains specifically bind to a target (e.g . antigen, receptor) of interest and effectively recruit one of more immune cells.
- the targets (e.g. antigens, receptors) of interest can be found on one or more tumor cells.
- the present chimeric proteins may recruit an immune cell, e.g. an immune cell that can kill and/or suppress a tumor cell, to a site of action (such as, by way of non-limiting example, the tumor microenvironment).
- the recognition domain binds to a target of interest found in a normal tissue of interest.
- the present chimeric proteins may bind to a target cell to direct localization of the chimeric protein to a tissue cell of interest while also capable of binding to a second, different cell type (e.g., an immune cell) to impart a tissue localized biological effect mediated by the modified IL-2.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) of interest which is part of a non-cellular structure.
- the chimeric protein of the present technology provides improved cell target selectivity, safety and/or therapeutic activity and/or pharmacokinetic profiles (e.g., increased serum half-life) compared to an untargeted modified IL-2.
- the chimeric protein of the present technology is a single chain polypeptide.
- the chimeric protein of the present technology is a protein complex comprising two or more polypeptide chains.
- the targeting moiety (or moieties) and the signaling agent(s) are on the same polypeptide chain in the protein complex.
- the targeting moiety (or moieties) and the signaling agent(s) are on different polypeptide chains in the protein complex.
- the present chimeric proteins find use in the treatment of various diseases or disorders such as cancer, infections, immune disorders, autoimmune diseases, cardiovascular diseases, wound healing, ischemia-related diseases, neurodegenerative diseases, metabolic diseases and many other diseases and disorders, and the present invention encompasses various methods of treatment.
- the present invention relates to Fc-based chimeric protein complexes comprising a modified IL- 2 as a signaling agent.
- the Fc-based chimeric protein complex of the present invention comprises a polypeptide having an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 291-296, 298-335.
- the Fc-based chimeric protein complex of the present invention comprises a polypeptide having an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 292, 293, 294, 299, 301, 310, 311, 312, 315, 316, 319, 320, 325, 328, 332, 333, and 335.
- the present invention relates to a chimeric protein or an Fc-based chimeric protein complex comprising a polypeptide having an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 290-449, 478-495, or 501-531.
- FIGs. 1A-F, 2A-H, 3A-H, 4A-D, 5A-F, 6A-J, 7A-D, 8A-F, 9A-J, 10A-F, 11A-L, 12A-L, 13A-F, 14A-L, 15A-L, 16A- J, 17A-J, 18A-F, and 19A-F show various non-limiting illustrative schematics of the Fc-based chimeric protein complexes of the present invention.
- each schematic is a composition of the present invention.
- TM refers to a “targeting moiety” as described herein
- SA refers to a “signaling agent” as described herein
- *“1” is an optional “linker” as described herein
- the two long parallel rectangles are human Fc domains, e.g. from lgG1, from lgG2, or from lgG4, as described herein and optionally with effector knock-out and/or stabilization mutations as also described herein
- the two long parallel rectangles with one having a protrusion and the other having an indentation are human Fc domains, e.g.
- At least one signaling agent is IL-2, or modified IL-2, or neoleukin, or modified neoleukin.
- FIGs. 1 A-F show illustrative homodimeric 2-chain complexes. These figures show illustrative configurations for the homodimeric 2-chain complexes.
- FIGs. 2A-H show illustrative homodimeric 2-chain complexes with two targeting moieties (TM) (as described herein, more targeting moieties may be present in some embodiments).
- TM targeting moieties
- the position of TM1 and TM2 are interchangeable.
- the constructs shown in the box (/.e., Figs. 2G and 2H) have signaling agent (SA) between TM1 and TM2 or between TM1 and Fc.
- SA signaling agent
- FIGs. 3A-H show illustrative homodimeric 2-chain complexes with two signaling agents (as described herein, more signaling agents may be present in some embodiments).
- the position of SA1 and SA2 are interchangeable.
- the constructs shown in the box (/.e., Figs. 3G and 3H) have a TM between Fc and SA1 and/or SA2, N- or C-terminal of the Fc chains.
- FIGs. 4A-D show illustrative heterodimeric 2-chain complexes with split TM and SA chains, namely the TM on the knob chain of the Fc and the SA on hole chain of the Fc.
- FIGs. 5A-F show illustrative heterodimeric 2-chain complexes with split TM and SA chains, namely with both TMs on the knob chain of the Fc and with SA on hole chain of the Fc, with two targeting moieties (as described herein, more targeting moieties may be present in some embodiments).
- the position of TM1 and TM2 are interchangeable.
- TM1 and TM2 can be identical.
- FIGs. 6A-J show illustrative heterodimeric 2-chain complexes, namely with TM on the knob chain of the Fc and with two signaling agents (as described herein, more signaling agents may be present in some embodiments).
- one SA is on the knob chain and one SA is on the hole chain.
- the position of SA1 and SA2 are interchangeable.
- FIGs. 7A-D show illustrative heterodimeric 2-chain complexes with split TM and SA chains, namely the SA on the knob chain of the Fc and the TM on hole chain of the Fc.
- FIGs. 8A-F show illustrative heterodimeric 2-chain complexes with split TM and SA chains, namely with SA on the knob chain of the Fc and both TMs on hole chain of the Fc, with two targeting moieties (as described herein, more targeting moieties may be present in some embodiments).
- the position of TM1 and TM2 are interchangeable.
- TM1 and TM2 can be identical.
- FIGs. 9A-J show illustrative heterodimeric 2-chain complexes, namely with a TM on hole chain of the Fc and with two signaling agents (as described herein, more signaling agents may be present in some embodiments).
- one SA is on the knob chain and one SA is on the hole chain.
- the position of SA1 and SA2 are interchangeable.
- FIGs. 10A-F show illustrative heterodimeric 2-chain complexes with TM and SA on the same chain, namely the SA and TM both on the knob chain of the Fc.
- FIGs. 11A-L show illustrative heterodimeric 2-chain complexes with a TM and a SA on the same chain, namely with SA and with TM both on the knob chain of the Fc, with two targeting moieties (as described herein, more targeting moieties may be present in some embodiments).
- the position of TM1 and TM2 are interchangeable.
- TM1 and TM2 can be identical.
- FIGs. 12A-L show illustrative heterodimeric 2-chain complexes with a TM and a SA on the same chain, namely with SA and with TM both on the knob chain of the Fc, with two signaling agents (as described herein, more signaling agents may be present in some embodiments).
- the position of SA1 and SA2 are interchangeable.
- FIGs. 13A-F show illustrative heterodimeric 2-chain complexes with TM and SA on the same chain, namely the SA and TM both on the hole chain of the Fc.
- FIGs. 14A-L show illustrative heterodimeric 2-chain complexes with a TM and a SA on the same chain, namely with SA and with TM both on the hole chain of the Fc, with two targeting moieties (as described herein, more targeting moieties are present in some embodiments).
- the position of TM1 and TM2 are interchangeable.
- TM1 and TM2 can be identical.
- FIGs. 15A-L show illustrative heterodimeric 2-chain complexes with a TM and a SA on the same chain, namely with SA and with TM both on the hole chain of the Fc, with two signaling agents (as described herein, more signaling agents may be present in some embodiments).
- the position of SA1 and SA2 are interchangeable.
- FIGs. 16A-J show illustrative heterodimeric 2-chain complexes with two targeting moieties (as described herein, more targeting moieties may be present in some embodiments) and with SA on knob Fc and TM on each chain.
- TM1 and TM2 can be identical.
- FIGs. 17A-J show illustrative heterodimeric 2-chain complexes with two targeting moieties (as described herein, more targeting moieties may be present in some embodiments) and with SA on hole Fc and TM on each chain.
- TM1 and TM2 can be identical.
- FIGs. 18A-F show illustrative heterodimeric 2-chain complexes with two signaling agents (as described herein, more signaling agents may be present in some embodiments) and with split SA and TM chains: SA on knob and TM on hole Fc.
- FIGs. 19A-F show illustrative heterodimeric 2-chain complexes with two signaling agents (as described herein, more signaling agents may be present in some embodiments) and with split SA and TM chains: TM on knob and SA on hole Fc.
- FIG. 20 depicts IL-2 and Fc-IL-2 driven STAT5 phosphorylation in PBMC lymphocyte populations.
- FIGs. 21A-G show the effect of CD25 knock-out mutations and CD8 targeting on STAT5 phosphorylation in lymphocyte populations.
- FIGs. 22A-G depict sensorgrams of binding of IL-2 and Fc-IL-2 fusion-proteins to biotinylated CD25 in bio-layer interferometry.
- FIGs. 23A-R depict screening of D20 mutants for pSTAT5 in CD8 + , CD4 + CD25 , and CD4 + CD25 + PMBCs.
- FIGs. 24A-R depict screening of N88 mutants for pSTAT5 in CD8 + , CD4 + CD25 , and CD4 + CD25 + PMBCs
- FIGs. 25A-D show the effect of beta mutations (here N88G) and CD8 targeting on STAT5 phosphorylation in PBMC sub-populations.
- FIGs. 26A-J show various combinations of CD25 and IL-2f3 ⁇ 4 mutations and their effect on pSTAT5 in PMBCs populations.
- FIGs. 27A-B depict binding of CD25 scFv Fc-fusions to HEK-Blue IL-2 and HEK-Blue IL-1 cells in FACS.
- FIG. 28 shows the effect of CD25 scFv Fc-fusions on wild type IL-2 signaling in HEK-Blue IL-2 cells.
- FIGs. 29A-M depict the effect of CD25 targeting of ALN2 variants with CD25 or beta mutations on STAT5 phosphorylation in certain PBMC sub-populations.
- FIGs. 30A-H show STAT5 phosphorylation in PBMC subpopulations by IL-2 and Fc-IL-2 mimic/neoleukin variants.
- FIG. 31 depicts different bi-valent (if VHH1 and VHH2 are identical) or bi-specific (if VHH1 and VHH2 represent different targeting domains) knob-in-hole ALN2 formats.
- FIG. 32 depicts various ALN2 configurations.
- FIGs. 33A-G depicts a STAT5 comparison of STAT5 phosphorylation by bi-valent and bi-specific CD8 VHH targeted ALN2’s compared to the mono-valent counterparts.
- FIGs. 34A-E depicts STAT5 phosphorylation ALN2’s in different formats in CD8+ and Treg PBMC subpopulations.
- FIGs. 35A-D show that single-peptide ALN2 induced pSTAT5 in CD8+ compared to Treg PBMC subpopulations.
- FIGs. 36A-M depict STAT5 phosphorylation in CD8+ and CD8- PBMC lymphocyte populations by CD8 VHH-Fc- IL-2 and T3 O-glycosylation variants thereof.
- FIGs. 37A-D show STAT5 phosphorylation by mouse CD8 targeted alpha:beta ALN2 variants in CD8+ and Treg primary mouse splenocytes.
- FIG. 38 depicts tumor growth (in mm 3 ) of animals treated with buffer, Fc-ALN2, or CD8-Fc-ALN2 in the MC38 and CT26 syngeneic mouse models for colon carcinoma.
- FIG. 39 shows the effect of CD8-Fc-ALN2 and anti-PD-1 co-treatment in the MC38 and CT26 mouse models.
- FIGs. 40A-D show STAT5 phosphorylation by CD8 targeted Fc gamma common Q126 mutants in CD8 positive PBMCs.
- FIGs. 41A-S depict sensorgrams of binding of CD8-Fc-IL-2 and Q126 mutants thereof fusion proteins to biotinylated CD25 in BLI.
- FIGs. 42A-D show pSTAT5 phosphorylation by alpha:gamma mutants in CD8+ and Treg PBMC subpopulations of three different donors.
- FIGs. 43A-D depict beta:gamma ALN2 STAT5 phosphorylation of ‘resting’ or TransAct activated CD8+ or Treg PBMC subpopulations.
- FIG. 44 shows the effect of CD8-Fc-ALN2 (12.5 ⁇ g), Fc-ALN2 (10.7 ⁇ g) or Fc-IL2 (10.7 ⁇ g) on T cell activation 1 day after single dose.
- FIG. 45 depicts the effect of CD8-Fc-ALN2 (12.5 ⁇ g), Fc-ALN2 (10.7 ⁇ g) or Fc-IL2 (10.7 ⁇ g) with and without anti- PD-1 Ab co-treatment on T cell activation 7 days after two doses.
- FIG. 46 shows the effect of CD8-Fc-ALN2 (25 ⁇ g), Fc-ALN2 (21.4 ⁇ g) or Fc-IL2 (21.4 ⁇ g) on T cell activation 3 days after a single dose.
- FIG. 47 depicts the effect of three injections of 12.5 ⁇ g CD8-Fc-ALN2 and anti-PD-1 Ab, compared to wild type Fc-IL2, 1 in the A20 mouse model.
- FIG. 48 shows the effect of three doses of 12.5 ⁇ g CD8-Fc-ALN2, compared to equimolar Fc-ALN2 treatments in the B16F10 mouse model.
- FIG. 49 depicts the effect of two injections of 12.5 ⁇ g CD8-Fc-ALN2, compared to equimolar Fc-ALN2 treatment in the Panc02 mouse model.
- FIG. 50 depicts STAT5 phosphorylation in mouse splenocytes (singlet population) comparing wild type IL2, PD-L1 targeted, and untargeted ALN2.
- FIG. 51 shows the effect of three doses of 12.5 ⁇ g CD8-Fc-ALN2 and anti-PD-1 Ab, compared to equimolar Fc- ALN2 treatments in the MC38 mouse model.
- FIG. 52 depicts the effect of three doses of 12.5 ⁇ g TNCA1-Fc-ALN2 or equivalent dose of untargeted ALN2 without or with anti-PD-1 Ab co-treatment in the MC38 mouse model.
- FIG. 53 shows STAT5 phosphorylation by mouse CD8, or NKp46, or bispecific targeted alpha:beta ALN2 variants in CD8 and NK primary mouse splenocytes compared to untargeted or wild type IL-2.
- FIG. 54 depicts CD25 (left) and PD-1 (right) up-regulation by ALN2 variants R38A_F42K_D20E (upper) and R38A_F42K_N88G (lower) in three PBMC donors. Data are plotted as means ⁇ SEM.
- FIG. 55 shows the effect of hCD8-Fc-ALN2 on human T cell activation in human immune system (HIS) mice 45 min after 1 treatment (5 ⁇ g).
- FIG. 56 depicts CD25 up-regulation in primary mouse splenocytes by mouse CD8 targeted or untargeted ALN2 variants with different loss-of-function beta mutations.
- FIG. 57 shows the effect of treatment on days 6 and 9 with 12.5 ⁇ g N88G- or D20E-based CD8-Fc-ALN2 or equimolar untargeted ALN2s in the MC38 mouse model.
- FIG. 58 depicts STAT5 phosphorylation in primary mouse splenocytes by ALN2 variants with different loss-of- function gamma mutations.
- FIG. 59 shows the effect of three doses of 12.5 or 4.17 ⁇ g CD8-Fc-ALN2 alpha:gamma mutation combination in the MC38 mouse model and compared to equimolar dosing of untargeted Fc-ALN.
- FIG. 60 shows the effect of three doses of 4.17 or 1 .4 ⁇ g CD8-Fc-ALN2 beta:gamma mutation combination in the MC38 mouse model and compared to equimolar dosing of untargeted Fc-ALN.
- FIG. 61 depicts signaling of D20 ALN2 variants in HEK-Blue CD8 vs HEK-Blue NKp46 cells.
- FIG. 62 depicts signaling of N88 ALN2 variants in HEK-Blue CD8 vs HEK-Blue NKp46 cells.
- the present technology is based, in part, on the discovery that targeted chimeric proteins or protein complexes, including Fc-based chimeric protein complexes, that include a modified IL-2 exhibit beneficial therapeutic properties and reduced side effects.
- the chimeric proteins of the present technology are highly active and/or long-acting while eliciting minimal side effects.
- the present technology provides pharmaceutical compositions comprising the chimeric proteins and their use in the treatment of various diseases.
- the chimeric protein or protein complexes having modified IL-2 may favor attenuated activation of CD8 + T cells, Thelp cells, or NK cells (which can provide an anti-tumor effect), which primarily express IL-2 receptors b and y, and disfavor T re g S (which can provide an immune suppressive, pro-tumor effect), which have IL-2 receptors a, b, and y.
- the preferences for I ⁇ -2Hb and/or IL-2Ry over IL-2Ra avoid IL-2 side effects such as pulmonary edema and/or vascular leak syndrome (VLS).
- IL-2-based chimeras are useful for the treatment of diseases (e.g ., autoimmune disease), for instance when the modified IL-2 is antagonistic (e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) at IL-2R ⁇ and/or IL-2Ry.
- the present constructs may favor attenuated suppression of CD8 + T cells (and therefore dampen the immune response), which have IL-2 receptors b and y and disfavor T regS which have IL-2 receptors a, b, and y.
- the chimeras bearing modified IL-2 favor the agonistic activation of Tregs, and therefore immune suppression, and disfavor activation of CD8 + T cells.
- these constructs find use in the treatment of diseases or diseases that would benefit from immune suppression, e.g., autoimmune disorders.
- the chimeric protein has targeting moieties as described herein directed to CD8 + T cells as well as a modified IL-2 having reduced affinity and/or activity for I ⁇ b and/or IL-2Ry and/or substantially reduced or ablated affinity and/or activity for IL-2Ra.
- these constructs provide targeted CD8 + T cell activity and are generally inactive (or have substantially reduced activity) towards T reg cells.
- such constructs have enhanced immune stimulatory effect compared to wild type IL-2 (e.g., without wishing to be bound by theory, by not stimulating Tregs), whilst eliminating or reducing the systemic side effects and/or toxicity associated with wild type IL-2 and modified IL-2 proteins constructs that preferentially target I ⁇ bg but not in a cell-selective, targeted and conditional manner, such as described in this invention.
- the present invention relates to a chimeric protein or an Fc-based chimeric protein complex comprising a polypeptide having an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 290-449, 478-495, or 501 -531.
- the chimeric protein or Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence constructed in one or more of Examples 1-25.
- the present technology provides a chimeric protein that includes a modified IL-2.
- the chimeric protein of the present technology comprises a modified IL-2 as a signaling agent.
- the modified IL-2 signaling agent encompasses functional derivatives, analogs, precursors, isoforms, splice variants, or fragments of the modified IL-2.
- the modified IL-2 encompasses mutations and/or modifications to SEQ ID NO: 1, which is the amino acid sequence of wild type IL-2.
- the modified IL-2 has a reduced binding affinity for its target receptor.
- the modified IL-2 signaling agent has reduced affinity and/or activity for I L-2 Ra and/or IL- 2Rb and/or IL-2Ry. In some embodiments, the modified IL-2 has reduced affinity and/or activity for I ⁇ b and/or IL-2Ry. In some embodiments, the modified IL-2 has substantially reduced or ablated affinity and/or activity for IL- 2Ra. Such embodiments may be relevant for treatment of cancer, for instance when the modified IL-2 is agonistic at I ⁇ bg.
- the IL-2 has one or more mutations or modifications that biases it away from an IL-2R having an a chain and one or more attenuating mutations that reduces the activity or affinity of the IL-2 in a restorable manner at an IL-2R having only the bg chain. In embodiments, the IL-2 has one or more mutations or modifications that biases it away from an IL-2R having only the bg chain and an attenuating mutation that reduces the activity or affinity of the IL-2 in a restorable manner at an IL-2R having an a chain.
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce or ablate the activity or affinity of the modified IL-2 for an I L-2 Ra chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y complex.
- the reduced activity or affinity of the modified IL-2 for the I L-2 Ra chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety disclosed herein.
- the mutation or modification that ablates the activity or affinity of the modified IL-2 for the I L-2 Ra chain is not restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- the reduced activity or affinity of the modified IL-2 for the IL-2R y complex is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety disclosed herein.
- the one or more mutations in reduce the activity or affinity of the modified IL-2 for an I L-2 Ra chain and I L-2 R y complex, respectively are both restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety disclosed herein.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that substantially ablate the activity or affinity of the modified IL-2 for an IL-2R a chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2R lacking an a chain, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and such IL-2 being substantially inactive at an IL-2R on cells that do not express a target for the targeting moiety or substantially inactive, compared to wild type IL-2, at IL-2R comprising the alpha chain when contacting cells that express the target for the targeting moiety, while being active at IL-2R lacking an a chain and/or cells that express the target for the targeting moiety.
- a target e.g., a cell
- the activity or affinity from mutation or modification is about 3- or about 5-, or about 10-, or about 30-, or about 100-, or about 300-, or about 500-, or about 1000-fold reduced as compared to the activity or affinity from a different mutation or modification.
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2Ra y and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2Ra, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2Ra y and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2R y, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and such IL-2 being substantially inactive at an IL-2R on cells that do not express a target for the targeting moiety or substantially inactive at IL-2Ra y, compared to wild type IL-2, when contacting cells that express the target for the targeting moiety, while being active at IL-2R y and/or cells that express the target for the targeting moiety.
- a target e.g., a cell
- the IL-2 has selective (e.g., biased for and/or strongly favored) action at IL-2RPy (and not IL- 2Ra y) but the activity at IL-2R y is attenuated by further mutations or modifications to render the IL-2 safe for systemic use (e.g. the IL-2 is active at IL-2R y predominantly at the site of therapeutic action, to which it is directed via the targeting moiety).
- the IL-2 has selective (e.g., biased for and/or strongly favored) action at NK cells and/or CD8+ cells and not substantially at Treg cells and the selective (e.g., biased for and/or strongly favored) action at NK cells and/or CD8+ cells is controlled by targeting to reduce or eliminate systemic side effects.
- the present chimeric protein is, in some embodiments, not only directed to cells that have an immune stimulation effect but also done so in a controllable way that focuses IL-2 action at the site of desired therapy. As described herein, such chimeric proteins find use, in embodiments, in safely stimulating the immune system for an anti-cancer effect.
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R lacking an a chain and/or one or more mutations or modifications reduce the activity or affinity of the modified IL-2 for an IL-2R comprising an a chain, such mutation or modification being an attenuation mutation for which the activity or affinity is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R lacking an a chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2R comprising an a chain, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and such IL-2 being substantially inactive at an IL-2R on cells that do not express a target for the targeting moiety or substantially inactive, compared to wild type IL-2, at IL-2R lacking an a chain when contacting cells that express the target for the targeting moiety, while being active at an IL-2R comprising an a chain and/or cells that express the target for the targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2R y and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for I L-2 Ra such mutation or modification being an attenuation mutation for which the activity or affinity is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for I L-2 R y and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for I L-2 Ra bg, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for I L-2 R y and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for I L-2 Ra bg, such reduced activity or affinity being restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and such IL-2 being substantially inactive at an IL-2R on cells that do not express a target for the targeting moiety or substantially inactive at IL-2RPy, compared to wild type IL-2, when contacting cells that express the target for the targeting moiety, while being active at I L-2 Ra bg and/or cells that express the target for the targeting moiety.
- a target e.g., a cell
- the modified IL-2 has selective (e.g., biased for and/or strongly favored) action at IL-2Ra y (and not IL-2R y) but the activity at IL-2Ra y is attenuated by further mutations or modifications to render the IL-2 safe for systemic use (e.g. the IL-2 is active at I L-2 Ra bg predominantly at the site of therapeutic action, to which it is directed via the targeting moiety).
- the IL-2 has one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain and normal activity or affinity to an I L-2 Ra chain, wherein the reduced activity or affinity of the modified IL-2 for the IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for IL-2Ra and normal activity or affinity to an IL-2R y chain, wherein the reduced activity or affinity of the modified IL-2 for the I L-2 Ra chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that ablate the activity or affinity of the modified IL-2 for an I L-2 Ra chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain, wherein the reduced activity or affinity of the modified IL-2 for the IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety (e.g., a CD8, CD3, or PD-1 targeting moiety) and is useful in mediating a T-cell mediated immune response (e.g., a CD8 T-cell mediated immune response).
- a target e.g., a cell
- a targeting moiety e.g., a CD8, CD3, or PD-1 targeting moiety
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an I L-2 Ra chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain, wherein the reduced activity or affinity of the modified IL-2 for the IL-2Ra and/or the IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety (e.g., a CD8, CD3, or PD-1 targeting moiety) and is useful in mediating a T-cell mediated immune response (e.g., a CD8 T-cell mediated immune response).
- a target e.g., a cell
- a targeting moiety e.g., a CD8, CD3, or PD-1 targeting moiety
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an I L-2 Ra chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain, wherein the reduced activity or affinity of the modified IL-2 for the I L-2 Ra chain and/or IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and is useful in mediating a Treg response.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications: one or more mutations or modifications that ablate the activity or affinity of the modified IL-2 for an I L-2 Ra chain and/or one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain, wherein the reduced activity or affinity of the modified IL-2 for the IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and is useful in mediating a Treg response.
- a target e.g., a cell
- the IL-2 has one or more mutations or modifications that reduce the activity or affinity of the modified IL-2 for an IL-2R y chain and normal activity or affinity to an I L-2 Ra chain, wherein the reduced activity or affinity of the modified IL-2 for the IL-2R y chain is restorable by induced proximity at/to a target (e.g., a cell) through a targeting moiety and is useful in mediating a Treg response.
- a target e.g., a cell
- the IL-2 has selective (e.g., biased for and/or strongly favored) action at Treg cells and not substantially at NK cells and/or CD8+ cells and the selective (e.g., biased for and/or strongly favored) action at Treg cells is controlled by targeting to reduce or eliminate systemic side effects.
- the present chimeric protein is, in some embodiments, not only directed to cells that have an immune inhibition effect but also done so in a controllable way that focuses IL-2 action at the site of desired therapy. As described herein, such chimeric proteins find use, in embodiments, in safely stimulating the immune system for an anti-autoimmune effect.
- the modified IL-2 signaling agent is modified wild type IL-2.
- Wild type IL-2 has the amino acid sequence of:
- the modified IL-2 signaling agent comprises: (i) a mutation selected from D20E, D20F, D20G, D20H, D20I, D20K, D20L, and D20V; or (ii) a mutation selected from N88G, N88E, N88K, N88Q, and N88V; or (iii) a mutation selected from Q126G, Q126A, Q126E, Q126F, Q126H, Q126I, Q126K, Q126L, Q126N, Q126P, Q126R, Q126S, Q126T, Q126V, Q126W, and Q126Y; or (iv) a mutation selected from (i) and (iii) or a mutation selected from (ii) and (iii); or (v) one or more mutations selected from: R38A/F42K/N88G/C125A, F42K/C125A, D20E/C125A, D20F/C125A, D20G/C
- N88E/C125A N88H/C125A, N88I/C125A, N88K/C125A, N88Q/C125A, N88R/C125A, N88T/C125A,
- the modified IL-2 signaling agent comprises one or more mutations at an amino acid residue selected from R38, F42, E62, C125, Y45, L72, D20, N88, and Q126 relative to SEQ ID NO: 1.
- the modified IL-2 signaling agent comprises one or more mutations selected from R38A, F42K, F42Y, E62A, C125A, Y45A, L72G, D20E, D20F, D20G, D20H, D20I, D20K, D20L, D20N, D20V, N88G, N88E, N88I, N88K, N88Q, N88R, N88V, R38A/F42Y/E62A/C125A, F42Y/Y45A/L72G/C125A, F42K/C125A, R38A/F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T
- the modified IL-2 signaling agent comprises one or more mutations selected from D20V, D20E, N88G, F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A, N88D/C125A, N88G/C125A, N88H/C125A, N88Q/C125A, N88T/C125A, D20E/R38A/F42K, D20E/R38A/F42K/C 125A, D20V/R38A/F42K, D20V/R38A/F42K/C125A, D20V/R38A/F42K/E62A,
- the modified IL-2 signaling agent comprises one or more mutations selected from R38A/F42Y/E62A/C 125A, F42Y/Y45A/L72G/C125A, F42K/C125A, D20E/C125A, D20G/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A, N88D/C125A, N88G/C125A, N88H/C125A, N88Q/C125A, N88T/C125A, D20E/R38A/F42K/C125A, D20V/R38A/F42K/C125A, and R38A/F42K/N88G/C125A, relative to SEQ ID NO: 1.
- the modified IL-2 signaling agent comprises one or more of the mutation combinations selected from those listed in Table 8.
- modified IL-2 agents have reduced affinity for a high- affinity IL-2 receptor (i.e., IL-2Ra y) and preserves affinity to the intermediate-affinity IL-2 receptor (i.e., IL-2R y), as compared to the wild-type IL-2.
- IL-2Ra y high- affinity IL-2 receptor
- IL-2R y intermediate-affinity IL-2 receptor
- these modified IL-2 agents have reduced affinity for an IL-2 receptor (e.g., IL-2R y), as compared to the wild-type IL-2.
- an IL-2 receptor e.g., IL-2R y
- the modified IL-2 signaling agent with mutations at R38, F42, Y45, and/or E62 is able to induce an expansion of effector cells including CD8+ T cells and NK cells but not Treg cells and/or endothelial cells.
- the modified IL-2 signaling agent with mutations at R38, F42, Y45, and/or E62 is less toxic than wildtype IL-2 agents.
- a chimeric protein comprising the modified IL-2 agent with substantially reduced affinity and/or activity for IL-2Ra may find application in oncology, for example.
- the modified IL-2 agent has a mutation at amino acid residue D20.
- the modified IL-2 agent may comprise D20E, D20G, D20S, D20T, or D20V.
- the modified IL-2 agent with a mutation at D20 has decreased toxicity as compared to wild type IL-2 agents.
- a D20 mutation decreases toxicity by inhibiting binding to and activation of endothelial cells.
- the modified IL-2 agent has a mutation at amino acids C125.
- the modified IL- 2 agent may comprise the mutation C125A.
- the modified IL-2 agent with a mutation at C125 optimize production of such a modified IL-2 agent.
- a mutation at C125 promotes stability of such a modified IL-2 agent by removing an unpaired cysteine residue.
- the modified IL-2 agent may have substantially reduced affinity and/or activity for IL-2Ra, as described in, for example, Carmenate ef a/. (2013) The Journal of Immunology, 190:6230-6238, the entire disclosure of which is hereby incorporated by reference.
- the modified IL-2 agent may have substantially reduced affinity and/or activity for IL-2RP, as described in, for example, WO 2016/025385, the entire disclosure of which is hereby incorporated by reference.
- the modified IL-2 agent may induce an expansion of Treg cells but not effector cells such as CD8+ T cells and NK cells.
- a chimeric protein comprising the modified IL-2 agent with substantially reduced affinity and/or activity for IL-2RP may find application in the treatment of autoimmune disease for example.
- the modified IL-2 agent may comprise a mutation at amino acid resiude N88.
- the modified IL-2 agent may comprise N88A, N88D, N88G, N88H, N88Q, or N88T.
- the modified IL-2 signaling agent comprises a deletion of the Ala at the N-terminus of SEQ ID NO: 1. In some embodiments, the modified IL-2 agent comprises the substitution of a Serine or Alanine for the Cysteine at position 125 of SEQ ID NO: 1. In some embodiments, the modified IL-2 agent comprises a deletion of the Ala at the N-terminus and the substitution of a Serine or Alanine for the Cysteine at position 125 of SEQ ID NO: 1.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ra and IL2R ⁇ , optionally wherein the modified IL-2 comprises one or more mutations selected from D20E/R38A/F42K, D20E/R38A/F42K/C 125A, D20V/R38A/F42K, D20V/R38A/F42K/C125A, D20V/R38A/F42K/E62A,
- D20V/R38A/F42K/E62A/C125A D20V/R38A/F42K/E62A/C125A, R38A/F42K/N88G, R38A/F42K/N88G/C125A, R38A/F42K/E62A/N88G, and R38A/F42K/E62A/N88G/C125A.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ra and IL-2Ry, optionally wherein the modified IL-2 comprises one or more mutations selected from R38A/F42K/Q126G, R38A/F42K/Q 126I , and R38A/F42K/Q126Y.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2RP, optionally wherein the modified IL-2 comprises one or more mutations selected from D20E, D20F, D20G, D20H, D20I, D20K, D20L, D20V, N88G, N88E, N88K, N88Q, N88V, D20E/C125A, D20F/C125A, D20G/C125A, D20H/C125A, D20I/C125A, D20L/C125A, D20K/C125A, D20N/C125A, D20S/C125A, D20T/C125A, D20V/C125A, N88A/C125A,
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2Ry, optionally wherein the modified IL-2 comprises one or more mutations selected from Q126A, Q126E, Q126F, Q126G, Q126H, Q126I, Q126K, Q126L, Q126N, Q126P, Q126R, Q126S, Q126T, Q126V, Q126W, and Q126Y.
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2R y, optionally wherein the modified IL-2 comprises one or more mutations selected from D20E/Q126A, D20E/Q126D, D20E/Q126E, D20E/Q126F, D20E/Q126G, D20E/Q126H, D20E/Q126I, D20E/Q126K, D20E/Q126L, D20E/Q126M,
- N88A/Q126M N88A/Q126N, N88A/Q126P, N88A/Q126R, N88A/Q126S, N88A/Q126T, N88A/Q126V,
- N88G/Q126H N88G/Q126I, N88G/Q126K, N88G/Q126L, N88G/Q126M, N88G/Q126N, N88G/Q126P,
- the modified IL-2 exhibits reduced affinity and/or activity for IL-2R y and exhibits increased selectivity toward activated CD8 cells.
- the modified IL-2 signlaing agent is modified neoleukin, which comprises the amino acid sequence of:
- PKKKIQLHAEHALYDALMILNIVKTNSPPAEEKLEDYAFNFELILEEIARLFESGDQKDEAEKAKRMKEWMKRIKTT ASEDEQEEMANAIITILQSWIFS SEQ ID NO: 2.
- the modified IL-2 signaling agent comprising SEQ ID NO: 2 has one or more mutations at amino acid residues D15 and/or N40.
- the modified IL-2 signaling agent comprising SEQ ID NO: 2 comprises D15T, D15H, N40I, N40G, or N40R.
- the modified IL-2 signaling agent comprises an amino acid sequence that has at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about
- the modified IL-2 is modified to have one or more mutations. In some embodiments, the modified IL-2 is modified to have one or more mutations and one or more modifications (e.g., glycosylation). IL-2 contains a threonine O -g lycosy I ati o n site on position 3 (T3).
- the modified IL- 2-signaling agent comprises a T3 O -g lycosy I ati o n mutation, wherein the mutation is one of T3A, T3F, T3H, T3L, T3V, and T3Y.
- the modified IL-2-signaling agent comprises a T3 O-glycosylation deletion mutation, wherein the first 3, 4, 5, 6, 7, or 8 residues of the modified IL-2 sequence are deleted.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions.
- “Conservative substitutions” may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
- the 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Val, Leu, lie; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
- “conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
- glycine and proline may be substituted for one another based on their ability to disrupt a-helices.
- non-conservative substitutions are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) shown above.
- the substitutions may also include non-classical amino acids (e.g. selenocysteine, pyrrolysine, A/-formylmethionine b-alanine, GABA and d-Aminolevulinic acid, 4-aminobenzoic acid (PABA), D- isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, y-Abu, e-Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosme, citrulline, homocitrulline, cysteic acid, t-butylglycine, t- butylalanine, phenylglycine,
- the mutations allow for the modified IL-2 to have one or more of attenuated activity, such as one or more of reduced binding affinity, reduced endogenous activity, and reduced specific bioactivity, relative to unmutated IL-2, e.g., the wild type form of IL-2 (e.g., SEQ ID NO: 1).
- the one or more of attenuated activity, such as reduced binding affinity, reduced endogenous activity, and reduced specific bioactivity, relative to unmutated IL-2, e.g., the wild type form of IL-2 (e.g., SEQ ID NO: 1) may be at a receptor such as IL-2Ra y.
- the mutations allow for the modified IL-2 to have reduced systemic toxicity, reduced side effects, and reduced off-target effects relative to unmutated IL-2, e.g., the wild type form of IL-2.
- the modified IL-2 is modified to have one or more mutations that reduces its binding affinity or activity at a therapeutic or target receptor.
- the activity provided by the modified IL-2 is agonism at the therapeutic or target receptor (e.g. activation of a cellular effect at a site of therapy) or antagonism at the therapeutic or target receptor (e.g., reduced or ablated activation of a cellular effect at a site of therapy).
- the modified IL-2 may activate the therapeutic or target receptor.
- the mutation results in the modified IL-2 to have reduced activating activity at the therapeutic or target receptor.
- the reduced affinity or activity at the therapeutic or target receptor is restorable by attachment with a targeting moiety. In other embodiments, the reduced affinity or activity at the therapeutic or target receptor is not substantially restorable by attachment with the targeting moiety.
- the chimeric proteins of the present technology reduce off-target effects because the modified IL-2 has mutations that weaken binding affinity or activity at a therapeutic or target receptor. In various embodiments, this reduces side effects observed with, for example, the wild type IL-2.
- the modified IL-2 is substantially inactive en route to the site of therapeutic activity and has its effect substantially on specifically targeted cell types which greatly reduces undesired side effects.
- the modified IL-2 has one or more mutations that cause the modified IL-2 to have attenuated or reduced affinity, e.g. binding (e.g. KD) and/or activation (measurable as, for example, K A and/or EC 50 ) for one or more therapeutic receptors.
- binding e.g. KD
- activation measurable as, for example, K A and/or EC 50
- the reduced affinity at the therapeutic receptor allows for attenuation of activity and/or signaling from the therapeutic receptor.
- the modified IL-2 has about 1%, or about 3%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 10%-20%, about 20%-40%, about 50%, about 40%-60%, about 60%-80%, about 80%-100% of the affinity for the therapeutic or target receptor (e.g., IL- 2Ra y or IL-2R y or any one of their subunits IL-2Ra, IL-2RP, and/or IL-2Ry) relative to the wild type IL-2.
- the therapeutic or target receptor e.g., IL- 2Ra y or IL-2R y or any one of their subunits IL-2Ra, IL-2RP, and/or IL-2Ry
- the binding affinity is at least about 2-fold lower, about 3-fold lower, about 4-fold lower, about 5-fold lower, about 6-fold lower, about 7-fold lower, about 8-fold lower, about 9-fold lower, at least about 10-fold lower, at least about 15-fold lower, at least about 20-fold lower, at least about 25-fold lower, at least about 30-fold lower, at least about 35-fold lower, at least about 40-fold lower, at least about 45-fold lower, at least about 50-fold lower, at least about 100-fold lower, at least about 150-fold lower, or about 10-50-fold lower, about 50-100-fold lower, about 100-150-fold lower, about 150-200-fold lower, or more than 200-fold lower relative to the wild type IL-2.
- Receptor binding activity may be measured using methods known in the art. For example, affinity and/or binding activity may be assessed by Scatchard plot analysis and computer-fitting of binding data (e.g . Scatchard, The attractions of proteins for small molecules and ions. Ann NY Acad Sci 51 : 660-672, 1949) or by reflectometric interference spectroscopy under flow through conditions, as described by Brecht ef a/. Biosens Bioeledron 1993;8:387-392, the entire contents of all of which are hereby incorporated by reference. In some embodiments, receptor binding activity is measured by bio-layer interferometry (BLI).
- BBI bio-layer interferometry
- the attenuated activity at the therapeutic or target receptor, the weakened affinity at the therapeutic or target receptor is restorable by attachment with a targeting moiety, having high affinity for an antigen at the site of therapeutic activity (e.g. an antibody or antibody format described herein).
- the targeting is realized by linking the modified IL-2 to a targeting moiety.
- the modified IL-2 is linked to a targeting moiety through its amino-terminus.
- the modified IL-2 is linked to a targeting moiety through its carboxy-terminus.
- the present chimeric proteins provide, in some embodiments, localized, on-target, and controlled therapeutic action at the therapeutic or target receptor.
- the activity of the modified IL-2 at a therapeutic or target receptor is enhanced by attachment with a targeting moiety, having high affinity for an antigen at the site of therapeutic activity (e.g. an antibody or antibody format described herein).
- the targeting is realized by linking the modified IL-2 to a targeting moiety.
- the modified IL-2 is linked to a targeting moiety through its amino-terminus.
- the modified IL-2 is linked to a targeting moiety through its carboxy-terminus.
- the present chimeric proteins provide, in some embodiments, localized, on-target, and controlled therapeutic action at the therapeutic or target receptor.
- the present invention provides chimeric proteins or protein complexes comprising one or more targeting moieties that bind to one or more of the following targets: CD8, CTLA4, CD3, CD4, DNAM-1, Nrp1 (neurophilin), TNFR1, TNFR2, GITR, ICOS, CD20, CD70, Clec9a, NKp46, PD-1, PD-L1, PD-L2, SIRPIa, FAP, XCR1, tenascin, and ECM proteins.
- CD8 CTLA4, CD3, CD4, DNAM-1, Nrp1 (neurophilin), TNFR1, TNFR2, GITR, ICOS, CD20, CD70, Clec9a, NKp46, PD-1, PD-L1, PD-L2, SIRPIa, FAP, XCR1, tenascin, and ECM proteins.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes of the present invention additionally comprise one or more targeting moieties having recognition domains which specifically bind to a target (e.g. antigen, receptor) of interest.
- the chimeric protein or chimeric protein complexes such as Fc-based chimeric protein complexes may comprise two, three, four, five, six, seven, eight, nine, ten or more targeting moieties.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes of the invention comprise two or more targeting moieties.
- the chimeric proteins or chimeric protein complexes can target two different cells ( e.g . to make a synapse) or the same cell ( e.g . to get a more concentrated signaling agent effect).
- the target (e.g. antigen, receptor) of interest is directed against an immune cell and/or organ cells, and/or tissue cells.
- the target (e.g. antigen, receptor) of interest can be found on one or more immune cells, which can include, without limitation, T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor or tumor-associated macrophages (e.g. M1 or M2 macrophages), B cells, Breg cells, dendritic cells, or subsets thereof.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) of interest and effectively, directly or indirectly, recruit one of more immune cells.
- the target (e.g. antigen, receptor) of interest can be found on one or more tumor cells.
- the target (e.g. antigen, receptor) of interest can be found on or in the tumor neovasculature.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes may directly or indirectly recruit an immune cell, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes may directly or indirectly recruit an immune cell, e.g. an immune cell that can kill and/or suppress a tumor cell, to a site of action (such as, by way of non-limiting example, the tumor microenvironment).
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have targeting moieties having recognition domains which specifically bind to a target (e.g. antigen, receptor) which is part of a non-cellular structure.
- a target e.g. antigen, receptor
- the antigen or receptor is not an integral component of an intact cell or cellular structure.
- the antigen or receptor is an extracellular antigen or receptor.
- the target is a non-proteinaceous, non-cellular marker, including, without limitation, nucleic acids, inclusive of DNA or RNA, such as, for example, DNA released from necrotic tumor cells or extracellular deposits such as cholesterol.
- the target (e.g. antigen, receptor) of interest is part of the non-cellular component of the stroma or the extracellular matrix (ECM) or the markers associated therewith.
- stroma refers to the connective and supportive framework of a tissue or organ. Stroma may include a compilation of cells such as fibroblasts/myofibroblasts, glial, epithelia, fat, immune, vascular, smooth muscle, and immune cells along with the extracellular matrix (ECM) and extracellular molecules.
- the target (e.g. antigen, receptor) of interest is part of the non-cellular component of the stroma such as the extracellular matrix and extracellular molecules.
- the ECM refers to the non-cellular components present within all tissues and organs.
- the ECM is composed of a large collection of biochemically distinct components including, without limitation, proteins, glycoproteins, proteoglycans, and polysaccharides. These components of the ECM are usually produced by adjacent cells and secreted into the ECM via exocytosis. Once secreted, the ECM components often aggregate to form a complex network of macromolecules.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein chimeric proteins of the invention comprise a targeting moiety that recognizes a target (e.g., an antigen or receptor or non-proteinaceous molecule) located on any component of the ECM.
- Illustrative components of the ECM include, without limitation, the proteoglycans, the non-proteoglycan polysaccharides, fibers, and other ECM proteins or ECM non-proteins, e.g. polysaccharides and/or lipids, or ECM associated molecules (e.g. proteins or non-proteins, e.g. polysaccharides, nucleic acids and/or lipids).
- the targeting moiety recognizes a target (e.g. antigen, receptor) on ECM proteoglycans.
- Proteoglycans are glycosylated proteins.
- the basic proteoglycan unit includes a core protein with one or more covalently attached glycosaminoglycan (GAG) chains.
- GAG glycosaminoglycan chains.
- Proteoglycans have a net negative charge that attracts positively charged sodium ions (Na+), which attracts water molecules via osmosis, keeping the ECM and resident cells hydrated. Proteoglycans may also help to trap and store growth factors within the ECM.
- Illustrative proteoglycans that may be targeted by the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes of the invention include, but are not limited to, heparan sulfate, chondroitin sulfate, and keratan sulfate.
- the targeting moiety recognizes a target (e.g. antigen, receptor) on non proteoglycan polysaccharides such as hyaluronic acid.
- the targeting moiety recognizes a target (e.g. antigen, receptor) on ECM fibers.
- ECM fibers include collagen fibers and elastin fibers.
- the targeting moiety recognizes one or more epitopes on collagens or collagen fibers.
- Collagens are the most abundant proteins in the ECM. Collagens are present in the ECM as fibrillar proteins and provide structural support to resident cells.
- the targeting moiety recognizes and binds to various types of collagens present within the ECM including, without limitation, fibrillar collagens (types I, II, III, V, XI), facit collagens (types IX, XII, XIV), short chain collagens (types VIII, X), basement membrane collagens (type IV), and/or collagen types VI, VII, or XIII.
- Elastin fibers provide elasticity to tissues, allowing them to stretch when needed and then return to their original state.
- the target moiety recognizes one or more epitopes on elastins or elastin fibers.
- the targeting moiety recognizes one or more ECM proteins including, but not limited to, a tenascin, a fibronectin, a fibrin, a laminin, or a nidogen/entactin.
- the targeting moiety recognizes and binds to tenascin.
- the tenascin (TN) family of glycoproteins includes at least four members, tenascin-C, tenascin-R, tenascin-X, and tenascin W.
- the primary structures of tenascin proteins include several common motifs ordered in the same consecutive sequence: amino-terminal heptad repeats, epidermal growth factor (EGF)-like repeats, fibronectin type III domain repeats, and a carboxyl- terminal fibrinogen-like globular domain. Each protein member is associated with typical variations in the number and nature of EGF-like and fibronectin type III repeats.
- Isoform variants also exist particularly with respect to tenascin-C. Over 27 splice variants and/or isoforms of tenascin-C are known. In a particular embodiment, the targeting moiety recognizes and binds to tenascin-CA1 . Similarly, tenascin-R also has various splice variants and isoforms. Tenascin-R usually exists as dimers or trimers. Tenascin-X is the largest member of the tenascin family and is known to exist as trimers. Tenascin-W exists as trimers. In some embodiments, the targeting moiety recognizes one or more epitopes on a tenascin protein. In some embodiments, the targeting moiety recognizes the monomeric and/or the dimeric and/or the trimeric and/or the hexameric forms of a tenascin protein.
- the targeting moieties recognize and bind to fibronectin.
- Fibronectins are glycoproteins that connect cells with collagen fibers in the ECM, allowing cells to move through the ECM. Upon binding to integrins, fibronectins unfold to form functional dimers.
- the targeting moiety recognizes the monomeric and/or the dimeric forms of fibronectin.
- the targeting moiety recognizes one or more epitopes on fibronectin.
- the targeting moiety recognizes fibronectin extracellular domain A (EDA) or fibronectin extracellular domain B (EDB).
- Elevated levels of EDA are associated with various diseases and disorders including psoriasis, rheumatoid arthritis, diabetes, and cancer.
- the targeting moiety recognizes fibronectin that contains the EDA isoform and may be utilized to target the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes to diseased cells including cancer cells.
- the targeting moiety recognizes fibronectin that contains the EDB isoform.
- such targeting moieties may be utilized to target the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes to tumor cells including the tumor neovasculature.
- the targeting moiety recognizes and binds to fibrin.
- Fibrin is another protein substance often found in the matrix network of the ECM. Fibrin is formed by the action of the protease thrombin on fibrinogen which causes the fibrin to polymerize.
- the targeting moiety recognizes one or more epitopes on fibrin. In some embodiments, the targeting moiety recognizes the monomeric as well as the polymerized forms of fibrin.
- the targeting moiety recognizes and binds to laminin.
- Laminin is a major component of the basal lamina, which is a protein network foundation for cells and organs.
- Laminins are heterotrimeric proteins that contain an a-chain, a b-chain, and a y-chain.
- the targeting moiety recognizes one or more epitopes on laminin.
- the targeting moiety recognizes the monomeric, the dimeric as well as the trimeric forms of laminin.
- the targeting moiety recognizes and binds to a nidogen or entactin.
- Nidogens/entactins are a family of highly conserved, sulfated glycoproteins. They make up the major structural component of the basement membranes and function to link laminin and collagen IV networks in basement membranes. Members of this family include nidogen-1 and nidogen-2.
- the targeting moiety recognizes an epitope on nidogen- 1 and/or nidogen-2.
- the targeting moiety comprises an antigen recognition domain that recognizes an epitope present on any of the targets described herein.
- the antigen-recognition domain recognizes one or more linear epitopes present on the protein.
- a linear epitope refers to any continuous sequence of amino acids present on the protein.
- the antigen-recognition domain recognizes one or more conformational epitopes present on the protein.
- a conformation epitope refers to one or more sections of amino acids (which may be discontinuous) which form a three-dimensional surface with features and/or shapes and/or tertiary structures capable of being recognized by an antigen recognition domain.
- the targeting moiety may bind to the full-length and/or mature forms and/or isoforms and/or splice variants and/or fragments and/or any other naturally occurring or synthetic analogs, variants, or mutants of any of the targets described herein.
- the targeting moiety may bind to any forms of the proteins described herein, including monomeric, dimeric, trimeric, tetrameric, heterodimeric, multimeric and associated forms.
- the targeting moiety may bind to any post-translationally modified forms of the proteins described herein, such as glycosylated and/or phosphorylated forms.
- the targeting moiety comprises an antigen recognition domain that recognizes extracellular molecules such as DNA. In some embodiments, the targeting moiety comprises an antigen recognition domain that recognizes DNA. In an embodiment, the DNA is shed into the extracellular space from necrotic or apoptotic tumor cells or other diseased cells.
- the targeting moiety comprises an antigen recognition domain that recognizes one or more non-cellular structures associated with atherosclerotic plaques.
- the fibro-lipid (fibro-fatty) plaque is characterized by an accumulation of lipid-laden cells underneath the intima of the arteries. Beneath the endothelium there is a fibrous cap covering the atheromatous core of the plaque.
- the core includes lipid-laden cells (macrophages and smooth muscle cells) with elevated tissue cholesterol and cholesterol ester content, fibrin, proteoglycans, collagen, elastin, and cellular debris.
- the central core of the plaque usually contains extracellular cholesterol deposits (released from dead cells), which form areas of cholesterol crystals with empty, needle-like clefts.
- extracellular cholesterol deposits released from dead cells
- a fibrous plaque is also localized under the intima, within the wall of the artery resulting in thickening and expansion of the wall and, sometimes, spotty localized narrowing of the lumen with some atrophy of the muscular layer.
- the fibrous plaque contains collagen fibers (eosinophilic), precipitates of calcium (hematoxylinophilic) and lipid-laden cells.
- the targeting moiety recognizes and binds to one or more of the non-cellular components of these plaques such as the fibrin, proteoglycans, collagen, elastin, cellular debris, and calcium or other mineral deposits or precipitates.
- the cellular debris is a nucleic acid, e.g. DNA or RNA, released from dead cells.
- the targeting moiety comprises an antigen recognition domain that recognizes one or more non-cellular structures found in the brain plaques associated with neurodegenerative diseases.
- the targeting moiety recognizes and binds to one or more non-cellular structures located in the amyloid plaques found in the brains of patients with Alzheimer’s disease.
- the targeting moiety may recognize and bind to the peptide amyloid beta, which is a major component of the amyloid plaques.
- the targeting moiety recognizes and binds to one or more non-cellular structures located in the brains plaques found in patients with Huntington’s disease.
- the targeting moiety recognizes and binds to one or more non-cellular structures found in plaques associated with other neurodegenerative or musculoskeletal diseases such as Lewy body dementia and inclusion body myositis.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes of the invention may have two or more targeting moieties that bind to non-cellular structures. In some embodiments, there are two targeting moieties and one targets a cell while the other targets a non-cellular structure. In various embodiments, the targeting moieties can directly or indirectly recruit cells, such as disease cells and/or effector cells. In some embodiments, the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes are capable of, or find use in methods involving, shifting the balance of immune cells in favor of immune attack of a tumor.
- the present chimeric proteins or chimeric protein complexes can shift the ratio of immune cells at a site of clinical importance in favor of cells that can kill and/or suppress a tumor (e.g . T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, dendritic cells, or subsets thereof) and in opposition to cells that protect tumors (e.g.
- a tumor e.g . T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, dendritic cells, or subsets thereof
- a tumor e.g . T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-t
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes are capable of increasing a ratio of effector T cells to regulatory T cells.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with T cells.
- the recognition domains directly or indirectly recruit T cells.
- the recognition domains specifically bind to effector T cells.
- the recognition domain directly or indirectly recruits effector T cells, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- Illustrative effector T cells include cytotoxic T cells (e.g. ab TCR, CD3 + , CD8 + , CD45RO); CD4 + effector T cells (e.g.
- CD8 + effector T cells e.g. ab TCR, CD3 + , CD8 + , CCR7 + , CD62Lhi, IL7R/CD127 +
- effector memory T cells e.g. CD62Llow, CD44 + , TCR, CD3 + , IL7R/CD127 + , IL-15R + , CCR7low
- central memory T cells e.g.
- CD62L + effector T cells CD62L + effector T cells
- CD8 + effector memory T cells TEM including early effector memory T cells (CD27 + CD62L ) and late effector memory T cells (CD27 ⁇ CD62L ) (TemE and TemL, respectively); CD 127 ( + )CD25(low/-) effector T cells; CD127( )CD25( ) effector T cells; CD8 + stem cell memory effector cells (TSCM) (e.g.
- TH1 effector T-cells e.g. CXCR3 + , CXCR6 + and CCR5 + ; or ab TCR, CD3 + , CD4 + , IL-12R + , IFNyR + , CXCR3 +
- TH2 effector T cells e.g. CCR3 + , CCR4 + and CCR8 + ; or ab TCR, CD3 + , CD4 + , IL-4R + , IL-33R + , CCR4 + , IL-17RB + , CRTH2 +
- TH9 effector T cells e.g.
- TH17 effector T cells e.g. ab TCR, CD3 + , CD4 + , IL-23R + , CCR6 + , IL-1 R + ); CD4 + CD45RO + CCR7 + effector T cells, ICOS + effector T cells; CD4 + CD45RO + CCR7( ) effector T cells; and effector T cells secreting IL-2, IL-4 and/or IFN-y.
- Illustrative T cell antigens of interest include, for example (and inclusive of the extracellular domains, where applicable): CD8, CD3, SLAMF4, IL-2Ra, 4-1 BB/TNFRSF9, IL-2 R b, ALCAM, B7-1, IL-4 R, B7-H3, BLAME/SLAMFS, CEACAM1, IL-6 R, CCR3, IL-7 Ra, CCR4, CXCRI/IL-S RA, CCR5, CCR6, IL-IOR a, CCR 7, IL- I 0 R b, CCRS, IL-12 R b 1, CCR9, IL-12 R b 2, CD2, IL-13 R a 1, IL-13, CD3, CD4, ILT2/CDS5j, ILT3/CDS5k, ILT4/CDS5d, ILT5/CDS5a, lutegrin a 4/CD49d, CDS, Integrin a E/CD103, CD6, Integrin a M/CD 11 b, CDS
- the present chimeric proteins or chimeric protein complexes comprise a targeting moiety directed against a checkpoint marker expressed on a T cell, e.g. one or more of PD-1, PD-L1, CD28, CTLA4, ICOS, BTLA, KIR, LAG3, CD 137, 0X40, CD27, CD40L, TIM3, and A2aR.
- a targeting moiety directed against a checkpoint marker expressed on a T cell e.g. one or more of PD-1, PD-L1, CD28, CTLA4, ICOS, BTLA, KIR, LAG3, CD 137, 0X40, CD27, CD40L, TIM3, and A2aR.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with B cells.
- a target e.g. antigen, receptor
- the recognition domains directly or indirectly recruit B cells, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- Illustrative B cell antigens of interest include, for example, CD10, CD19, CD20, CD21, CD22, CD23, CD24, CD37, CD38, CD39, CD40, CD70, CD72, CD73, CD74, CDw75, CDw76, CD77, CD78, CD79a/b, CD80, CD81, CD82, CD83, CD84, CD85, CD86, CD89, CD98, CD126, CD127, CDw130, CD138, CDw150, CS1, and B-cell maturation antigen (BCMA).
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these illustrative B cell antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with Natural Killer cells.
- a target e.g. antigen, receptor
- the recognition domains directly or indirectly recruit Natural Killer cells, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- Illustrative Natural Killer cell antigens of interest include, for example TIGIT, 2B4/SLAMF4, KIR2DS4, CD 155/PVR, KIR3DL1, CD94, LMIR1/CD300A, CD69, LMIR2/CD300C, CRACC/SLAMF7, LMIR3/CD300LF, DNAM-1, LMIR5/CD300LB, Fc-epsilon Rll, LMIR6/CD300LE, Fc-g RI/CD64, MICA, Fc-g RIIB/CD32b, MICB, Fc-g RIIC/CD32c, MULT-1, Fc-g RIIA/CD32a, Nectin-2/CD112, Fc-y RIII/CD16, NKG2A, FcRH 1/IRTA5, NKG2C, FcRH2/IRTA4, NKG2D, FcRH4/IRTA1, NKp30, FcRH5/IRTA2, NK
- the recognition domains specifically bind to a target (e.g . antigen, receptor) associated with macrophages/monocytes.
- a target e.g . antigen, receptor
- the recognition domains directly or indirectly recruit macrophages/monocytes, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- Illustrative macrophages/monocyte antigens of interest include, for example SIRPIa, B7-1/CD80, ILT4/CD85d, B7-H1, ILT5/CD85a, Common b Chain, Integrin a 4/CD49d, BLAME/SLAMF8, Integrin a X/CDIIc, CCL6/C10, Integrin b 2/CD18, CD 155/PVR, Integrin b 3/CD61, CD31/PECAM-1, Latexin, CD36/SR-B3, Leukotriene B4 R1, CD40/TNFRSF5, LIMPIIISR-B2, CD43, LMIR1/CD300A, CD45, LMIR2/CD300c, CD68, LMIR3/CD300LF, CD84/SLAMF5, LMIR5/CD300LB, CD97, LMIR6/CD300LE, CD163, LRP-1, CD2F-10/SLAMF9, MARCO, CRACC/SLAMF7, MD-1
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with dendritic cells.
- a target e.g. antigen, receptor
- the recognition domains directly or indirectly recruit dendritic cells, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- Illustrative dendritic cell antigens of interest include, for example, CLEC9A, XCR1, RANK, CD36/SRB3, LOX-1/SR-E1, CD68, MARCO, CD163, SR-A1/MSR, CD5L, SREC-1, CL-PI/COLEC12, SREC-II, LIMPIIISRB2, RP105, TLR4, TLR1, TLR5, TLR2, TLR6, TLR3, TLR9, 4-IBB Ligand/TN FSF9, IL-12/IL-23 p40, 4- Amino-1 ,8-naphthalimide, ILT2/CD85j, CCL21/6Ckine, ILT3/CD85k, 8-oxo-dG, ILT4/CD85d, 8D6A, ILT5/CD85a, A2B5, lutegrin a 4/CD49d, Aag, Integrin b 2/CD18, AMICA, Langerin, B7-2/CD86, Leukotriene
- the recognition domains specifically bind to a target (e.g . antigen, receptor) on immune cells selected from, but not limited to, megakaryocytes, thrombocytes, erythrocytes, mast cells, basophils, neutrophils, myeloid cells, monocytes, eosinophils, or subsets thereof.
- a target e.g . antigen, receptor
- the recognition domains directly or indirectly recruit megakaryocytes, thrombocytes, erythrocytes, mast cells, basophils, neutrophils, myeloid cells, monocytes, eosinophils, or subsets thereof, e.g., in some embodiments, to a therapeutic site (e.g.
- the immune cell is selected from a T cell, a B cell, a dendritic cell, a macrophage, a neutrophil, a mast cell, a monocyte, a red blood cell, myeloid cell, myeloid derived suppressor cell, a NKT cell, and a NK cell, or derivatives thereof.
- the immune cell is a T cell and the targeting moiety targets CD8.
- the immune cell is a Treg and the targeting moiety targets CTLA4.
- the immune cell is an NK cell and the targeting moiety is NKp46.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with megakaryocytes and/or thrombocytes.
- a target e.g. antigen, receptor
- Illustrative megakaryocyte and/or thrombocyte antigens of interest include, for example, GP llb/llla, GPIb, vWF, PF4, and TSP.
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these illustrative megakaryocyte and/or thrombocyte antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with erythrocytes.
- a target e.g. antigen, receptor
- Illustrative erythrocyte antigens of interest include, for example, CD34, CD36, CD38, CD41 a (platelet glycoprotein llb/llla), CD41 b (GPIIb), CD71 (transferrin receptor), CD105, glycophorin A, glycophorin C, c-kit, HLA- DR, H2 (MHC-II), and Rhesus antigens.
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these illustrative erythrocyte antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with mast cells.
- a target e.g. antigen, receptor
- Illustrative mast cells antigens of interest include, for example, SCFR/CD117, Fc e RI, CD2, CD25, CD35, CD88, CD203c, C5R1, CMAI, FCERIA, FCER2, TPSABI.
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these mast cell antigens.
- the recognition domains specifically bind to a target (e.g . antigen, receptor) associated with basophils.
- a target e.g . antigen, receptor
- basophils antigens of interest include, for example, Fc e RI, CD203c, CD123, CD13, CD107a, CD107b, and CD164.
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these basophil antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with neutrophils.
- a target e.g. antigen, receptor
- neutrophils antigens of interest include, for example, 7D5, CD10/CALLA, CD13, CD16 (FcRIII), CD18 proteins (LFA-1, CR3, and p150, 95), CD45, CD67, and CD177.
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind one or more of these neutrophil antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with eosinophils.
- a target e.g. antigen, receptor
- Illustrative eosinophils antigens of interest include, for example, CD35, CD44 and CD69.
- a targeting moiety of the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes bind one or more of these eosinophil antigens.
- the recognition domain may bind to any appropriate target, antigen, receptor, or cell surface markers known by the skilled artisan.
- the antigen or cell surface marker is a tissue-specific marker.
- tissue-specific markers include, but are not limited to, endothelial cell surface markers such as ACE, CD14, CD34, CDH5, ENG, ICAM2, MCAM, NOS3, PECAMI, PROCR, SELE, SELP, TEK, THBD, VCAMI, VWF; smooth muscle cell surface markers such as ACTA2, MYHIO, MYHI 1, MYH9, MYOCD; fibroblast (stromal) cell surface markers such as ALCAM, CD34, COLIAI, COL1A2, COL3A1, FAP, PH-4; epithelial cell surface markers such as CDID, K6IRS2, KRTIO, KRT13, KRT17, KRT18, KRT19, KRT4, KRT5, KRT8, MUCI, TACSTDI;
- a targeting moiety of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes binds one or more of these antigens. In various embodiments, a targeting moiety of the chimeric proteins or chimeric protein complexes, such as Fc- based chimeric protein complexes, bind one or more of cells having these antigens.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) associated with tumor cells.
- a target e.g. antigen, receptor
- the recognition domains directly or indirectly recruit tumor cells.
- the direct or indirect recruitment of the tumor cell is to one or more effector cell (e.g. an immune cell as described herein) that can kill and/or suppress the tumor cell.
- Tumor cells refer to an uncontrolled growth of cells or tissues and/or an abnormal increase in cell survival and/or inhibition of apoptosis which interferes with the normal functioning of bodily organs and systems.
- tumor cells include benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases.
- Illustrative tumor cells include, but are not limited to cells of: basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); melanoma; myeloma; neuroblastoma; oral cavity cancer (lip, tongue, mouth, and pharynx); ovarian cancer; pancreatic cancer
- Tumor cells, or cancer cells also include, but are not limited to, carcinomas, e.g. various subtypes, including, for example, adenocarcinoma, basal cell carcinoma, squamous cell carcinoma, and transitional cell carcinoma), sarcomas (including, for example, bone and soft tissue), leukemias (including, for example, acute myeloid, acute lymphoblastic, chronic myeloid, chronic lymphocytic, and hairy cell), lymphomas and myelomas (including, for example, Hodgkin and non-Hodgkin lymphomas, light chain, non-secretory, MGUS, and plasmacytomas), and central nervous system cancers (including, for example, brain (e.g. gliomas (e.g.
- astrocytoma oligodendroglioma, and ependymoma
- meningioma meningioma
- pituitary adenoma a neurotrophic factor
- neuromas a neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic factor-derived neurotrophic tumors (e.g. meningiomas and neurofibroma).
- Illustrative tumor antigens include, but are not limited to, MART-1/Melan-A, gp100, Dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, Colorectal associated antigen (CRC)-0017- 1A/GA733, Carcinoembryonic Antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1, Prostate Specific Antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, prostate-specific membrane antigen (PSMA), T-cell receptor/CD3-zeta chain, MAGE-family of tumor antigens (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-A10, MAGE
- a targeting moiety of the chimeric proteins or chimeric protein complexes bind one or more of these tumor antigens.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind to HER2.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, bind to PD-L2.
- the present chimeric proteins or chimeric protein complexes have one or more of the targeting moieties which is directed against an immune cell selected from a T cell, a B cell, a dendritic cell, a neutrophil, a myeloid derived suppressor cell, a macrophage, a NK cell, or subsets thereof, along with any of the signaling agents (e.g., modified IL-2) described herein.
- an immune cell selected from a T cell, a B cell, a dendritic cell, a neutrophil, a myeloid derived suppressor cell, a macrophage, a NK cell, or subsets thereof, along with any of the signaling agents (e.g., modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a T cell (including, without limitation an effector T cell), along with any of the signaling agents described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a B cell, along with any of the signaling agents described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, along with any of the signaling agents described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a macrophage, along with any of the signaling agents described herein. In one embodiment, the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a NK cell, along with any of the signaling agents described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a T cell, for example, mediated by targeting to CD8, SLAMF4, IL-2 R a, 4-1 BB/TNFRSF9, IL-2 R b, ALCAM, B7-1, IL-4 R, B7- H3, BLAME/SLAMFS, CEACAM1, IL-6 R, CCR3, IL-7 Ra, CCR4, CXCRI/IL-S RA, CCR5, CCR6, IL-10R a, CCR 7, IL-I O R b, OCRS, IL-12 R b 1, CCR9, IL-12 R b 2, CD2, IL-13 Ra 1, IL-13, CD3, CD4, ILT2/CDS5j, ILT3/CDS5k, ILT4/CDS5d, ILT5/CDS5a, lutegrin a 4/CD49d, CD8, SLAMF4, IL-2 R a,
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a checkpoint marker expressed on a T cell, e.g. one or more of PD-1, CD28, CTLA4, ICOS, BTLA, KIR, LAG3, CD137, 0X40, CD27, CD40L, TIM3, and A2aR, along with any of the signaling agents described herein.
- a targeting moiety directed against a checkpoint marker expressed on a T cell e.g. one or more of PD-1, CD28, CTLA4, ICOS, BTLA, KIR, LAG3, CD137, 0X40, CD27, CD40L, TIM3, and A2aR, along with any of the signaling agents described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties directed against PD-1 .
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties which selectively bind a PD-1 polypeptide.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes comprise one or more antibodies, antibody derivatives or formats, peptides or polypeptides, or fusion proteins that selectively bind a PD-1 polypeptide.
- the targeting moiety comprises the anti-PD-1 antibody pembrolizumab (aka MK-3475, KEYTRUDA), or fragments thereof.
- pembrolizumab and other humanized anti-PD-1 antibodies are disclosed in Hamid, et al. (2013) New England Journal of Medicine 369 (2): 134-44, US 8,354,509, and WO 2009/114335, the entire disclosures of which are hereby incorporated by reference.
- pembrolizumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 7 and/or a light chain comprising the amino acid sequence of SEQ ID NO: 8.
- the targeting moiety comprises the anti-PD-1 antibody, nivolumab (aka BMS-936558, MDX- 1106, ONO-4538, OPDIVO), orfragments thereof.
- nivolumab clone 5C4
- other human monoclonal antibodies that specifically bind to PD-1 are disclosed in US 8,008,449 and WO 2006/121168, the entire disclosures of which are hereby incorporated by reference.
- nivolumab or an antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 9 and/or a light chain comprising the amino acid sequence of SEQ ID NO: 10.
- the targeting moiety comprises the anti-PD-1 antibody pidilizumab (aka CT-011, hBAT or hBAT- 1), or fragments thereof.
- pidilizumab aka CT-011, hBAT or hBAT- 1
- pidilizumab and other humanized anti-PD-l monoclonal antibodies are disclosed in US 2008/0025980 and WO 2009/101611, the entire disclosures of which are hereby incorporated by reference.
- the anti-PD-1 antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a light chain variable regions comprising an amino acid sequence selected from SEQ ID NOs: 15-18 of US 2008/0025980: SEQ ID NO: 15 of US 2008/0025980 (SEQ ID NO: 11); SEQ ID NO: 16 of US 2008/0025980 (SEQ ID NO: 12);SEQ ID NO: 17 of US 2008/0025980 (SEQ ID NO: 13); and SEQ ID NO: 18 of US 2008/0025980 (SEQ ID NO: 14) ;and/or a heavy chain comprising an amino acid sequence selected from SEQ ID NOs: 20-24 of US 2008/0025980: SEQ ID NO: 20 of US 2008/0025980 (SEQ ID NO: 15); SEQ ID NO: 21 of US 2008/0025980 (SEQ ID NO: 16); SEQ ID NO: 22 of US 2008/0025980 (SEQ ID NO: 17); SEQ
- the targeting moiety comprises a light chain comprising SEQ ID NO: 18 of US 2008/0025980 (SEQ ID NO: 14) and a heavy chain comprising SEQ ID NO: 22 of US 2008/0025980 (SEQ ID NO: 17).
- the targeting moiety comprises AMP-514 (aka MEDI-0680).
- the targeting moiety comprises the PD-L2-Fc fusion protein AMP-224, which is disclosed in W02010/027827 and WO 2011/066342, the entire disclosures of which are hereby incorporated by reference.
- the targeting moiety may include a targeting domain which comprises SEQ ID NO:4 of W02010/027827 (SEQ ID NO: 20) and/or the B7-DC fusion protein which comprises SEQ ID NO:83 of WO2010/027827 (SEQ ID NO: 21).
- the targeting moiety comprises the PD-L1-Fc fusion protein and/or the PD-1-Fc fusion protein, as described in WO 2019/191519.
- the targeting moiety comprises the peptide AUNP 12 or any of the other peptides disclosed in US 2011/0318373 or 8,907,053.
- the targeting moiety may comprise AUNP 12 (/.e., Compound 8 or SEQ ID NO:49 of US 2011/0318373) which has the sequence of:
- the targeting moiety comprises the anti-PD-1 antibody 1E3, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 1 E3 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 23; and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 24.
- the targeting moiety comprises the anti-PD-1 antibody 1E8, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 1 E8 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 25 and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 26.
- the targeting moiety comprises the anti-PD-1 antibody 1 H3, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 1 H3 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 27 and/or light chain variable region comprising the amino acid sequence of SEQ ID NO: 28.
- the targeting moiety comprises a VHH directed against PD-1 as disclosed, for example, in US 8,907,065 and WO 2008/071447, the entire disclosures of which are hereby incorporated by reference.
- the VHHs against PD-1 comprise SEQ ID NOs: 347-351 of US 8,907,065 (SEQ ID NO: 347 of US 8,907,065 (SEQ ID NO: 29); SEQ ID NO: 348 of US 8,907,065 (SEQ ID NO:30); SEQ ID NO: 349 of US 8,907,065 (SEQ ID NO:31); SEQ ID NO: 350 of US 8,907,065 (SEQ ID NO: 32); and SEQ ID NO: 351 of US 8,907,065 (SEQ ID NO:33)).
- the targeting moiety comprises any one of the anti-PD-1 antibodies, or fragments thereof, as disclosed in US2011/0271358 and WO2010/036959, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID NOs: 25-29 of US2011/0271358 (SEQ ID NO: 25 of US2011/0271358 (SEQ ID NO:34); SEQ ID NO: 26 of US2011/0271358 (SEQ ID NO:35); SEQ ID NO: 27 of US2011/0271358 (SEQ ID NO:36); SEQ ID NO: 28 of US2011/0271358 (SEQ ID NO:37);and SEQ ID NO: 29 of US2011/0271358 (SEQ ID NO:38));and/or a light chain comprising an amino acid sequence selected from SEQ ID NOs: 30-33 of US2011/0271358 (SEQ ID NO: 25
- the present chimeric proteins or chimeric protein complexes comprise one or more antibodies directed against PD-1, or antibody fragments thereof, selected from TSR-042 (Tesaro, Inc.), REGN2810 (Regeneron Pharmaceuticals, Inc.), PDR001 (Novartis Pharmaceuticals), and BGB-A317 (BeiGene Ltd.).
- the present chimeric proteins or chimeric protein complexes have one or more targeting moieties directed against PD-L1.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes have one or more targeting moieties which selectively bind a PD-L1 polypeptide.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes comprise one or more antibodies, antibody derivatives or formats, peptides or polypeptides, or fusion proteins that selectively bind a PD-L1 polypeptide.
- the targeting moiety comprises the anti-PD-L1 antibody MEDI4736 (aka durvalumab), or fragments thereof.
- MEDI4736 is selective for PD-L1 and blocks the binding of PD-L1 to the PD-1 and CD80 receptors.
- MEDI4736 and antigen-binding fragments thereof for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region.
- the sequence of MEDI4736 is disclosed in WO/2017/06272, the entire contents of which are hereby incorporated by reference.
- MEDI4736 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:43; and/or a light chain comprising the amino acid sequence of SEQ ID NO:44.
- the MEDI4736 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:4 of WO/2017/06272 (SEQ ID NO:45); and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO:3 of WO/2017/06272 (SEQ ID NO:46).
- the targeting moiety comprises the anti-PD-L1 antibody atezolizumab (aka MPDL3280A, RG7446), or fragments thereof.
- atezolizumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:47; and/or a light chain comprising the amino acid sequence of SEQ ID NO:48.
- the targeting moiety comprises the anti-PD-L1 antibody avelumab (aka MSB0010718C), or fragments thereof.
- avelumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO:49; and/or a light chain comprising the amino acid sequence of SEQ ID NO:50.
- the targeting moiety comprises the anti-PD-L1 antibody BMS-936559 (aka 12A4, MDX-1105), or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- BMS-936559 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of: (SEQ ID NO:51); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO:52).
- the targeting moiety comprises the anti-PD-L1 antibody 3G10, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 3G10 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 53); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 54).
- the targeting moiety comprises the anti-PD-L1 antibody 10A5, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 10A5 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 55); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 56).
- the targeting moiety comprises the anti-PD-L1 antibody 5F8, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 5F8 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 57); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 58).
- the targeting moiety comprises the anti-PD-L1 antibody 10H10, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 10H10 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 59); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 60).
- the targeting moiety comprises the anti-PD-L1 antibody 1B12, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 1B12 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 61); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 62).
- the targeting moiety comprises the anti-PD-L1 antibody 7H1 , or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 7H1 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 63); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 64).
- the targeting moiety comprises the anti-PD-L1 antibody 11 E6, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 11E6 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 65); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 66).
- the targeting moiety comprises the anti-PD-L1 antibody 12B7, or fragments thereof, as disclosed in US 2013/0309250 and W02007/005874, the entire disclosures of which are hereby incorporated by reference.
- 12B7 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 67); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 68).
- the targeting moiety comprises the anti-PD-L1 antibody 13G4, or fragments thereof, as disclosed in US 2013/0309250 and WQ2007/005874, the entire disclosures of which are hereby incorporated by reference.
- 13G4 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 69); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 70).
- the targeting moiety comprises the anti-PD-L1 antibody 1E12, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 1E12 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 71); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 72).
- the targeting moiety comprises the anti-PD-L1 antibody 1F4, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 1F4 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 73); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 74).
- the targeting moiety comprises the anti-PD-L1 antibody 2G11, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 2G11 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 75); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 76).
- the targeting moiety comprises the anti-PD-L1 antibody 3B6, or fragments thereof, as disclosed in US 2014/0044738, the entire disclosures of which are hereby incorporated by reference.
- 3B6 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 77); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 78).
- the targeting moiety comprises the anti-PD-L1 antibody 3D10, or fragments thereof, as disclosed in US 2014/0044738 and WO2012/145493, the entire disclosures of which are hereby incorporated by reference.
- 3D10 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of (SEQ ID NO: 79); and/or a light chain variable region comprising the amino acid sequence of (SEQ ID NO: 80).
- the targeting moiety comprises any one of the anti-PD-L1 antibodies disclosed in US2011/0271358 and WO2010/036959, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 34-38 of US2011/0271358 (SEQ ID No: 34 of US2011/0271358 (SEQ ID NO: 81); SEQ ID No: 35 of US2011/0271358 (SEQ ID NO: 82); SEQ ID No: 36 of US2011/0271358 (SEQ ID NO: 83); SEQ ID No: 37 of US2011/0271358 (SEQ ID NO: 84); and SEQ ID No: 38 of US2011/0271358 (SEQ ID NO: 85)); and/or a light chain comprising an amino acid sequence selected from SEQ ID Nos: 39-42 of US2011/0
- the targeting moiety comprises the anti-PD-L1 antibody 2.7A4, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.7A4 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 2 of WO 2011/066389 (SEQ ID NO: 90); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 7 of WO 2011/066389 (SEQ ID NO: 91).
- the targeting moiety comprises the anti-PD-L1 antibody 2.9D10, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.9D10 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 12 of WO 2011/066389 (SEQ ID NO: 92); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 17 of WO 2011/066389 (SEQ ID NO: 93).
- the targeting moiety comprises the anti-PD-L1 antibody 2.14H9, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.14H9 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 22 of WO 2011/066389 (SEQ ID NO: 94); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 27 of WO 2011/066389 (SEQ ID NO: 95).
- the targeting moiety comprises the anti-PD-L1 antibody 2.20A8, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.20A8 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 32 of WO 2011/066389 (SEQ ID NO: 96); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 37 of WO 2011/066389 (SEQ ID NO: 97).
- the targeting moiety comprises the anti-PD-L1 antibody 3.15G8, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 3.15G8 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 42 of WO 2011/066389 (SEQ ID NO: 98); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 47 of WO 2011/066389 (SEQ ID NO: 99).
- the targeting moiety comprises the anti-PD-L1 antibody 3.18G1, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 3.18G1 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 52 of WO 2011/066389 (SEQ ID NO: 100); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 57 of WO 2011/066389 (SEQ ID NO: 101).
- the targeting moiety comprises the anti-PD-L1 antibody 2.7A40PT, or fragments thereof, as disclosed in WO 2011/066389, US8,779,108, and US2014/0356353, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.7A40PT or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 62 of WO 2011/066389 (SEQ ID NO: 102); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 67 of WO 2011/066389 (SEQ ID NO:103).
- the targeting moiety comprises the anti-PD-L1 antibody 2.14H90PT, or fragments thereof, as disclosed in WO 2011/066389, US8,779, 108, and US2014/0356353, the entire disclosures of which are hereby incorporated by reference.
- 2.14H90PT or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID No: 72 of WO 2011/066389 (SEQ ID NO: 104); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 77 of WO 2011/066389 (SEQ ID NO:105).
- the targeting moiety comprises any one of the anti-PD-L1 antibodies disclosed in WO2016/061142, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 18, 30, 38, 46, 50, 54, 62, 70, and 78 of WO2016/061142 (SEQ ID No: 18 of WO2016/061142 (SEQ ID NO:106); SEQ ID No: 30 of WO2016/061142 (SEQ ID NO: 107); SEQ ID No: 38 of WO2016/061142 (SEQ ID NO:108); SEQ ID No: 46 of WO2016/061142 (SEQ ID NO: 109); SEQ ID No: 50 of W02016/061142 (SEQ ID NO:110); SEQ ID No: 54 of W02016/061142 (SEQ ID NO:111); SEQ ID No:
- the targeting moiety comprises any one of the anti-PD-L1 antibodies disclosed in WO2016/022630, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, and 46 of WO2016/022630 ( SEQ ID No: 2 of WO2016/022630 (SEQ ID NO: 124); SEQ ID No: 6 of WO2016/022630 (SEQ ID NO: 125); SEQ ID No: 10 of WO2016/022630 (SEQ ID NO: 126); SEQ ID No: 14 of WO2016/022630 (SEQ ID NO: 127); SEQ ID No: 18 of W02016/022630 (SEQ ID NO:128); SEQ ID No: 22 of W02016/022630 (SEQ ID NO: 129); SEQ
- the targeting moiety comprises any one of the anti-PD-L1 antibodies disclosed in WO2015/112900, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 38, 50, 82, and 86 of WO 2015/112900 (SEQ ID No: 38 of WO2015/112900 (SEQ ID NO:148); SEQ ID No: 50 of WO 2015/112900 (SEQ ID NO:149); SEQ ID No: 82 of WO 2015/112900 (SEQ ID NO: 150); and SEQ ID No: 86 of WO 2015/112900 (SEQ ID NO: 151)); and/or a light chain comprising an amino acid sequence selected from SEQ ID Nos: 42, 46, 54, 58, 62, 66, 70, 74, and 78 of WO 2015/112900 (SEQ ID No: 42 of
- the targeting moiety comprises any one of the anti-PD-L1 antibodies disclosed in WO 2010/077634 and US 8,217,149, the entire disclosures of which are hereby incorporated by reference.
- the anti-PD-L1 antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain region comprising the amino acid sequence of SEQ ID No: 20 of WO 2010/077634 (SEQ ID NO: 161); and/or a light chain variable region comprising the amino acid sequence of SEQ ID No: 21 of WO 2010/077634 (SEQ ID NO: 162).
- the targeting moiety comprises any one of the anti-PD-L1 antibodies obtainable from the hybridoma accessible under CNCM deposit numbers CNCM 1-4122, CNCM I-4080 and CNCM 1-4081 as disclosed in US 20120039906, the entire disclosures of which are hereby incorporated by reference.
- the targeting moiety comprises a VHH directed against PD-L1 as disclosed, for example, in US 8,907,065 and WO 2008/071447, the entire disclosures of which are hereby incorporated by reference.
- the VHHs against PD-L1 comprise SEQ ID NOS: 394-399 of US 8,907,065 (SEQ ID No: 394 of US 8,907,065 (SEQ ID NO:163); SEQ ID No: 395 of US 8,907,065 (SEQ ID NO:164); SEQ ID No: 396 of US 8,907,065 (SEQ ID NO: 165); SEQ ID No: 397 of US 8,907,065 (SEQ ID NO: 166); SEQ ID No: 398 of US 8,907,065 (SEQ ID NO:167); and SEQ ID No: 399 of US 8,907,065 (SEQ ID NO:168)).
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties directed against PD-L2.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties which selectively bind a PD-L2 polypeptide.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes comprise one or more antibodies, antibody derivatives or formats, peptides or polypeptides, or fusion proteins that selectively bind a PD-L2 polypeptide.
- the targeting moiety comprises a VH FI directed against PD-L2 as disclosed, for example, in US 8,907,065 and WO 2008/071447, the entire disclosures of which are hereby incorporated by reference.
- the VHHs against PD-L2 comprise SEQ ID Nos: 449-455 of US 8,907,065 (SEQ ID No: 449 of US 8,907,065 (SEQ ID NO:169); SEQ ID No: 450 of US 8,907,065 (SEQ ID NO:170); SEQ ID No: 451 of US 8,907,065 (SEQ ID NO: 171); SEQ ID No: 452 of US 8,907,065 (SEQ ID NO: 172); SEQ ID No: 453 of US 8,907,065 (SEQ ID NO: 173); SEQ ID No: 454 of US 8,907,065 (SEQ ID NO: 174); and SEQ ID No: 455 of US 8,907,
- the targeting moiety comprises any one of the anti-PD-L2 antibodies disclosed in US2011/0271358 and WO2010/036959, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 43-47 of US2011/0271358 (SEQ ID No: 43 of US2011/0271358 (SEQ ID NO:176); SEQ ID No: 44 of US2011/0271358 (SEQ ID NO: 177); SEQ ID No: 45 of US2011/0271358 (SEQ ID NO:178); SEQ ID No: 46 of US2011/0271358 (SEQ ID NO: 179); and SEQ ID No: 47 of US2011/0271358 (SEQ ID NO: 180)); and/or a light chain comprising an amino acid sequence selected from SEQ ID Nos: 48-51 of US2011/0271358 (SEQ ID No: 43 of US
- the targeting moieties of the invention may comprise a sequence that targets PD-1, PD- L1 , and/or PD-L2 which is at least about 60%, at least about 61 %, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%
- the targeting moieties of the invention may comprise any combination of heavy chain, light chain, heavy chain variable region, light chain variable region, complementarity determining region (CDR), and framework region sequences that target PD-1, PD-L1, and/or PD-L2 as disclosed herein.
- CDR complementarity determining region
- Additional antibodies, antibody derivatives or formats, peptides or polypeptides, or fusion proteins that selectively bind or target PD-1, PD-L1 and/or PD-L2 are disclosed in WO 2011/066389, US 2008/0025980, US 2013/0034559, US 8,779,108, US 2014/0356353, US 8,609,089, US 2010/028330, US 2012/0114649, WO 2010/027827, WO 2011/066342, US 8,907,065, WO 2016/062722, WO 2009/101611, WO2010/027827, WO 2011/066342, WO 2007/005874 , WO 2001/014556, US2011/0271358, WO 2010/036959, WO 2010/077634, US 8,217,149, US 2012/0039906, WO 2012/145493, US 2011/0318373, U.S.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes
- have a targeting moiety directed against a T cell for example, mediated by targeting to CD8, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, have a targeting moiety directed against CD8 on T cells.
- the targeting moiety directed against CD8 comprises a VHH comprising the amino acid sequence of:
- the targeting moiety directed against CD8 comprises a VHH comprising the amino acid sequence of: EVQLVESGGGLVQPGGSLRLSCAASGFTFDDYVIGWFRQAPGKGREGVACIRIFDRHTYYAD SVKGRFTISSDNSKNTVYLQMNSLRAEDTATYYCAAGSFFGCTRPEGDMDYFGQGTLVQVQ SA (SEQ ID NO: 455).
- the targeting moiety directed against CD8 comprises a VHH comprising the amino acid sequence of:
- the targeting moieties of the invention may comprise a sequence that targets CD8 which is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81 %, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97%, at least
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a T cell, for example, mediated by targeting to CD4, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, have a targeting moiety directed against CD4 on T cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, have a targeting moiety directed against a T cell, for example, mediated by targeting to CD3, CXCR3, CCR4, CCR9, CD70, CD103, or one or more immune checkpoint markers, along with any of the signaling agents (e.g., modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against CD3 on T cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties directed against CD3 expressed on T cells.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have one or more targeting moieties which selectively bind a CD3 polypeptide.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes comprise one or more antibodies, antibody derivatives or formats, peptides or polypeptides, or fusion proteins that selectively bind a CD3 polypeptide.
- the targeting moiety comprises the anti-CD3 antibody muromonab-CD3 (aka Orthoclone OKT3), or fragments thereof.
- Muromonab-CD3 is disclosed in U.S. Patent No. 4,361,549 and Wilde ef at. (1996) 51 :865-894, the entire disclosures of which are hereby incorporated by reference.
- muromonab-CD3 or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of (SEQ ID NO: 185); and/or a light chain comprising the amino acid sequence of (SEQ ID NO: 186).
- the targeting moiety comprises the anti-CD3 antibody otelixizumab, or fragments thereof.
- Otelixizumab is disclosed in U.S. Patent Publication No. 20160000916 and Chatenoud etal. (2012) 9:372-381, the entire disclosures of which are hereby incorporated by reference.
- otelixizumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of: SEQ ID NO:187; and/or a light chain comprising the amino acid sequence of SEQ ID NO: 188.
- the targeting moiety comprises the anti-CD3 antibody teplizumab (AKA MGA031 and hOKT3y1 (Ala-Ala)), or fragments thereof.
- Teplizumab is disclosed in Chatenoud etal. (2012) 9:372-381, the entire disclosures of which are hereby incorporated by reference.
- teplizumab or an antigen binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 189; and/or a light chain comprising the amino acid sequence of SEQ ID NO: 190.
- the targeting moiety comprises the anti-CD3 antibody visilizumab (AKA Nuvion®; HuM291), or fragments thereof.
- Visilizumab is disclosed in U.S. 5,834,597 and W02004052397, and Cole ef a/., Transplantation (1999) 68:563-571, the entire disclosures of which are hereby incorporated by reference.
- visilizumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 191 ; and/or a light chain variable region comprising the amino acid sequence of SEQ ID NO: 192.
- the targeting moiety comprises the anti-CD3 antibody foralumab (aka NI-0401), or fragments thereof.
- the targeting moiety comprises any one of the anti-CD3 antibodies disclosed in US20140193399, US 7,728,114, US20100183554, and US 8,551,478, the entire disclosures of which are hereby incorporated by reference.
- the anti-CD3 antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID Nos: 2 and 6 of US 7,728,114 (SEQ ID No: 2 of US 7,728,114 (SEQ ID NO:193) and SEQ ID No: 6 of US 7,728,114 (SEQ ID NO: 194)); and/or a light chain variable region comprising the amino acid sequence of SEQ ID NOs 4 and 8 of US 7,728,114 (SEQ ID No: 4 of US 7,728,114 (SEQ ID NO:195) and SEQ ID No: 8 of US 7,728,114 (SEQ ID NO: 196)).
- the targeting moiety comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO:2 of US 7,728,114 and a light chain variable region comprising the amino acid sequence of SEQ ID NO:4 of US 7,728,114.
- the targeting moiety comprises any one of the anti-CD3 antibodies disclosed in US2016/0168247, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 6-9 of US2016/0168247 (SEQ ID No: 6 of US2016/0168247 (SEQ ID NO:197); SEQ ID No: 7 of US2016/0168247 (SEQ ID NO: 198); SEQ ID No: 8 of US2016/0168247 (SEQ ID NO:199); and SEQ ID No: 9 of US2016/0168247 (SEQ ID NO:200)); and/or a light chain comprising an amino acid sequence selected from SEQ ID Nos: 10-12 of US2016/0168247 (SEQ ID No: 10 of US2016/0168247 (SEQ ID NO:201); SEQ ID No: 11 of US2016/0168247 (SEQ ID NO:202); and SEQ ID No: 12 of US2016/0168247 (SEQ ID NO:203)).
- the targeting moiety comprises any one of the anti-CD3 antibodies disclosed in US2015/0175699, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID No: 9 of US2015/0175699 (SEQ ID NO:204); and/or a light chain comprising an amino acid sequence selected from SEQ ID No: 10 of US2015/0175699 (SEQ ID NO:205).
- the targeting moiety comprises any one of the anti-CD3 antibodies disclosed in US 8,784,821 , the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 2, 18, 34, 50, 66, 82, 98 and 114 of US 8,784,821 (SEQ ID No: 2 of US 8,784,821 (SEQ ID NO:206); SEQ ID No: 18 of US 8,784,821 (SEQ ID NO:207); SEQ ID No: 34 of US 8,784,821 (SEQ ID NO:208); SEQ ID No: 50 of US 8,784,821 (SEQ ID NO:209); SEQ ID No: 66 of US 8,784,821 (SEQ ID NO:210); SEQ ID No: 82 of US 8,784,821 (SEQ ID NO:211); SEQ ID No: 98 of US 8,784,82
- the targeting moiety comprises any one of the anti-CD3 binding constructs disclosed in US20150118252, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 6 and 86 of US20150118252 (SEQ ID No: 6 of US20150118252 (SEQ ID NO:222) and SEQ ID No: 86 of US20150118252 (SEQ ID NO:223)) and/or a light chain comprising an amino acid sequence selected from SEQ ID No: 3 of US2015/0175699 (SEQ ID No: 3 of US20150118252 (SEQ ID NO:224)).
- the targeting moiety comprises any one of the anti-CD3 binding proteins disclosed in US2016/0039934, the entire contents of which are hereby incorporated by reference.
- the antibody or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain comprising an amino acid sequence selected from SEQ ID Nos: 6-9 of US2016/0039934 (SEQ ID No: 6 of US2016/0039934 (SEQ ID NO:225); SEQ ID No: 7 of US2016/0039934 (SEQ ID NO:226); SEQ ID No: 8 of US2016/0039934 (SEQ ID NO:227); and SEQ ID No: 9 of US2016/0039934 (SEQ ID NO:228)); and/or a light chain comprising an amino acid sequence selected from SEQ ID Nos: 1-4 of US2016/0039934 (SEQ ID No: 1 of US2016/0039934 (SEQ ID NO:229); SEQ ID No: 2 of US2016
- the targeting moieties of the invention may comprise a sequence that targets CD3 which is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81 %, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 95%, at least
- the targeting moieties of the invention may comprise any combination of heavy chain, light chain, heavy chain variable region, light chain variable region, complementarity determining region (CDR), and framework region sequences that target CD3 as disclosed herein.
- the targeting moieties of the invention may comprise any heavy chain, light chain, heavy chain variable region, light chain variable region, complementarity determining region (CDR), and framework region sequences of the CD3-specific antibodies including, but not limited to, X35-3, VIT3, BMA030 (BW264/56), CLB-T3/3, CRIS7, YTH12.5, F1 11-409, CLB-T3.4.2, TR-66, WT32, SPv-T3b, 11D8, XIII-141, XIII-46, XIII-87, 12F6, T3/RW2-8C8, T3/RW2-4B6, OKT3D, M-T301, SMC2, WT31 and F101.01.
- CD3-specific antibodies are well known in the art and,
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have (a targeting moiety directed against a T cell, for example, mediated by targeting to PD-1, along with any of the signaling agents (e.g ., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a B cell, for example, mediated by targeting to CD10, CD19, CD20, CD21, CD22, CD23, CD24, CD37, CD38, CD39, CD40, CD70, CD72, CD73, CD74, CDw75, CDw76, CD77, CD78, CD79a/b, CD80, CD81, CD82, CD83, CD84, CD85, CD86, CD89, CD98, CD126, CD127, CDw130, CD138, or CDw150; along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against CD20.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a B cell, for example, mediated by targeting to CD 19, CD20 or CD70, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- a targeting moiety directed against a B cell, for example, mediated by targeting to CD 19, CD20 or CD70, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a B cell, for example, mediated by targeting to CD20, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against CD20 on B cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the CD20 targeting moiety is a recombinant heavy-chain-only antibody (VHH) having the sequence of:
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a NK cell, for example, mediated by targeting to 2B4/SLAMF4, KIR2DS4, CD155/PVR, KIR3DL1, CD94, LMIR1/CD300A, CD69, LMIR2/CD300c, CRACC/SLAMF7, LMIR3/CD300LF, D NAM-1, LMIR5/CD300LB, Fc-epsilon Rll, LMIR6/CD300LE, Fc-g RI/CD64, MICA, Fc-g RIIB/CD32b, MICB, Fc-g RIIC/CD32c, MULT-1, Fc-g RIIA/CD32a, Nectin-2/CD112, Fc-g RIII/CD16, NKG2A, FcRH 1/IRTA5, NKG2
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a NK cell, for example, mediated by targeting to Kiri alpha, DNAM-1 or CD64, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- a targeting moiety directed against a NK cell, for example, mediated by targeting to Kiri alpha, DNAM-1 or CD64, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a NK cell, for example, mediated by targeting to TIGIT or KIR1 , along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against TIGIT on NK cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, for example, mediated by targeting to CLEC-9A, XCR1, RANK, CD36/SRB3, LOX-1/SR-E1, CD68, MARCO, CD 163, SR-A1/MSR, CD5L, SREC-1, CL-PI/COLEC 12, SREC-II, LIMPIIISRB2, RP105, TLR4, TLR1, TLR5, TLR2, TLR6, TLR3, TLR9, 4-IBB Ligand/TNFSF9, IL-12/IL-23 p40, 4-Amino-1,8-naphthalimide, ILT2/CD85j, CCL21/6Ckine, ILT3/CD85k, 8-oxo-dG, ILT4/CD85d, 8D6A, ILT5/CD85a, A2B5,
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, for example, mediated by targeting to CLEC- 9A, DC-SIGN, CD64, CLEC4A, or DEC205, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against CLEC9A on dendritic cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, for example, mediated by targeting to CLEC9A, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against CLEC9A on dendritic cells and a second targeting moiety directed against PD-L1 or PD- L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, for example, mediated by targeting to XCR1, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against XCR1 on dendritic cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a dendritic cell, for example, mediated by targeting to RANK, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against RANK on dendritic cells and a second targeting moiety directed against PD-L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a monocyte/macrophage, for example, mediated by targeting to SIRP1 a, B7-1/CD80, ILT4/CD85d, B7-H 1 , ILT5/CD85a, Common b Chain, Integrin a 4/CD49d, BLAME/SLAMF8, Integrin a X/CDIIc, CCL6/C10, Integrin b 2/CD 18, CD 155/PVR, Integrin b 3/CD61, CD31/PECAM-1, Latexin, CD36/SR-B3, Leukotriene B4 R1, CD40/TNFRSF5, LIMPIIISR-B2, CD43, LMIR1/CD300A, CD45, LMIR2/CD300c, CD68, LMIR3/CD300LF, CD84/SLAMF5, LMIR5/
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a targeting moiety directed against a monocyte/macrophage, for example, mediated by targeting to B7-H 1 , CD31/PECAM-1, CD163, CCR2, or Macrophage Mannose Receptor CD206, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has a targeting moiety directed against a monocyte/macrophage, for example, mediated by targeting to SIRP1 a, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has a targeting moiety directed against SIRP1 a on macrophage cells and a second targeting moiety directed against PD- L1 or PD-L2 on tumor cells.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has one or more targeting moieties directed against a checkpoint marker, e.g. one or more of PD- 1/PD-L1 or PD-L2, CD28/CD80 or CD86, CTLA4/ CD80 or CD86, ICOS/ICOSL or B7RP1, BTLA/HVEM, KIR, LAG3, CD137/CD137L, OX40/OX40L, CD27, CD40L, TIM3/Gal9, CD47, CD70, and A2aR, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- a checkpoint marker e.g. one or more of PD- 1/PD-L1 or PD-L2, CD28/CD80 or CD86, CTLA4/ CD80 or CD86, ICOS/ICOSL or B7RP1, BTLA/HVEM, KIR, LAG3, CD137/
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has one or more targeting moieties directed against an immune cell selected from a T cell, a B cell, a dendritic cell, a macrophage, a NK cell, or subsets thereof, along with any of the signaling agents (e.g., a modified IL-2) described herein.
- the targeting moiety may bind to any of the tumor antigens described herein.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention comprise one or more targeting moieties having recognition domains that bind to a target (e.g. antigen, receptor) of interest including those found on one or more cells selected from adipocytes (e.g., white fat cell, brown fat cell), liver lipocytes, hepatic cells, kidney cells (e.g., kidney parietal cell, kidney salivary gland, mammary gland, etc.), duct cells (of seminal vesicle, prostate gland, etc.), intestinal brush border cells (with microvilli), exocrine gland striated duct cells, gall bladder epithelial cells, ductulus efferens nonciliated cells, epididymal principal cells, epididymal basal cells, endothelial cells, ameloblast epithelial cells (tooth enamel secretion), planum semilunatum epithelial cells of vestib
- the targeting moiety of the present chimeric proteins or chimeric protein complexes are protein-based agents capable of specific binding, such as an antibodies or derivatives thereof.
- the targeting moiety comprises an antibody.
- the antibody is a full-length multimeric protein that includes two heavy chains and two light chains. Each heavy chain includes one variable region (e.g., VH) and at least three constant regions (e.g., CHi, CH2 and CH3), and each light chain includes one variable region ( ⁇ ) and one constant region (CL). The variable regions determine the specificity of the antibody.
- Each variable region comprises three hypervariable regions also known as complementarity determining regions (CDRs) flanked by four relatively conserved framework regions (FRs).
- CDRs complementarity determining regions
- FRs relatively conserved framework regions
- the three CDRs, referred to as CDR1, CDR2, and CDR3, contribute to the antibody binding specificity.
- the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody.
- the targeting moiety comprises antibody derivatives or formats.
- the targeting moiety of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is a single-domain antibody, a recombinant heavy-chain-only antibody (VHH), a single-chain antibody (scFv), a shark heavy-chain-only antibody (VNAR), a microprotein (cysteine knot protein, knottin), a DARPin; a Tetranectin; an Affibody; a Transbody; an Anticalin; an AdNectin; an Affilin; a Microbody; a peptide aptamer; an alterases; a plastic antibodies; a phylomer; a stradobodies; a maxibodies; an evibody; a fynomer, an armadillo repeat protein, a Kunitz domain, an avimer, an atrimer, a probody
- the targeting moiety comprises a single-domain antibody, such as VHH from, for example, an organism that produces VHH antibody such as a camelid, a shark, or a designed VHH.
- VHHs are antibody-derived therapeutic proteins that contain the unique structural and functional properties of naturally-occurring heavy-chain antibodies. VHH technology is based on fully functional antibodies from camelids that lack light chains. These heavy-chain antibodies contain a single variable domain (VHH) and two constant domains (CH2 and CH3). VHHs are commercially available under the trademark of NANOBODY or NANOBODIES.
- the targeting moiety comprises a VHH.
- the VHH is a humanized VHH or camelized VHH.
- the VHH comprises a fully human VH domain, e.g. a HUMABODY (Crescendo Biologies, Cambridge, UK).
- fully human VH domain e.g. a HUMABODY is monovalent, bivalent, or trivalent.
- the fully human VH domain, e.g. a HUMABODY is mono- or multi-specific such as monospecific, bispecific, or trispecific.
- Illustrative fully human VH domains, e.g. a HUMABODIES are described in, for example, WO 2016/113555 and WO2016/113557, the entire disclosure of which is incorporated by reference.
- the targeting moiety of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is a protein-based agent capable of specific binding to a cell receptor, such as a natural ligand for the cell receptor.
- the cell receptor is found on one or more immune cells, which can include, without limitation, T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, dendritic cells, or subsets thereof.
- the cell receptor is found on megakaryocytes, thrombocytes, erythrocytes, mast cells, basophils, neutrophils, eosinophils, or subsets thereof.
- the targeting moiety is a natural ligand such as a chemokine.
- chemokines that may be included in the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention include, but are not limited to, CCL1, CCL2, CCL4, CCL5, CCL6, CCL7, CCL8, CCL9, CCL10, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CLL25, CCL26, CCL27, CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL15, CXCL16, CXCL17, XCL1, XCL
- the targeting moiety may be XCL1 which is a chemokine that recognizes and binds to the dendritic cell receptor XCR1.
- the targeting moiety is CCL1, which is a chemokine that recognizes and binds to CCR8.
- the targeting moiety is CCL2, which is a chemokine that recognizes and binds to CCR2 or CCR9.
- the targeting moiety is CCL3, which is a chemokine that recognizes and binds to CCR1, CCR5, or CCR9.
- the targeting moiety is CCL4, which is a chemokine that recognizes and binds to CCR1 or CCR5 or CCR9.
- the targeting moiety is CCL5, which is a chemokine that recognizes and binds to CCR1 or CCR3 or CCR4 or CCR5.
- the targeting moiety is CCL6, which is a chemokine that recognizes and binds to CCR1 .
- the targeting moiety is CCL7, which is a chemokine that recognizes and binds to CCR2 or CCR9.
- the targeting moiety is CCL8, which is a chemokine that recognizes and binds to CCR1 or CCR2 or CCR2B or CCR5 or CCR9.
- the targeting moiety is CCL9, which is a chemokine that recognizes and binds to CCR1.
- the targeting moiety is CCL10, which is a chemokine that recognizes and binds to CCR1.
- the targeting moiety is CCL11, which is a chemokine that recognizes and binds to CCR2 or CCR3 or CCR5 or CCR9.
- the targeting moiety is CCL13, which is a chemokine that recognizes and binds to CCR2 or CCR3 or CCR5 or CCR9.
- the targeting moiety is CCL14, which is a chemokine that recognizes and binds to CCR1 or CCR9.
- the targeting moiety is CCL15, which is a chemokine that recognizes and binds to CCR1 or CCR3.
- the targeting moiety is CCL16, which is a chemokine that recognizes and binds to CCR1, CCR2, CCR5, or CCR8.
- the targeting moiety is CCL17, which is a chemokine that recognizes and binds to CCR4.
- the targeting moiety is CCL19, which is a chemokine that recognizes and binds to CCR7.
- the targeting moiety is CCL20, which is a chemokine that recognizes and binds to CCR6.
- the targeting moiety is CCL21, which is a chemokine that recognizes and binds to CCR7.
- the targeting moiety is CCL22, which is a chemokine that recognizes and binds to CCR4.
- the targeting moiety is CCL23, which is a chemokine that recognizes and binds to CCR1 .
- the targeting moiety is CCL24, which is a chemokine that recognizes and binds to CCR3.
- the targeting moiety is CCL25, which is a chemokine that recognizes and binds to CCR9.
- the targeting moiety is CCL26, which is a chemokine that recognizes and binds to CCR3.
- the targeting moiety is CCL27, which is a chemokine that recognizes and binds to CCR10.
- the targeting moiety is CCL28, which is a chemokine that recognizes and binds to CCR3 or CCR10.
- the targeting moiety is CXCL1, which is a chemokine that recognizes and binds to CXCR1 or CXCR2.
- the targeting moiety is CXCL2, which is a chemokine that recognizes and binds to CXCR2.
- the targeting moiety is CXCL3, which is a chemokine that recognizes and binds to CXCR2.
- the targeting moiety is CXCL4, which is a chemokine that recognizes and binds to CXCR3B.
- the targeting moiety is CXCL5, which is a chemokine that recognizes and binds to CXCR2.
- the targeting moiety is CXCL6, which is a chemokine that recognizes and binds to CXCR1 or CXCR2.
- the targeting moiety is CXCL8, which is a chemokine that recognizes and binds to CXCR1 or CXCR2.
- the targeting moiety is CXCL9, which is a chemokine that recognizes and binds to CXCR3.
- the targeting moiety is CXCL10, which is a chemokine that recognizes and binds to CXCR3.
- the targeting moiety is CXCL11, which is a chemokine that recognizes and binds to CXCR3 or CXCR7.
- the targeting moiety is CXCL12, which is a chemokine that recognizes and binds to CXCR4 or CXCR7.
- the targeting moiety is CXCL13, which is a chemokine that recognizes and binds to CXCR5.
- the targeting moiety is CXCL16, which is a chemokine that recognizes and binds to CXCR6.
- the targeting moiety is LDGF- PBP, which is a chemokine that recognizes and binds to CXCR2.
- the targeting moiety is XCL2, which is a chemokine that recognizes and binds to XCR1 .
- the targeting moiety is CX3CL1, which is a chemokine that recognizes and binds to CX3CR1 .
- the targeting moiety is a natural ligand such as FMS-like tyrosine kinase 3 ligand (Flt3L) or a truncated region thereof (e.g., which is able to bind Flt3).
- the targeting moiety is an extracellular domain of Flt3L.
- the targeting moiety comprising a Flt3L domain, wherein the Flt3L domain is a single chain dimer, optionally where one Flt3L domain is connected to the other Flt3L domain via one or more linkers, wherein the linker is a flexible linker.
- the targeting moiety of the present invention comprises Flt3L domain, wherein the Flt3L domain is a single chain dimer and a Fc domain, the Fc domain optionally having one or more mutations that reduces or eliminates one or more effector functions of the Fc domain, promotes Fc chain pairing in the Fc domain, and/or stabilizes a hinge region in the Fc domain.
- the targeting moiety recognizes CD20.
- the targeting moiety recognizes PD-L1.
- the targeting moiety recognizes Clec9A.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprises targeting moieties in various combinations.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise two targeting moieties, wherein both targeting moieties are antibodies or derivatives thereof.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise two targeting moieties, wherein both targeting moieties are natural ligands for cell receptors.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise two targeting moieties, wherein one of the targeting moieties is an antibody or derivative thereof, and the other targeting moiety is a natural ligand for a cell receptor.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex functionally modulates (by way of non-limitation, partially or completely neutralizes) the target (e.g. antigen, receptor) of interest, e.g. substantially inhibiting, reducing, or neutralizing a biological effect that the antigen has.
- the recognition domains may be directed against one or more tumor antigens that are actively suppressing, or have the capacity to suppress, the immune system of, for example, a patient bearing a tumor.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex functionally modulates immune inhibitory signals (e.g.
- checkpoint inhibitors for example, one or more of TIM-3, BTLA, PD-1, CTLA-4, B7-H4, GITR, galectin-9, HVEM, PD-L1, PD-L2, B7-H3, CD244, CD160, TIGIT, SIRPa, ICOS, CD172a, and TMIGD2.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is engineered to disrupt, block, reduce, and/or inhibit the transmission of an immune inhibitory signal, by way of non-limiting example, the binding of PD-1 with PD-L1 or PD-L2 and/or the binding of CTLA-4 with one or more of AP2M1, CD80, CD86, SHP-2, and PPP2R5A.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex binds but does not functionally modulate the target (e.g. antigen, receptor) of interest, e.g. the recognition domain is, or is akin to, a binding antibody.
- the recognition domain simply targets the antigen or receptor but does not substantially inhibit, reduce or functionally modulate a biological effect that the antigen or receptor has.
- some of the smaller antibody formats described above e.g. as compared to, for example, full antibodies
- the recognition domain binds an epitope that is physically separate from an antigen or receptor site that is important for its biological activity (e.g. the antigen’s active site).
- Such non-neutralizing binding finds use in various embodiments of the present invention, including methods in which the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is used to directly or indirectly recruit active immune cells to a site of need via an effector antigen, such as any of those described herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be used to directly or indirectly recruit cytotoxic T cells via CD8 to a tumor cell in a method of reducing or eliminating a tumor (e.g.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise an anti-CD8 recognition domain and a recognition domain directed against a tumor antigen).
- CD8 signaling is an important piece of the tumor reducing or eliminating effect.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is used to directly or indirectly recruit dendritic cells (DCs) via CLEC9A (e.g.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise an anti-CLEC9A recognition domain and a recognition domain directed against a tumor antigen).
- CLEC9A signaling is an important piece of the tumor reducing or eliminating effect.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex binds to XCR1 e.g. on dendritic cells.
- the recognition domain in some embodiments comprises all or part of XCL1 or a non-neutralizing anti-XCR1 agent.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex binds to an immune modulatory antigen (e.g. immune stimulatory or immune inhibitory).
- the immune modulatory antigen is one or more of 4-1 BB, OX-40, HVEM, GITR, CD27, CD28, CD30, CD40, ICOS ligand; OX-40 ligand, LIGHT (CD258), GITR ligand, CD70, B7-1, B7-2, CD30 ligand, CD40 ligand, ICOS, ICOS ligand, CD137 ligand and TL1A.
- such immune stimulatory antigens are expressed on a tumor cell.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex binds but does not functionally modulate such immune stimulatory antigens and therefore allows recruitment of cells expressing these antigens without the reduction or loss of their potential tumor reducing or eliminating capacity.
- the recognition domain of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be in the context of chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex that comprises two recognition domains that have neutralizing activity, or comprises two recognition domains that have non-neutralizing (e.g. binding) activity, or comprises one recognition domain that has neutralizing activity and one recognition domain that has non neutralizing (e.g. binding) activity.
- the fragment crystallizable domain is the tail region of an antibody that interacts with Fc receptors located on the cell surface of cells that are involved in the immune system, e.g., B lymphocytes, dendritic cells, natural killer cells, macrophages, neutrophils, eosinophils, basophils, and mast cells.
- Fc domain is composed of two identical protein fragments, derived from the second and third constant domains of the antibody's two heavy chains.
- the Fc domain contains three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
- the Fc-based chimeric protein of complex the present technology includes a Fc domain.
- the Fc domains are from selected from IgG, IgA, IgD, IgM or IgE.
- the Fc domains are from selected from lgG1, lgG2, lgG3, or lgG4.
- the Fc domains are from selected from human IgG, IgA, IgD, IgM or IgE. In some embodiments, the Fc domains are from selected from human lgG1, lgG2, lgG3, or lgG4.
- the Fc domains of the Fc-based chimeric protein complex comprise the CH2 and CH3 regions of IgG.
- the IgG is human IgG.
- the human IgG is selected from lgG1, lgG2, lgG3, or lgG4.
- the Fc domains comprise one or more mutations.
- the mutation(s) to the Fc domains reduces or eliminates the effector function the Fc domains.
- the mutated Fc domain has reduced affinity or binding to a target receptor.
- the mutation to the Fc domains reduces or eliminates the binding of the Fc domains to FcyR.
- the FcyR is selected from FcyRI; FcyRIla, 131 R/R; FcyRIla, 131 FI/FI, FcyRIIb; and FcyRIII.
- the mutation to the Fc domains reduces or eliminated binding to complement proteins, such as, e.g., C1q.
- the mutation to the Fc domains reduces or eliminated binding to both FcyR and complement proteins, such as, e.g., C1q.
- the Fc domains comprise the LALA mutation to reduce or eliminate the effector function of the Fc domains.
- the LALA mutation comprises L234A and L235A substitutions in human IgG (e.g., lgG1) (wherein the numbering is based on the commonly used numbering of the CH2 residues for human lgG1 according to EU convention (PNAS, Edelman et al., 1969; 63 (1) 78-85)).
- the Fc domains of human IgG comprise a mutation at 46. to reduce or eliminate the effector function of the Fc domains.
- the mutations are selected from L234A, L234F, L235A, L235E, L235Q, K322A, K322Q, D265A, P329G, P329A, P331G, and P331S.
- the Fc domains comprise the FALA mutation to reduce or eliminate the effector function of the Fc domains.
- the FALA mutation comprises F234A and L235A substitutions in human lgG4.
- the Fc domains of human lgG4 comprise a mutation at one or more of F234, L235, K322, D265, and P329 to reduce or eliminate the effector function of the Fc domains.
- the mutations are selected from F234A, L235A, L235E, L235Q, K322A, K322Q, D265A, P329G, and P329A.
- the mutation(s) to the Fc domain stabilize a hinge region in the Fc domain.
- the Fc domain comprises a mutation at S228 of human IgG to stabilize a hinge region.
- the mutation is S228P.
- the mutation(s) to the Fc domain promote chain pairing in the Fc domain.
- chain pairing is promoted by ionic pairing (a/k/a charged pairs, ionic bond, or charged residue pair).
- the Fc domain comprises a mutation at one more of the following amino acid residues of IgG to promote of ionic pairing: D356, E357, L368, K370, K392, D399, and K409.
- the human IgG Fc domain comprise one of the mutation combinations in Table 1 to promote of ionic pairing.
- chain pairing is promoted by knob-in-hole mutations.
- the Fc domain comprises one or more mutations to allow for a knob-in-hole interaction in the Fc domain.
- a first Fc chain is engineered to express the “knob” and a second Fc chain is engineered to express the complementary “hole.”
- human IgG Fc domain comprises the mutations of Table 2 to allow for a knob-in-hole interaction.
- the Fc domains in the Fc-based chimeric protein complexes of the present technology comprise any combination of the above disclosed mutations.
- the Fc domain comprises mutations that promote ionic pairing and/or a knob-in-hole interaction.
- the Fc domain comprises mutations that have one or more of the following properties: promote ionic pairing, induce a knob-in-hole interaction, reduce or eliminate the effector function of the Fc domain, and cause Fc stabilization ( e.g . at hinge).
- a human IgG Fc domains comprise mutations disclosed in Table 3, which promote ionic pairing and/or promote a knob-in-hole interaction in the Fc domain.
- a human IgG Fc domains comprise mutations disclosed in Table 4, which promote ionic pairing, promote a knob-in-hole interaction, or a combination thereof in the Fc domain.
- the “Chain G and “Chain 2” of Table 4 can be interchanged ( e.g . Chain 1 can have Y407T and Chain 2 can have T366Y).
- a human IgG Fc domains comprise mutations disclosed in Table 5, which reduce or eliminate FcyR and/or complement binding in the Fc domain.
- the Table 5 mutations are in both chains.
- the Fc domains in the Fc-based chimeric protein complexes of the present technology are homodimeric, /. e. , the Fc region in the chimeric protein complex comprises two identical protein fragments.
- the Fc domains in the Fc-based chimeric protein complexes of the present technology are heterodimeric, /.e., the Fc domain comprises two non-identical protein fragments.
- heterodimeric Fc domains are engineered using ionic pairing and/or knob-in-hole mutations described herein.
- the heterodimeric Fc-based chimeric protein complexes have a trans orientation/configuration.
- the targeting moiety and signaling agent e.g. IL-2, are, in embodiments, not found on the same polypeptide chain in the present Fc-based chimeric protein complexes.
- the Fc domains includes or starts with the core hinge region of wild-type human lgG1, which contains the sequence Cys-Pro-Pro-Cys (SEQ ID NO: 276).
- the Fc domains also include the upper hinge, or parts thereof (e.g., DKTHTCPPC (SEQ ID NO: 451); see WO 2009053368), EPKSCDKTHTCPPC (SEQ ID NO: 452), or EPKSSDKTHTCPPC (SEQ ID NO: 453); see Lo et al thread Protein Engineering vol.11 no.6 pp.495-500, 1998)).
- the Fc-based chimeric protein complexes of the present technology comprise at least one Fc domain disclosed herein, at least one signaling agent (SA), e.g. IL-2, disclosed herein, and at least one targeting moiety (TM) disclosed herein.
- SA signaling agent
- TM targeting moiety
- the present Fc-based chimeric protein complexes may encompass a complex of two fusion proteins, each comprising an Fc domain.
- the Fc-based chimeric protein complex is heterodimeric. In some embodiments, the heterodimeric Fc-based chimeric protein complex has a trans orientation/configuration. In some embodiments, the heterodimeric Fc-based chimeric protein complex has a cis orientation/configuration.
- heterodimeric Fc domains are engineered using ionic pairing and/or knob-in-hole mutations described herein.
- the heterodimeric Fc-based chimeric protein complexes have a trans orientation.
- the targeting moiety and signaling agent are, in embodiments, not found on the same polypeptide chain in the present Fc-based chimeric protein complexes.
- the targeting moiety and signaling agent are, in embodiments, found on separate polypeptide chains in the Fc-based chimeric protein complexes.
- the targeting moiety and signaling agent are, in embodiments, found on the same polypeptide chain in the Fc-based chimeric protein complexes.
- one targeting moiety may be in trans orientation (relative to the signaling agent), whereas another targeting moiety may be in cis orientation (relative to the signaling agent).
- the signaling agent and target moiety are on the same ends/sides (N-terminal or C-terminal ends) of an Fc domain. In some embodiments, the signaling agent and targeting moiety are on different sides/ends of a Fc domain (N-terminal and C-terminal ends).
- the targeting moieties may be found on the same Fc chain or on two different Fc chains in the heterodimeric protein complex (in the latter case the targeting moieties would be in trans relative to each other, as they are on different Fc chains). In some embodiments, where more than one targeting moiety is present on the same Fc chain, the targeting moieties may be on the same or different sides/ends of a Fc chain (N-terminal or/and C-terminal ends).
- the signaling agents may be found on the same Fc chain or on two different Fc chains in the heterodimeric protein complex (in the latter case the signaling agents would be in trans relative to each other, as they are on different Fc chains). In some embodiments, where more than one signaling agent is present on the same Fc chain, the signaling agents may be on the same or different sides/ends of a Fc chain (N-terminal or/and C-terminal ends).
- one signaling agent may be in trans orientation (as relates to the targeting moiety), whereas another signaling agent may be in cis orientation (as relates to the targeting moiety).
- the heterodimeric Fc-based chimeric protein complex does not comprise the signaling agent, e.g. IL-2, and targeting moiety on a single polypeptide.
- the Fc-based chimeric protein has an improved in vivo half-life relative to a chimeric protein lacking an Fc or a chimeric protein which is not a heterodimeric complex. In some embodiments, the Fc-based chimeric protein has an improved solubility, stability and other pharmacological properties relative to a chimeric protein lacking an Fc or a chimeric protein which is not a heterodimeric complex.
- Fleterodimeric Fc-based chimeric protein complexes are composed of two different polypeptides.
- the targeting domain is on a different polypeptide than the signaling agent, e.g. IL-2, and accordingly, proteins that contain only one targeting domain copy, and also only one signaling agent, e.g. IL-2, copy can be made (this provides a configuration in which potential interference with desired properties can be controlled).
- one targeting domain e.g. VHH
- one signaling agent e.g.
- heterodimeric Fc-based chimeric protein complexes can have two targeting moieties and these can be placed on the two different polypeptides.
- the C-terminus of both targeting moieties e.g . VHHs
- the C-terminus of both targeting moieties can be masked to avoid potential autoantibodies or pre-existing antibodies (e.g. VHH autoantibodies or pre-existing antibodies).
- heterodimeric Fc-based chimeric protein complexes e.g.
- heterodimeric Fc-based chimeric protein complexes can have two signaling agent, each on different polypeptides to allow more complex effector responses.
- heterodimeric Fc-based chimeric protein complexes e.g. with the targeting domain on a different polypeptide than the signaling agent, e.g. IL-2, combinatorial diversity of targeting moiety and signaling agent, e.g. IL-2, is provided in a practical manner.
- polypeptides with any of the targeting moieties described herein can be combined “off the shelf with polypeptides with any of the signaling agents described herein to allow rapid generation of various combinations of targeting moieties and signaling agents in single Fc-based chimeric protein complexes.
- the Fc-based chimeric protein complex comprises one or more linkers.
- the Fc-based chimeric protein complex includes a linker that connects the Fc domain, signaling agent, e.g. IL-2(s), and targeting moiety(ies).
- the Fc-based chimeric protein complex includes a linker that connects each signaling agent, e.g. IL-2, and targeting moiety (or, if more than one targeting moiety, a signaling agent, e.g. IL-2, to one of the targeting moieties).
- the Fc-based chimeric protein complex includes a linker that connects each signaling agent, e.g. IL-2, to the Fc domain.
- the Fc-based chimeric protein complex includes a linker that connects each targeting moiety to the Fc domain. In some embodiments, the Fc-based chimeric protein complex includes a linker that connects a targeting moiety to another targeting moiety. In some embodiments, the Fc-based chimeric protein complex includes a linker that connects a signaling agent, e.g. IL-2, to another signaling agent.
- a signaling agent e.g. IL-2
- a Fc-based chimeric protein complex comprises two or more targeting moieties.
- the targeting moieties can be the same targeting moiety or they can be different targeting moieties.
- a Fc-based chimeric protein complex comprises two or more signaling agents.
- the signaling agents can be the same targeting moiety or they can be different targeting moieties.
- the Fc-based chimeric protein complex comprises a Fc domain, at least two signaling agents (SA), and at least two targeting moieties (TM), wherein the Fc domain, signaling agents, and targeting moieties are selected from any of the Fc domains, signaling agents, and targeting moieties disclosed herein.
- the Fc domain is homodimeric.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 1A-F. In various embodiments, the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 2A-H.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 3A-H.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 4A-D.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 5A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 6A-J.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 7A-D.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 8A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 9A-J.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 10A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 11A-L.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 12A-L.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 13A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 14A-L.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 15A-L.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 16A-J.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 17A-J. In various embodiments, the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 18A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 19A-F.
- the Fc-based chimeric protein complex takes the form of any of the schematics of Figs. 20A-E.
- the Fc-based chimeric protein complex takes the form of the schematic of Fig. 31.
- the Fc-based chimeric protein complex takes the form of the schematic of Fig. 32.
- the present invention contemplates an Fc-based chimeric protein complex comprising one or more of the variants of Table 7 and/or one or more constructs listed in Table 7 within the column “ALN2 variant”.
- the signaling agents are linked to the targeting moieties and the targeting moieties are linked to the Fc domain on the same terminus (see FIGs. 1A-F).
- the Fc domain is homodimeric.
- the signaling agents and targeting moieties are linked to the Fc domain, wherein the targeting moieties and signaling agents are linked on the same terminus (see FIGs. 1A-F).
- the Fc domain is homodimeric.
- the targeting moieties are linked to signaling agents and the signaling agents are linked to the Fc domain on the same terminus (see FIGs. 1A-F).
- the Fc domain is homodimeric.
- the homodimeric Fc-based chimeric protein complex has two or more targeting moieties. In some embodiments, there are four targeting moieties and two signaling agents, the targeting moieties are linked to the Fc domain and the signaling agents are linked to targeting moieties on the same terminus (see FIGS. 2A- H). In some embodiments, the Fc domain is homodimeric. In some embodiments, where there are four targeting moieties and two signaling agents, two targeting moieties are linked to the Fc domain and two targeting moieties are linked to the signaling agents, which are linked to the Fc domain on the same terminus (see FIGS. 2A-H). In some embodiments, the Fc domain is homodimeric.
- two targeting moieties are linked to each other and one of the targeting moieties of from each pair is linked to the Fc domain on the same terminus and the signaling agents are linked to the Fc domain on the same terminus (see FIGS. 2A-H).
- the Fc domain is homodimeric.
- two targeting moieties are linked to each other, wherein one of the targeting moieties of from each pair is linked to a signaling agent, e.g.
- the Fc domain is homodimeric.
- the homodimeric Fc-based chimeric protein complex has two or more signaling agents.
- two signaling agents are linked to each other and one of the signaling agents of from pair is linked to the Fc domain on the same terminus and the targeting moieties are linked to the Fc domain on the same terminus (see FIGs. 3A-H).
- the Fc domain is homodimeric.
- the Fc domain is homodimeric. In some embodiments, where there are four signaling agents and two targeting moieties, two signaling agents are linked to the Fc domain one the same terminus and two of the signaling agents are each linked to a targeting moiety, wherein the targeting moieties are linked to the Fc domain at the same terminus (see FIGs. 3A-H). In some embodiments, the Fc domain is homodimeric. In some embodiments, where there are four signaling agents and two targeting moieties, two signaling agents are linked to each other and one of the signaling agents of from pair is linked to a targeting moiety and the targeting moieties are linked to the Fc domain on the same terminus (see FIGs. 3A-H). In some embodiments, the Fc domain is homodimeric.
- the Fc-based chimeric protein complex comprise a Fc domain, wherein the Fc domain comprises ionic pairing mutation(s) and/or knob-in-hole mutation(s), at least one signaling agent, e.g. IL-2, and at least one targeting moiety, wherein the ionic pairing motif and/or a knob-in-hole motif, signaling agent, e.g. IL-2, and targeting moiety are selected from any of the ionic pairing motif and/or a knob-in-hole motif, signaling agents, and targeting moieties disclosed herein.
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agent e.g. IL-2
- the targeting moiety is linked to the signaling agent, e.g. IL-2, which is linked to the Fc domain (see FIGs. 10A-F and 13A-F).
- the targeting moiety is linked to the signaling agent, e.g. IL-2, which is linked to the Fc domain (see FIGs. 10A-F and 13A-F).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agent, e.g. IL-2, and targeting moiety are linked to the Fc domain (see FIGs. 4A-D, 7A-D, 10A-F, and 13A-F).
- the targeting moiety and the signaling agent, e.g. IL-2 are linked to different Fc chains on the same terminus (see FIGs. 4A-D and 7A-D).
- the targeting moiety and the signaling agent, e.g. IL-2 are linked to different Fc chains on different termini (see FIGs. 4A-D and 7A-D).
- the Fc domain is heterodimeric. In some embodiments, the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agent e.g. IL-2
- two targeting moieties can be: 1) linked to each other with one of the targeting moieties linked to the Fc domain; or 2) each linked to the Fc domain (see FIGs. 5A-F, 8A-F, 11A-L, 14A-L, 16A-J, and 17A-J).
- the targeting moieties are linked on one Fc chain and the signaling agent, e.g. IL-2, is on the other Fc chain (see FIGs. 5A-F and 8A-F).
- the paired targeting moieties and the signaling agent, e.g. IL-2 are linked to the same Fc chain (see FIGs. 11A-L and 14A-L).
- a targeting moiety is linked to the Fc domain and the other targeting moiety is linked to the signaling agent, e.g. IL-2, and the paired targeting moiety is linked to the Fc domain (see FIGs. 11A-L, 14A-L, 16A- J, and 17A-J).
- the unpaired targeting moiety and paired targeting moiety are linked to the same Fc chain (see FIGs. 11A-L and 14A-L).
- the unpaired targeting moiety and paired targeting moiety are linked to different Fcchains (see FIGs. 16A-J and 17A-J). In some embodiments, the unpaired targeting moiety and paired targeting moiety are linked on the same terminus (see FIGs. 16A-J and 17A-J). In some embodiments, the Fc domain is heterodimeric. In some embodiments, the Fc domain comprises a mutation that reduces or eliminates its effector function.
- a targeting moiety is linked to the signaling agent, e.g. IL-2, which is linked to the Fc domain, and the unpaired targeting moiety is linked the Fc domain (see FIGs. 11A-L, 14A-L, 16A-J, and 17A-J).
- the paired signaling agent, e.g. IL-2, and unpaired targeting moiety are linked to the same Fc chain (see FIGs. 11A-L and 14A-L).
- the paired signaling agent, e.g. IL-2, and unpaired targeting moiety are linked to different Fc chains (see FIGs.
- the paired signaling agent e.g. IL-2
- unpaired targeting moiety are linked on the same terminus (see FIGs. 16A-J and 17A-J).
- the Fc domain is heterodimeric. In some embodiments, the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the targeting moieties are linked together and the signaling agent, e.g. IL-2, is linked to one of the paired targeting moieties, wherein the targeting moiety not linked to the signaling agent, e.g. IL-2, is linked to the Fc domain (see FIGs. 11 A- L and 14A-L).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the targeting moieties are linked together and the signaling agent, e.g. IL-2, is linked to one of the paired targeting moieties, wherein the signaling agent, e.g. IL-2, is linked to the Fc domain (see FIGs. 11A-L and 14A-L).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the targeting moieties are both linked to the signaling agent, e.g. IL-2, wherein one of the targeting moieties is linked to the Fc domain (see FIGs. 11A-L and 14A-L).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the targeting moieties and the signaling agent, e.g. IL-2 are linked to the Fc domain (see FIGs. 16A-J and 17A-J).
- the targeting moieties are linked on the terminus (see FIGs. 16A-J and 17A-J).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agents are linked to the Fc domain on the same terminus and the targeting moiety is linked to the Fc domain (see FIGs.
- the signaling agents are linked to the Fc domain on the same Fc chain and the targeting moiety is linked on the other Fc chain (see FIGs. 18A-F and 19A-F).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- a signaling agent e.g. IL- 2
- the targeting moiety which is linked to the Fc domain
- the other signaling agent e.g. IL-2
- the targeting moiety and the unpaired signaling agent are linked to different Fc chains (see FIGs. 6A-J and 9A-J).
- the targeting moiety and the unpaired signaling agent, e.g. IL-2 are linked to different Fc chains on the same terminus (see FIGs.
- the targeting moiety and the unpaired signaling agent, e.g. IL-2 are linked to different Fc chains on different termini (see FIGs. 6A-J and 9A-J). In some embodiments, the targeting moiety and the unpaired signaling agent, e.g. IL-2, are linked to the same Fc chains (see FIGs. 12A-L and 15A-L). In some embodiments, the Fc domain is heterodimeric. In some embodiments, the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the targeting moiety is linked to a signaling agent, e.g. IL-2, which is linked to the Fc domain and the other signaling agent, e.g. IL-2, is linked to the Fc domain (see FIGs. 6A-J and 9A-J).
- the paired signaling agent, e.g. IL-2, and the unpaired signaling agent, e.g. IL-2 are linked to different Fc chains (see FIGs. 6A-J and 9A-J).
- the paired signaling agent, e.g. IL-2, and the unpaired signaling agent e.g.
- IL-2 are linked to different Fc chains on the same terminus (see FIGs. 6A-J and 9A-J).
- the paired signaling agent, e.g. IL-2, and the unpaired signaling agent, e.g. IL-2 are linked to different Fc chains on different termini (see FIGs. 6A-J and 9A-J).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agents are linked together and the targeting moiety is linked to one of the paired signaling agents, wherein the targeting moiety is linked to the Fc domain (see FIGs. 12A-L and 15A-L).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agents are linked together and one of the signaling agents is linked to the Fc domain and the targeting moiety is linked to the Fc domain (see FIGs. 12A-L, 15A-L, 18A-F, and 19A-F).
- the paired signaling agents and targeting moiety are linked to the same Fc chain (see FIGs. 12A-L and 15A-L).
- the paired signaling agents and targeting moiety are linked to different Fc chains (see FIGs. 18A-F and 19A-F).
- the paired signaling agents and targeting moiety are linked to different Fc chains on the same terminus (see FIGs. 18A-F and 19A-F).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agents are both linked to the targeting moiety, wherein one of the signaling agents is linked to the Fc domain (see FIGs. 12A- L and 15A-L).
- the Fc domain is heterodimeric.
- the Fc domain comprises a mutation that reduces or eliminates its effector function.
- the signaling agents are linked together and one of the signaling agents is linked to the targeting moiety and the other signaling agent, e.g. IL-2, is linked to the Fc domain (see FIGs. 12A-L and 15A-L).
- each signaling agent e.g. IL-2
- the targeting moiety is linked to one of the signaling agents (see FIGs. 12A-L and 15A-L).
- the signaling agents are linked to the same Fc chain (see FIGs. 12A-L and 15A-L).
- a targeting moiety or signaling agent e.g. IL-2
- the Fc domain comprising one or both of CH2 and CH3 domains, and optionally a hinge region.
- vectors encoding the targeting moiety, signaling agent, e.g. IL-2, or combination thereof, linked as a single nucleotide sequence to an Fc domain can be used to prepare such polypeptides.
- the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence having at least 90%, or at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 291-296, 298-335, 340-345, 347-359, 361-368, 371-375, 377-449.
- the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence having at least 95%, or at least 98%, or at least 99% identity with any one of SEQ ID NOs: 291-296, 298-335. In embodiments, the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 291-296, 298-335 and less than 10 mutations to the amino acid sequence. In embodiments, the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 291-296, 298-335, and less than 5 mutations to the amino acid sequence.
- the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 291-296, 298-335.
- the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence having at least 95%, or at least 98%, or at least 99% identity with any one SEQ ID NOs: 292, 293, 294, 299, 301, 310, 311, 312, 315, 316, 319, 320, 325, 328, 332, 333, and 335.
- the Fc-based chimeric protein complex comprises a polypeptide having an amino acid sequence selected from SEQ ID NOs: 292, 293, 294, 299, 301, 310, 311, 312, 315, 316, 319, 320, 325, 328, 332, 333, and 335. Additional Signaling Agents
- the present invention provides a chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprising one or more signaling agents (for instance, an immune-modulating agent) in addition to the modified IL-2 described herein.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may comprise two, three, four, five, six, seven, eight, nine, ten or more signaling agents in addition to the modified IL-2 described herein.
- the additional signaling agent is modified to have reduced affinity or activity for one or more of its receptors, which allows for attenuation of activity (inclusive of agonism or antagonism) and/or prevents non-specific signaling or undesirable seguestration of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- the additional signaling agent is antagonistic in its wild type form and bears one or more mutations that attenuate its antagonistic activity.
- the additional signaling agent is antagonistic due to one or more mutations, e.g. an agonistic signaling agent is converted to an antagonistic signaling agent and, such a converted signaling agent, optionally, also bears one or more mutations that attenuate its antagonistic activity (e.g. as described in WO 2015/007520, the entire contents of which are hereby incorporated by reference).
- the additional signaling agent is selected from modified versions of cytokines, growth factors, and hormones.
- cytokines, growth factors, and hormones include, but are not limited to, lymphokines, monokines, traditional polypeptide hormones, such as human growth hormone, N- methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH); hepatic growth factor; fibroblast growth factor; prolactin; placental lactogen; tumor necrosis factor-a and tumor necrosis factor-b; mullerian-inhibiting substance; mouse gonadotropin-associated peptide; inhibin; activin; vascular endothelial growth factor; integrin; thrombopoietin (TPO); nerve growth factors such as NGF-
- the additional signaling agent is a modified version of a growth factor selected from, but not limited to, transforming growth factors (TGFs) such as TGF-a and TGF-b, epidermal growth factor (EGF), insulin-like growth factor such as insulin-like growth factor-1 and -II, fibroblast growth factor (FGF), heregulin, platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF).
- TGFs transforming growth factors
- TGFs transforming growth factors
- EGF epidermal growth factor
- FGF fibroblast growth factor
- PDGF platelet-derived growth factor
- VEGF vascular endothelial growth factor
- the growth factor is a modified version of a fibroblast growth factor (FGF).
- FGFs include, but are not limited to, FGF1, FGF2, FGF3, FGF4, FGF5, FGF6, FGF7, FGF8, FGF9, FGF10, FGF11, FGF12, FGF13, FGF14, murine FGF15, FGF16, FGF17, FGF18, FGF19, FGF20, FGF21, FGF22, and FGF23.
- the growth factor is a modified version of a vascular endothelial growth factor (VEGF).
- VEGFs include, but are not limited to, VEGF-A, VEGF-B, VEGF-C, VEGF-D, and PGF and isoforms thereof including the various isoforms of VEGF-A such as VEGF121, VEGFi2ib, VEGF145, VEGF1 6 5, VEGFi 6 sb, VEGF-I89, and VEGF206 ⁇
- the growth factor is a modified version of a transforming growth factor (TGF).
- TGFs include, but are not limited to, TGF-a and TGF-b and subtypes thereof including the various subtypes of TGF-b including 1 ⁇ Rb1, 1 ⁇ Rb2, and 1 ⁇ Rb3.
- the additional signaling agent is a modified version of a hormone selected from, but not limited to, human chorionic gonadotropin, gonadotropin releasing hormone, an androgen, an estrogen, thyroid- stimulating hormone, follicle-stimulating hormone, luteinizing hormone, prolactin, growth hormone, adrenocorticotropic hormone, antidiuretic hormone, oxytocin, thyrotropin-releasing hormone, growth hormone releasing hormone, corticotropin-releasing hormone, somatostatin, dopamine, melatonin, thyroxine, calcitonin, parathyroid hormone, glucocorticoids, mineralocorticoids, adrenaline, noradrenaline, progesterone, insulin, glucagon, amylin, calcitriol, calciferol, atrial-natriuretic peptide, gastrin, secretin, cholecystokinin, neuropeptide Y, ghrelin, P
- the additional signaling agent is an immune-modulating agent, e.g. one or more of an interleukin, interferon, and tumor necrosis factor.
- the additional signaling agent is an interleukin, including for example IL-1 b; IL-2; IL-3; IL-4; IL-5; IL-6; IL-7; IL-8; IL-9; IL-10; IL-11; IL-12; IL-13; IL-14; IL-15; IL-16; IL-17; IL-18; IL-19; IL-20; IL-21; IL-22; IL- 23; IL-24; IL-25; IL-26; IL-27; IL-28; IL-29; IL-30; IL-31; IL-32; IL-33; IL-35; IL-36 or a fragment, variant, analogue, or family-member thereof.
- interleukin including for example IL-1 b; IL-2; IL-3; IL-4; IL-5; IL-6; IL-7; IL-8; IL-9; IL-10; IL-11; IL-12; IL-13; IL-14; IL-15;
- Interleukins are a group of multi- functional cytokines synthesized by lymphocytes, monocytes, and macrophages.
- Known functions include stimulating proliferation of immune cells (e.g., T helper cells, B cells, eosinophils, and lymphocytes), chemotaxis of neutrophils and T lymphocytes, and/or inhibition of interferons.
- Interleukin activity can be determined using assays known in the art: Matthews ef a/., in Lymphokines and Interferens: A Practical Approach, Clemens ef a/., eds, IRL Press, Washington, D.C. 1987, pp.
- the signaling agent is a modified version of an interferon such as interferon types I, II, and III.
- interferon types I, II, and III Illustrative interferons, including for example, interferon-a-1, 2, 4, 5, 6, 7, 8, 10, 13, 14, 16, 17, and 21, interferon- b and interferon-g, interferon K, interferon e, interferon t, and interferon 05.
- the additional signaling agent is a type I interferon.
- the type I interferon is selected from IFNa2, IFNa1, IFN-b, IFN-g, Consensus IFN, IFN-e, IFN-k, IFN-T, IFN-d, and IFN-v.
- the additional signaling agent is a modified version of a tumor necrosis factor (TNF) or a protein in the TNF family, including but not limited to, TNF-a, TNF-b, LT-b, CD40L, CD27L, CD30L, FASL, 4-1 BBL, 0X40 L, and TRAIL.
- TNF tumor necrosis factor
- the additional signaling agent is a modified ( e.g . mutant) form of the signaling agent having one or more mutations.
- the mutations allow for the modified signaling agent to have one or more of attenuated activity such as one or more of reduced binding affinity, reduced endogenous activity, and reduced specific bioactivity relative to unmodified or unmutated, i.e. the wild type form of the signaling agent (e.g. comparing the same signaling agent in a wild type form versus a modified (e.g. mutant) form).
- the mutations allow for the modified signaling agent to have one or more of attenuated activity such as one or more of reduced binding affinity, reduced endogenous activity, and reduced specific bioactivity relative to unmodified or unmutated signaling agent, i.e. the unmutated IL-2.
- the mutations which attenuate or reduce binding or affinity include those mutations which substantially reduce or ablate binding or activity.
- the mutations which attenuate or reduce binding or affinity are different than those mutations which substantially reduce or ablate binding or activity. Consequentially, in various embodiments, the mutations allow for the signaling agent to be more safe, e.g.
- the mutations allow for the signaling agent to be safer, e.g. have reduced systemic toxicity, reduced side effects, and reduced off-target effects relative to unmutated signaling agent, e.g. the unmutated sequence of IL-2.
- the additional signaling agent is modified to have one or more mutations that reduce its binding affinity or activity for one or more of its receptors.
- the signaling agent is modified to have one or more mutations that substantially reduce or ablate binding affinity or activity for the receptors.
- the activity provided by the wild type signaling agent is agonism at the receptor (e.g. activation of a cellular effect at a site of therapy).
- the wild type signaling agent may activate its receptor.
- the mutations result in the modified signaling agent to have reduced or ablated activating activity at the receptor.
- the mutations may result in the modified signaling agent to deliver a reduced activating signal to a target cell or the activating signal could be ablated.
- the activity provided by the wild type signaling agent is antagonism at the receptor (e.g. blocking or dampening of a cellular effect at a site of therapy).
- the wild type signaling agent may antagonize or inhibit the receptor.
- the mutations result in the modified signaling agent to have a reduced or ablated antagonizing activity at the receptor.
- the mutations may result in the modified signaling agent to deliver a reduced inhibitory signal to a target cell or the inhibitory signal could be ablated.
- the signaling agent is antagonistic due to one or more mutations, e.g. an agonistic signaling agent is converted to an antagonistic signaling agent (e.g.
- a converted signaling agent optionally, also bears one or more mutations that reduce its binding affinity or activity for one or more of its receptors or that substantially reduce or ablate binding affinity or activity for one or more of its receptors.
- the reduced affinity or activity at the receptor is inducible or restorable by attachment with one or more of the targeting moieties or upon inclusion in the Fc-based chimeric protein complex disclosed herein. In other embodiments, the reduced affinity or activity at the receptor is not substantially inducible or restorable by the activity of one or more of the targeting moieties or upon inclusion in the Fc-based chimeric protein complex disclosed herein.
- the additional signaling agent is active on target cells because the targeting moiety(ies) compensates for the missing/insufficient binding (e.g., without limitation and/or avidity) required for substantial activation.
- the modified signaling agent is substantially inactive en route to the site of therapeutic activity and has its effect substantially on specifically targeted cell types which greatly reduces undesired side effects.
- the additional signaling agent may include one or more mutations that attenuate or reduce binding or affinity for one receptor (/. e. , a therapeutic receptor) and one or more mutations that substantially reduce or ablate binding or activity at a second receptor. In such embodiments, these mutations may be at the same or at different positions (/.e., the same mutation or multiple mutations). In some embodiments, the mutation(s) that reduce binding and/or activity at one receptor is different than the mutation(s) that substantially reduce or ablate at another receptor. In some embodiments, the mutation(s) that reduce binding and/or activity at one receptor is the same as the mutation(s) that substantially reduce or ablate at another receptor.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes have a modified signaling agent that has both mutations that attenuate binding and/or activity at a therapeutic receptor and therefore allow for a more controlled, on-target therapeutic effect (e.g. relative wild type signaling agent) and mutations that substantially reduce or ablate binding and/or activity at another receptor and therefore reduce side effects (e.g. relative to wild type signaling agent).
- a modified signaling agent that has both mutations that attenuate binding and/or activity at a therapeutic receptor and therefore allow for a more controlled, on-target therapeutic effect (e.g. relative wild type signaling agent) and mutations that substantially reduce or ablate binding and/or activity at another receptor and therefore reduce side effects (e.g. relative to wild type signaling agent).
- the substantial reduction or ablation of binding or activity is not substantially inducible or restorable with a targeting moiety or upon inclusion in the Fc-based chimeric protein complex disclosed herein. In some embodiments, the substantial reduction or ablation of binding or activity is inducible or restorable with a targeting moiety or upon inclusion in the Fc-based chimeric protein complex disclosed herein. In various embodiments, substantially reducing or ablating binding or activity at a second receptor also may prevent deleterious effects that are mediated by the other receptor.
- substantially reducing or ablating binding or activity at the other receptor causes the therapeutic effect to improve as there is a reduced or eliminated sequestration of the therapeutic chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes away from the site of therapeutic action. For instance, in some embodiments, this obviates the need of high doses of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes that compensate for loss at the other receptor. Such ability to reduce dose further provides a lower likelihood of side effects.
- the additional modified signaling agent comprises one or more mutations that cause the signaling agent to have reduced, substantially reduced, or ablated affinity, e.g. binding ( e.g . KD) and/or activation (for instance, when the modified signaling agent is an agonist of its receptor, measurable as, for example, KA and/or EC50) and/or inhibition (for instance, when the modified signaling agent is an antagonist of its receptor, measurable as, for example, Ki and/or IC50), for one or more of its receptors.
- the reduced affinity at the signaling agent’s receptor allows for attenuation of activity (inclusive of agonism or antagonism).
- the modified signaling agent has about 1%, or about 3%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 10%-20%, about 20%-40%, about 50%, about 40%-60%, about 60%-80%, about 80%-100% of the affinity for the receptor relative to the wild type signaling agent.
- the binding affinity is at least about 2-fold lower, about 3-fold lower, about 4-fold lower, about 5-fold lower, about 6-fold lower, about 7-fold lower, about 8-fold lower, about 9-fold lower, at least about 10-fold lower, at least about 15-fold lower, at least about 20-fold lower, at least about 25-fold lower, at least about 30-fold lower, at least about 35-fold lower, at least about 40-fold lower, at least about 45-fold lower, at least about 50-fold lower, at least about 100-fold lower, at least about 150-fold lower, or about 10-50-fold lower, about 50-100-fold lower, about 100-150-fold lower, about 150-200-fold lower, or more than 200-fold lower relative to the wild type signaling agent (including, by way of non-limitation, relative to the unmutated IL-2).
- the attenuation or reduction in binding affinity of a modified signaling agent for one receptor is less than the substantial reduction or ablation in affinity for the other receptor.
- the attenuation or reduction in binding affinity of a modified signaling agent for one receptor is less than the substantial reduction or ablation in affinity for the other receptor by about 1%, or about 3%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95%.
- substantial reduction or ablation refers to a greater reduction in binding affinity and/or activity than attenuation or reduction.
- the additional modified signaling agent comprises one or more mutations that reduce the endogenous activity of the signaling agent to about 75%, or about 70%, or about 60%, or about 50%, or about 40%, or about 30%, or about 25%, or about 20%, or about 10%, or about 5%, or about 3%, or about 1%, e.g., relative to the wild type signaling agent (including, by way of non-limitation, relative to the unmutated IL-2).
- the additional modified signaling agent comprises one or more mutations that cause the signaling agent to have reduced affinity and/or activity for a receptor of any one of the cytokines, growth factors, and hormones as described herein.
- the additional modified signaling agent comprises one or more mutations that cause the signaling agent to have reduced affinity for its receptor that is lower than the binding affinity of the targeting moiety(ies) for its(their) receptor(s).
- this binding affinity differential is between signaling agent/receptor and targeting moiety/receptor on the same cell.
- this binding affinity differential allows for the signaling agent, e.g. mutated signaling agent, to have localized, on-target effects and to minimize off-target effects that underlie side effects that are observed with wild type signaling agent.
- this binding affinity is at least about 2-fold, or at least about 5-fold, or at least about 10-fold, or at least about 15-fold lower, or at least about 25-fold, or at least about 50-fold lower, or at least about 100-fold, or at least about 150-fold.
- Receptor binding activity may be measured using methods known in the art. For example, affinity and/or binding activity may be assessed by Scatchard plot analysis and computer-fitting of binding data (e.g. Scatchard, 1949) or by reflectometric interference spectroscopy under flow through conditions, as described by Brecht ef a/. (1993), the entire contents of all of which are hereby incorporated by reference. In some embodiments, receptor binding activity is measured using bio-layer interferometry (BLI).
- BBI bio-layer interferometry
- the additional modified signaling agent comprises an amino acid sequence that has at least about 60%, or at least about 61 %, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71 %, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81 %, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%,
- the additional modified signaling agent comprises an amino acid sequence that has at least about 60%, or at least about 61 %, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71 %, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81 %, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91 %, or at least about 92%, or at least
- the additional modified signaling agent comprises an amino acid sequence having one or more amino acid mutations.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions as described herein.
- the additional modified signaling agents bear mutations that affect affinity and/or activity at one or more receptors.
- there is reduced affinity and/or activity at a therapeutic receptor e.g. a receptor through which a desired therapeutic effect is mediated (e.g. agonism or antagonism).
- the modified signaling agents bear mutations that substantially reduce or ablate affinity and/or activity at a receptor, e.g. a receptor through which a desired therapeutic effect is not mediated (e.g. as the result of promiscuity of binding).
- the receptors of any modified signaling agents e.g. one of the cytokines, growth factors, and hormones as described herein, are known in the art.
- Illustrative mutations which provide reduced affinity and/or activity (e.g. agonistic) at a receptor are found in WO 2013/107791 (e.g. with regard to interferons), WO 2015/007542 (e.g. with regard to interleukins), and WO 2015/007903 (e.g. with regard to TNF), the entire contents of each of which are hereby incorporated by reference.
- Illustrative mutations which provide reduced affinity and/or activity (e.g. antagonistic) at a therapeutic receptor are found in WO 2015/007520, the entire contents of which are hereby incorporated by reference.
- the additional modified signaling agent comprises one or more mutations that cause the signaling agent to have reduced affinity and/or activity for a type I cytokine receptor, a type II cytokine receptor, a chemokine receptor, a receptor in the Tumor Necrosis Factor Receptor (TNFR) superfamily, TGF-beta Receptors, a receptor in the immunoglobulin (Ig) superfamily, and/or a receptor in the tyrosine kinase superfamily.
- TNFR Tumor Necrosis Factor Receptor
- Ig immunoglobulin
- the receptor for the additional signaling agent is a Type I cytokine receptor.
- Type I cytokine receptors are known in the art and include, but are not limited to receptors for IL2 (beta-subunit), IL3, IL4, IL5, IL6, IL7, IL9, IL11, IL12, GM-CSF, G-CSF, LIF, CNTF, and also the receptors for Thrombopoietin (TPO), Prolactin, and Growth hormone.
- Illustrative type I cytokine receptors include, but are not limited to, GM-CSF receptor, G-CSF receptor, LIF receptor, CNTF receptor, TPO receptor, and type I IL receptors.
- the receptor for the additional signaling agent is a Type II cytokine receptor.
- Type II cytokine receptors are multimeric receptors composed of heterologous subunits and are receptors mainly for interferons. This family of receptors includes, but is not limited to, receptors for interferon-a, interferon-b and interferon-y, IL10, IL22, and tissue factor.
- Illustrative type II cytokine receptors include, but are not limited to, IFNa receptor (e.g . IFNAR1 and IFNAR2), IFN ⁇ receptor, IFNy receptor ( e.g . IFNGR1 and IFNGR2), and type II IL receptors.
- the receptor for the additional signaling agent is a G protein-coupled receptor.
- Chemokine receptors are G protein-coupled receptors with seven transmembrane structure and coupled to G-protein for signal transduction. Chemokine receptors include, but are not limited to, CC chemokine receptors, CXC chemokine receptors, CX3C chemokine receptors, and XC chemokine receptor (XCR1).
- Illustrative chemokine receptors include, but are not limited to, CCR1, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, CXCR1, CXCR2, CXCR3, CXCR3B, CXCR4, CXCR5, CSCR6, CXCR7, XCR1, and CX3CR1.
- the receptor for the additional signaling agent is a TNFR family member.
- Tumor necrosis factor receptor (TNFR) family members share a cysteine-rich domain (CRD) formed of three disulfide bonds surrounding a core motif of CXXCXXC creating an elongated molecule.
- CCD cysteine-rich domain
- Illustrative tumor necrosis factor receptor family members include: CDI 20a (TNFRSFIA), CD 120b (TNFRSFIB), Lymphotoxin beta receptor (LTBR, TNFRSF3), CD 134 (TNFRSF4), CD40 (CD40, TNFRSF5), FAS (FAS, TNFRSF6), TNFRSF6B (TNFRSF6B), CD27 (CD27, TNFRSF7), CD30 (TNFRSF8), CD137 (TNFRSF9), TNFRSFIOA (TNFRSFIOA), TNFRSFIOB, (TNFRSFIOB), TNFRSFIOC (TNFRSFIOC), TNFRSFIOD (TNFRSFIOD), RANK (TNFRSFI IA), Osteoprotegerin (TNFRSFI IB), TNFRSF12A (TNFRSF12A), TNFRSF13B (TNFRSF13B), TNFRSF13C (TNFRSF13C), TNFRSF14 (TNFRSF14), Nerve growth
- the receptor for the additional signaling agent is a TGF-beta receptor.
- TGF-beta receptors are single pass serine/threonine kinase receptors.
- TGF-beta receptors include, but are not limited to, TGFBR1, TGFBR2, and TGFBR3.
- the receptor for the additional signaling agent is an Ig superfamily receptor.
- Receptors in the immunoglobulin (Ig) superfamily share structural homology with immunoglobulins.
- Receptors in the Ig superfamily include, but are not limited to, interleukin-1 receptors, CSF-1 R, PDGFR (e.g . PDGFRA and PDGFRB), and SCFR.
- the receptor for the additional signaling agent is a tyrosine kinase superfamily receptor.
- Receptors in the tyrosine kinase superfamily are well known in the art. There are about 58 known receptor tyrosine kinases (RTKs), grouped into 20 subfamilies. Receptors in the tyrosine kinase superfamily include, but are not limited to, FGF receptors and their various isoforms such as FGFR1, FGFR2, FGFR3, FGFR4, and FGFR5.
- the additional modified signaling agent is interferon a.
- the modified IFNa agent has reduced affinity and/or activity for the IFN-a/b receptor (IFNAR), /. e. , IFNAR1 and/or IFNAR2 chains.
- the modified IFN-a agent has substantially reduced or ablated affinity and/or activity for the IFN-a/b receptor (IFNAR), /.e quilt IFNAR1 and/or IFNAR2 chains.
- the modified signaling agent is the allelic form IFNa2a, having the amino acid sequence of SEQ ID NO:233.
- the modified signaling agent is the allelic form IFNa2b having the amino acid sequence of SEQ ID NO: 234 (which differs from IFNa2a at amino acid position 23).
- said IFNa2 mutant (IFNa2a or IFNa2b) is mutated at one or more amino acids at positions 144-154, such as amino acid positions 145, 148, 149 and/or 153.
- the IFNa2 mutant comprises one or more mutations selected from A145G, L153A, R149A, and M148A. Such mutants are described, for example, in WO2013/107791 and Piehler ef a/., (2000) J. Biol. Chem, 275:40425-33, the entire contents of all of which are hereby incorporated by reference.
- the IFNa2 mutants have reduced affinity and/or activity for IFNAR1.
- the IFNa2 mutant comprises one or more mutations selected from F64A, N65A, T69A, L80A, Y85A, and Y89A, as described in WO2010/030671, the entire contents of which is hereby incorporated by reference.
- the IFNa2 mutant comprises one or more mutations selected from K133A, R144A, R149A, and L153A as described in W02008/124086, the entire contents of which is hereby incorporated by reference.
- the IFNa2 mutant comprises one or more mutations selected from R120E and R120E/K121 E, as described in W02015/007520 and WO2010/030671, the entire contents of which are hereby incorporated by reference.
- said IFNa2 mutant antagonizes wildtype IFNa2 activity.
- said mutant IFNa2 has reduced affinity and/or activity for IFNAR1 while affinity and/or activity of IFNR2 is retained.
- the human IFNa2 mutant comprises (1) one or more mutations selected from R120E and R120E/K121 E, which, without wishing to be bound by theory, create an antagonistic effect and (2) one or more mutations selected from K133A, R144A, R149A, and L153A, which, without wishing to be bound by theory, allow for an attenuated effect at, for example, IFNAR2.
- the human IFNa2 mutant comprises R120E and L153A.
- the human IFNa2 mutant comprises one or more mutations selected from, L15A, A19W, R22A, R23A, L26A, F27A, L30A, L30V, K31A, D32A, R33K, R33A, R33Q, H34A, D35A, Q40A, D114R, L117A, R120A, R125A, K134A, R144A, A145G, A145M, M148A, R149A, S152A, L153A, and N156A as disclosed in WO 2013/059885, the entire disclosures of which are hereby incorporated by reference.
- the human IFNa2 mutant comprises the mutations H57Y, E58N, Q61S, and/or L30A as disclosed in WO 2013/059885. In some embodiments, the human IFN-a2 mutant comprises the mutations H57Y, E58N, Q61S, and/or R33A as disclosed in WO 2013/059885. In some embodiments, the human IFNa2 mutant comprises the mutations H57Y, E58N, Q61S, and/or M148A as disclosed in WO 2013/059885. In some embodiments, the human IFNa2 mutant comprises the mutations H57Y, E58N, Q61S, and/or L153A as disclosed in WO 2013/059885.
- the human IFNa2 mutant comprises the mutations N65A, L80A, Y85A, and/or Y89A as disclosed in WO 2013/059885. In some embodiments, the human IFNa2 mutant comprises the mutations N65A, L80A, Y85A, Y89A, and/or D114A as disclosed in WO 2013/059885. In some embodiments, the human I FNa2 mutant comprises one or more mutations selected from R144Xi, A145X2, and R33A, wherein Xi is selected from A, S, T, Y, L, and I, and wherein X2 is selected from G, FI, Y, K, and D.
- the human IFNa2 mutant comprises one or more mutations selected from R33A, TIO6X 3 , R120E, R144Xi A145X2, M148A, R149A, and L153A with respect to amino acid sequence of SEQ ID NO: 233 or 234, wherein Xi is selected from A, S, T, Y, L, and I, wherein X 2 is selected from G, FI, Y, K, and D, and wherein X 3 is selected from A and E.
- the additional modified signaling agent is IFNal .
- the modified IFNal signaling agent also has reduced affinity and/or activity for the IFN-a/b receptor (IFNAR), /.e., IFNAR1 and/or IFNAR2 chains.
- the modified IFNal agent has substantially reduced or ablated affinity and/or activity for the IFN-a/b receptor (IFNAR), /.e., IFNAR1 and/or IFNAR2 chains.
- the additional modified IFNal signaling agent is modified to have a mutation at one or more amino acids at positions L15, A19, R23, S25, L30, D32, R33, H34, Q40, D115, L118, K121, R126, E133, K134, K135, R145, A146, M149, R150, S153, L154, and N157 with reference to SEQ ID NO: 450.
- the mutations can optionally be a hydrophobic mutation and can be, e.g., selected from alanine, valine, leucine, and isoleucine.
- the IFNal interferon is modified to have a one or more mutations selected from L15A, A19W, R23A, S25A, L30A, L30V, D32A, R33K, R33A, R33Q, H34A, Q40A, D115R, L118A, K121A, K121 E, R126A, R126E, E133A, K134A, K135A, R145A, R145D, R145E, R145G, R145H, R145I, R145K, R145L, R145N, R145Q, R145S, R145T, R145V, R145Y, A146D, A146E, A146G, A146H, A146I, A146K, A146L, A146M, A146N, A146Q, A146R, A146S, A146T, A146V, A146Y, M149A, M149V, R150A, S153A, L154A, and N157A with reference to SEQ
- the IFNal mutant comprises one or more multiple mutations selected from L30A/H58Y/E59N/Q62S, R33A/H58Y/E59N/Q62S, M149A/H58Y/E59N/Q62S, L154A/H58Y/E59N/Q62S, R145A/H58Y/E59N/Q62S, D115A/R121A, L118A/R121A, L118A/R121 A/K122A, R121A/K122A, and
- the additional modified IFNal signaling agent is modified to have one or more mutations at amino acid positions C1, C29, C86, C99, or C139 with reference to SEQ ID NO: 450.
- Beilharz et al. Journal of interferon research 6.6 (1986): 677-685 (which is hereby incorporated by reference in its entirety) describes various mutations of IFNal that may be used introduced in the modified IFNal of the present invention.
- the mutation at position C86 can be, e.g., C86S or C86A or C86Y. These C86 mutants of IFNal are called reduced cysteine-based aggregation mutants.
- the IFNal variant includes mutations at positions C1, C86 and C99 with reference to SEQ ID NO: 450.
- the additional modified signaling agent is interferon b.
- the modified interferon b agent also has reduced affinity and/or activity for the IFN-a/b receptor (IFNAR), /. e. , IFNAR1 and/or IFNAR2 chains.
- the modified interferon b agent has substantially reduced or ablated affinity and/or activity for the IFN-a/b receptor (IFNAR), /.e., IFNAR1 and/or IFNAR2 chains.
- the modified additional signaling agent is IRNb.
- the IRNb encompasses functional derivatives, analogs, precursors, isoforms, splice variants, or fragments of IRNb.
- the IRNb encompasses IRNb derived from any species.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprises a modified version of mouse IRNb.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprises a modified version of human IRNb.
- Fluman IRNb is a polypeptide with a molecular weight of about 22 kDa comprising 166 amino acid residues.
- the amino acid sequence of human IRNb is SEQ ID NO: 277.
- the human IRNb is IENb-la which is a glycosylated form of human IRNb. In some embodiments, the human IRNb is I F N b- 1 b which is a non-glycosylated form of human IRNb that has a Met-1 deletion and a Cys-17 to Ser mutation.
- the modified IRNb has one or more mutations that reduce its binding to or its affinity for the IFNAR1 subunit of IFNAR. In one embodiment, the modified IRNb has reduced affinity and/or activity at IFNAR1. In various embodiments, the modified IRNb is human IRNb and has one or more mutations at positions F67, R71, L88, Y92, 195, N96, K123, and R124. In some embodiments, the one or more mutations are substitutions selected from F67G, F67S, R71A, L88G, L88S, Y92G, Y92S, I95A, N96G, K123G, and R124G. In an embodiment, the modified IRNb comprises the F67G mutation.
- the modified IRNb comprises the K123G mutation. In an embodiment, the modified IRNb comprises the F67G and R71A mutations. In an embodiment, the modified IRNb comprises the L88G and Y92G mutations. In an embodiment, the modified IRNb comprises the Y92G, I95A, and N96G mutations. In an embodiment, the modified IRNb comprises the K123G and R124G mutations. In an embodiment, the modified IRNb comprises the F67G, L88G, and Y92G mutations. In an embodiment, the modified IRNb comprises the F67S, L88S, and Y92S mutations.
- the modified IRNb has one or more mutations that reduce its binding to or its affinity for the IFNAR2 subunit of IFNAR. In one embodiment, the modified IRNb has reduced affinity and/or activity at IFNAR2. In various embodiments, the modified IRNb is human IRNb and has one or more mutations at positions W22, R27, L32, R35, V148, L151, R152, and Y155. In some embodiments, the one or more mutations are substitutions selected from W22G, R27G, L32A, L32G, R35A, R35G, V148G, L151G, R152A, R152G, and Y155G. In an embodiment, the modified IFN ⁇ comprises the W22G mutation.
- the modified IFN ⁇ comprises the L32A mutation. In an embodiment, the modified IFN ⁇ comprises the L32G mutation. In an embodiment, the modified IFN ⁇ comprises the R35A mutation. In an embodiment, the modified IFN ⁇ comprises the R35G mutation. In an embodiment, the modified IFN ⁇ comprises the V148G mutation. In an embodiment, the modified IFN ⁇ comprises the R152A mutation. In an embodiment, the modified IFN ⁇ comprises the R152G mutation. In an embodiment, the modified IFN ⁇ comprises the Y155G mutation. In an embodiment, the modified IFN ⁇ comprises the W22G and R27G mutations. In an embodiment, the modified IFN ⁇ comprises the L32A and R35A mutation. In an embodiment, the modified IFN ⁇ comprises the L151G and R152A mutations. In an embodiment, the modified IFN ⁇ comprises the V148G and R152A mutations.
- the modified IFN ⁇ has one or more of the following mutations: R35A, R35T, E42K, MS2I, G78S, A141Y, A.142T, E148K, and R152H. In some embodiments, the modified IFN ⁇ has one or more of the following mutations: R35A, R35T, E42K, MS2i, G78S, A141Y, A142T, E149K, and R152H in combination with C17S or G17A
- the modified IFN ⁇ has one or more of the following mutations: R35A, R35T, E42K, MS2I, G78S, A 141 Y, A.142T, E149K, and R.152H in combination with arty of the other IFN ⁇ mutations described herein.
- the crystal structure of human IFN ⁇ is known and is described in Karpusas et at., (1998) PNAS, 94(22): 11813— 11818. Specifically, the structure of human IFN ⁇ has been shown to include five a-helices (/.e., A, B, C, D, and E) and four loop regions that connect these helices (/.e., AB, BC, CD, and DE loops). In various embodiments, the modified IFN ⁇ has one or more mutations in the A, B, C, D, E helices and/or the AB, BC, CD, and DE loops which reduce its binding affinity or activity at a therapeutic receptor such as IFNAR.
- a therapeutic receptor such as IFNAR.
- the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 15, 16, 18, 19, 22, and/or 23.
- the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 28-30, 32, and 33.
- the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 36, 37, 39, and 42.
- the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 64 and 67 and a serine substitution at position 68. In an illustrative embodiment, the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 71-73. In an illustrative embodiment, the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 92, 96, 99, and 100. In an illustrative embodiment, the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 128, 130, 131, and 134.
- the modified IFN ⁇ is human IFN ⁇ comprising alanine substitutions at amino acid positions 149, 153, 156, and 159.
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at W22, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at R27, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at W22, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at R27, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN comprises SEQ ID NO:277 and a mutation at L32, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN comprises SEQ ID NO:277 and a mutation at R35, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN comprises SEQ ID NO:277 and a mutation at L32, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V) and a mutation at R35, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at F67, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at R71, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at F67, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at R71, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at L88, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN comprises SEQ ID NO:277 and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at F67, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at L88, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V) and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at L88, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V) and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at 195, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), methionine (M), and valine (V) and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO:277 and a mutation at N96, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at Y92, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at 195, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), methionine (M), and valine (V) and a mutation at N96, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at K123, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at R124, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at K123, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at R124, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at L151, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at R152, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at L151, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), isoleucine (I), methionine (M), and valine (V) and a mutation at R152, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at V148, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), and methionine (M).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at V148, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V) and a mutation at R152, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- the mutant IFN ⁇ comprises SEQ ID NO: 277 and a mutation at Y155, the mutation being an aliphatic hydrophobic residue selected from glycine (G), alanine (A), leucine (L), isoleucine (I), methionine (M), and valine (V).
- G glycine
- A alanine
- L leucine
- I isoleucine
- M methionine
- V valine
- the present invention relates to a chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprising: (a) a modified IFN ⁇ , having the amino acid sequence of SEQ ID NO: 277 and a mutation at position W22, wherein the mutation is an aliphatic hydrophobic residue and a modified IL-2 or modified IL-2 variant disclosed here; and (b) one or more targeting moieties, said targeting moieties comprising recognition domains which specifically bind to antigens or receptors of interest, the modified IFN ⁇ and the one or more targeting moieties are optionally connected with one or more linkers.
- the mutation at position W22 is aliphatic hydrophobic residue is selected from G, A, L, I, M, and V. In various embodiments the mutation at position W22 is G.
- the modified additional signaling agent is interferon y.
- the modified interferon y agent has reduced affinity and/or activity for the interferon-gamma receptor (IFNGR), i.e., IFNGR1 and IFNGR2 chains.
- the modified interferon y agent has substantially reduced or ablated affinity and/or activity for the interferon-gamma receptor (IFNGR), i.e., IFNGR1 and/or IFNGR2 chains.
- the modified additional signaling agent is a consensus interferon.
- the consensus interferon is generated by scanning the sequences of several human non-allelic IFNa subtypes and assigning the most frequently observed amino acid in each corresponding position.
- the consensus interferon differs from IFNa2b at 20 out of 166 amino acids (88% homology), and comparison with IFN ⁇ shows identity at over 30% of the amino acid positions.
- the consensus interferon comprises the following amino acid sequence of SEQ ID NO: 278.
- the consensus interferon comprises the amino acid sequence of SEQ ID NO: 279, which differs from the amino acid sequence of SEQ ID NO: 278 by one amino acid, /. e. , SEQ ID NO: 279 lacks the initial methionine residue of SEQ ID NO: 278:
- the consensus interferon comprises a modified version of the consensus interferon, /.e., a consensus interferon variant, as a signaling agent.
- the consensus interferon variant encompasses functional derivatives, analogs, precursors, isoforms, splice variants, or fragments of the consensus interferon.
- the consensus interferon variants are selected form the consensus interferon variants disclosed in U.S. Patent Nos. 4,695,623, 4,897,471, 5,541,293, and 8,496,921, the entire contents of all of which are hereby incorporated by reference.
- the consensus interferon variant may comprise the amino acid sequence of IFN-CON2 or IFN-CON3 as disclosed in U.S. Patent Nos. 4,695,623, 4,897,471, and 5,541,293.
- the consensus interferon variant comprises the amino acid sequence of IFN-CON2: SEQ ID NO: 280.
- the consensus interferon variant comprises the amino acid sequence of IFN-CON3: SEQ ID NO: 281.
- the consensus interferon variant comprises the amino acid sequence of any one of the variants disclosed in U.S. Patent No. 8,496,921.
- the consensus variant may comprise the amino acid sequence of: SEQ ID NO: 282.
- the consensus interferon variant may comprise the amino acid sequence of: SEQ ID NO: 283.
- the consensus interferon variant may be PEGylated, /.e., comprises a PEG moiety.
- the consensus interferon variant may comprise a PEG moiety attached at the S156C position of SEQ ID NO: 283.
- the engineered interferon is a variant of human IFNa2a, with an insertion of Asp at approximately position 41 in the sequence Glu-Glu-Phe-Gly-Asn-Gln (SEQ ID NO: 284) to yield Glu-Glu-Phe-Asp- Gly-Asn-GIn (SEQ ID NO: 285) (which resulted in a renumbering of the sequence relative to IFNa2a sequence) and the following mutations of Arg23Lys, Leu26Pro, Glu53Gln, Thr54Ala, Pro56Ser, Asp86Glu, lle104Thr, Gly106Glu, Thr110GIu, Lys117Asn, Arg125Lys, and Lys136Thr. All embodiments herein that describe consensus interferons apply equally to this engineered interferon
- the additional modified signaling agent is vascular endothelial growth factor (VEGF).
- VEGF vascular endothelial growth factor
- VEGF is a potent growth factor that plays major roles in physiological but also pathological angiogenesis, regulates vascular permeability and can act as a growth factor on cells expressing VEGF receptors. Additional functions include, among others, stimulation of cell migration in macrophage lineage and endothelial cells.
- VEGF-1, VEGFR -2, and VEGFR -3 At least three receptors.
- Members of the VEGF family can bind and activate more than one VEGFR type.
- VEGF-A binds VEGFR-1 and -2
- VEGF-C can bind VEGFR-2 and -3
- VEGFR-1 and VEGFR-2 activation regulate angiogenesis while VEGFR-3 activation is associated with lymphangiogenesis.
- the major pro-angiogenic signal is generated from activation of VEGFR-2.
- VEGFR-1 activation has been reported to be possibly associated with negative role in angiogenesis. It has also been reported that VEGFR-1 signaling is important for progression of tumors in vivo via bone marrow-derived VEGFR-1 positive cells (contributing to formation of premetastatic niche in the bone).
- VEGF-A directed/neutralizing therapeutic antibodies have been developed, primarily for use in treatment of various human tumors relying on angiogenesis. These are not without side effects though. This may not be surprising considering that these operate as general, non-cell/tissue specific VEGFA/EGFR interaction inhibitors. Flence, it would be desirable to restrict VEGF (e.g . VEGF-A)/VEGFR-2 inhibition to specific target cells (e.g. tumor vasculature endothelial cells).
- target cells e.g. tumor vasculature endothelial cells.
- the VEGF is VEGF-A, VEGF-B, VEFG-C, VEGF-D, or VEGF-E and isoforms thereof including the various isoforms of VEGF-A such as VEGF121, VEGFi2ib, VEGF145, VEGF165, VEGFi6sb, VEGFm and VEGF206.
- the modified signaling agent has reduced affinity and/or activity for VEGFR- 1 (Flt-1) and/or VEGFR-2 (KDR/Flk-1).
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for VEGFR-1 (Flt-1) and/or VEGFR-2 (KDR/Flk-1). In an embodiment, the modified signaling agent has reduced affinity and/or activity for VEGFR-2 (KDR/Flk-1) and/or substantially reduced or ablated affinity and/or activity for VEGFR-1 (Flt-1).
- VEGFR-2 KDR/Flk-1
- Flt-1 substantially reduced or ablated affinity and/or activity for VEGFR-1 (Flt-1).
- VEGFR- 1 acts a decoy receptor and therefore substantially reduces or ablates affinity at this receptor avoids sequestration of the therapeutic agent.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for VEGFR-1 (Flt-1 ) and/or substantially reduced or ablated affinity and/or activity for VEGFR-2 (KDR/Flk-1).
- the VEGF is VEGF-C or VEGF-D.
- the modified signaling agent has reduced affinity and/or activity for VEGFR-3.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for VEGFR-3.
- Proangiogenic therapies are also important in various diseases (e.g. ischemic heart disease, bleeding etc.), and include VEGF-based therapeutics.
- Activation of VEGFR-2 is proangiogenic (acting on endothelial cells).
- Activation of VEFGR-1 can cause stimulation of migration of inflammatory cells (including, for example, macrophages) and lead to inflammation associated hypervascular permeability.
- Activation of VEFGR-1 can also promote bone marrow associated tumor niche formation.
- VEGF based therapeutic selective for VEGFR-2 activation would be desirable in this case.
- cell specific targeting e.g. to endothelial cells, would be desirable.
- the additional modified signaling agent has reduced affinity and/or activity (e.g .
- VEGFR-2 has substantially reduced or ablated affinity and/or activity for VEGFR-1 .
- a targeting moiety that binds to a tumor endothelial cell marker e.g. PSMA and others
- such construct inhibits VEGFR-2 activation specifically on such marker-positive cells, while not activating VEGFR-1 en route and on target cells (if activity ablated), thus eliminating induction of inflammatory responses, for example. This would provide a more selective and safe anti-angiogenic therapy for many tumor types as compared to VEGF-A neutralizing therapies.
- the additional modified signaling agent has reduced affinity and/or activity (e.g. agonistic) for VEGFR-2 and/or has substantially reduced or ablated affinity and/or activity for VEGFR-1 .
- affinity and/or activity e.g. agonistic
- VEGFR-2 vascular endothelial cells
- the additional modified signaling agent has reduced affinity and/or activity (e.g. agonistic) for VEGFR-2 and/or has substantially reduced or ablated affinity and/or activity for VEGFR-1 .
- the modified signaling agent is VEGF165, which has the amino acid sequence of SEQ ID NO:235.
- the additional modified signaling agent is VEGFi65b, which has the amino acid sequence of SEQ ID NO:236.
- the modified signaling agent has a mutation at amino acid I83 (e.g., a substitution mutation at I83, e.g., I83K, I83R, or I83H).
- a substitution mutation at I83 e.g., I83K, I83R, or I83H.
- the additional modified signaling agent is TNFa.
- TNF is a pleiotropic cytokine with many diverse functions, including regulation of cell growth, differentiation, apoptosis, tumorigenesis, viral replication, autoimmunity, immune cell functions and trafficking, inflammation, and septic shock. It binds to two distinct membrane receptors on target cells: TNFR1 (p55) and TNFR2 (p75).
- TNFR1 exhibits a very broad expression pattern whereas TNFR2 is expressed preferentially on certain populations of lymphocytes, Tregs, endothelial cells, certain neurons, microglia, cardiac myocytes and mesenchymal stem cells. Very distinct biological pathways are activated in response to receptor activation, although there is also some overlap.
- TNFR1 signaling is associated with induction of apoptosis (cell death) and TNFR2 signaling is associated with activation of cell survival signals (e.g. activation of NFkB pathway).
- Administration of TNF is systemically toxic, and this is largely due to TNFR1 engagement.
- activation of TNFR2 is also associated with a broad range of activities and, as with TNFR1, in the context of developing TNF based therapeutics, control over TNF targeting and activity is important.
- the additional modified signaling agent has reduced affinity and/or activity for TNFR1 and/or TNFR2. In some embodiments, the modified signaling agent has substantially reduced or ablated affinity and/or activity for TNFR1 and/or TNFR2.
- TNFR1 is expressed in most tissues, and is involved in cell death signaling while, by contrast, TNFR2 is involved in cell survival signaling. Accordingly, in embodiments directed to methods of treating cancer, the modified signaling agent has reduced affinity and/or activity for TNFR1 and/or substantially reduced or ablated affinity and/or activity for TNFR2.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be targeted to a cell for which apoptosis is desired, e.g. a tumor cell or a tumor vasculature endothelial cell.
- the modified signaling agent has reduced affinity and/or activity for TNFR2 and/or substantially reduced or ablated affinity and/or activity for TNFR1.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex in some embodiments, comprise modified TNF-a agent that allows of favoring either death or survival signals.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has a modified TNF having reduced affinity and/or activity for TNFR1 and/or substantially reduced or ablated affinity and/or activity for TNFR2.
- a chimera in some embodiments, is a more potent inducer of apoptosis as compared to a wild type TNF and/or a chimera bearing only mutation(s) causing reduced affinity and/or activity for TNFR1.
- Such a chimera finds use in inducing tumor cell death or a tumor vasculature endothelial cell death (e.g. in the treatment of cancers).
- these chimeras avoid or reduce activation of T reg cells via TNFR2, for example, thus further supporting TNFR1 -mediated antitumor activity in vivo.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex has a modified TNF having reduced affinity and/or activity for TNFR2 and/or substantially reduced or ablated affinity and/or activity for TNFR1 .
- a chimera in some embodiments, is a more potent activator of cell survival in some cell types, which may be a specific therapeutic objective in various disease settings, including without limitation, stimulation of neurogenesis.
- a TNFR2-favoring chimera is also useful in the treatment of autoimmune diseases (e.g. Crohn’s, diabetes, MS, colitis etc. and many others described herein).
- the chimera is targeted to auto-reactive T cells.
- the chimera promotes T reg cell activation and indirect suppression of cytotoxic T cells.
- the chimera causes the death of auto-reactive T cells, e.g. by activation of TNFR2 and/or avoidance of TNFR1 (e.g. a modified TNF having reduced affinity and/or activity for TNFR2 and/or substantially reduced or ablated affinity and/or activity for TNFR1).
- TNFR1 e.g. a modified TNF having reduced affinity and/or activity for TNFR2 and/or substantially reduced or ablated affinity and/or activity for TNFR1
- these auto-reactive T cells have their apoptosis/survival signals altered e.g. by NFkB pathway activity/signaling alterations.
- a TNFR2 based chimera has additional therapeutic applications in diseases, including various autoimmune diseases, heart disease, de-myelinating and neurodegenerative disorders, and infectious disease, among others.
- the wild type TNFa has the amino acid sequence of SEQ ID NO:237.
- the modified TNFa agent has mutations at one or more amino acid positions 29, 31, 32, 84, 85, 86, 87, 88, 89, 145, 146 and 147 which produces a modified TNFa with reduced receptor binding affinity. See, for example, U.S. Patent No. 7,993,636, the entire contents of which are hereby incorporated by reference.
- the modified human TNFa moiety has mutations at one or more amino acid positions R32, N34, Q67, H73, L75, T77, S86, Y87, V91, I97, T105, P106, A109, P113, Y115, E127, N137, D143, and A145, as described, for example, in WO/2015/007903, the entire contents of which is hereby incorporated by reference (numbering according to the human TNF sequence, Genbank accession number BAG70306, version BAG70306.1 Gl: 197692685).
- the modified human TNFa moiety has substitution mutations selected from R32G, N34G, Q67G, H73G, L75G, L75A, L75S, T77A, S86G, Y87Q, Y87L, Y87A, Y87F, V91G, V91A, I97A, I97Q, I97S, T105G, P106G, A109Y, P113G, Y115G, Y115A, E127G, N137G, D143N, A145G and A145T.
- the human TNFa moiety has a mutation selected from Y87Q, Y87L, Y87A, and Y87F.
- the human TNFa moiety has a mutation selected from I97A, I97Q, and I97S.
- the human TNFa moiety has a mutation selected from Y115A and Y115G.
- the modified TNFa agent has one or more mutations selected from N39Y, S147Y, and Y87H, as described in W02008/124086, the entire contents of which is hereby incorporated by reference.
- the additional modified signaling agent is TNF ⁇ .
- TNF ⁇ can form a homotrimer or a heterotrimer with LT-b (I_T-a1b2).
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for TNFR1 and/or TNFR2 and/or herpes virus entry mediator (HEVM) and/or LT- R.
- HEVM herpes virus entry mediator
- the wild type TNF has the amino acid sequence of SEQ ID NO:238.
- the modified TNF ⁇ agent may comprise mutations at one or more amino acids at positions 106-113, which produce a modified TNF ⁇ with reduced receptor binding affinity to TNFR2.
- the modified signaling agent has one or more substitution mutations at amino acid positions 106-113.
- the substitution mutations are selected from Q107E, Q107D, S106E, S106D, Q107R, Q107N, Q107E/S106E, Q107E/S106D, Q107D/S106E, and Q107D/S106D.
- the modified signaling agent has an insertion of about 1 to about 3 amino acids at positions 106-113.
- the additional modified agent is a TNF family member (e.g . TNF-alpha, TNF-beta) which can be a single chain trimeric version as described in WO 2015/007903, the entire contents of which are incorporated by reference.
- TNF family member e.g . TNF-alpha, TNF-beta
- the modified agent is a TNF family member (e.g. TNF-alpha, TNF-beta) which has reduced affinity and/or activity, i.e. antagonistic activity (e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) atTNFRI .
- the modified agent is a TNF family member (e.g. TNF-alpha, TNF- beta) which also, optionally, has substantially reduced or ablated affinity and/or activity for TNFR2.
- the modified agent is a TNF family member (e.g.
- TNF-alpha, TNF-beta which has reduced affinity and/or activity, i.e. antagonistic activity (e.g . natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) at TNFR2.
- the modified agent is a TNF family member (e.g. TNF-alpha, TNF- beta) which also, optionally, has substantially reduced or ablated affinity and/or activity for TNFR1 .
- the constructs of such embodiments find use in, for example, methods of dampening TNF response in a cell specific manner.
- the antagonistic TNF family member e.g. TNF-alpha, TNF-beta
- the antagonistic TNF family member is a single chain trimeric version as described in WO 2015/007903.
- the additional modified signaling agent is TRAIL.
- the modified TRAIL agent has reduced affinity and/or activity for DR4 (TRAIL-RI) and/or DR5 (TRAIL-RII) and/or DcR1 and/or DcR2.
- the modified TRAIL agent has substantially reduced or ablated affinity and/or activity for DR4 (TRAIL-RI) and/or DR5 (TRAIL-RII) and/or DcR1 and/or DcR2.
- the wild type TRAIL has the amino acid sequence of SEQ ID NO:239.
- the modified TRAIL agent may comprise a mutation at amino acid positions T127-R132, E144-R149, E155-H161, Y189-Y209, T214-1220, K224-A226, W231, E236-L239, E249-K251, T261-H264 and H270-E271 (Numbering based on the human sequence, Genbank accession number NP _003801, version 10 NP _003801.1, Gl: 4507593; see above).
- the additional modified signaling agent is TGFa.
- the modified TGFa agent has reduced affinity and/or activity for the epidermal growth factor receptor (EGFR).
- the modified TGFa agent has substantially reduced or ablated affinity and/or activity for the epidermal growth factor receptor (EGFR).
- the additional modified signaling agent is TGF ⁇ .
- the modified signaling agent has reduced affinity and/or activity for TGFBR1 and/or TGFBR2.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for TGFBR1 and/or TGFBR2.
- the modified signaling agent optionally has reduced or substantially reduced or ablated affinity and/or activity for TGFBR3 which, without wishing to be bound by theory, may act as a reservoir of ligand for TGF- beta receptors.
- the TGF ⁇ may favor TGFBR1 over TGFBR2 or TGFBR2 over TGFBR1.
- LAP may act as a reservoir of ligand for TGF-beta receptors.
- the modified signaling agent has reduced affinity and/or activity for TGFBR1 and/or TGFBR2 and/or substantially reduced or ablated affinity and/or activity for Latency Associated Peptide (LAP).
- LAP Latency Associated Peptide
- such chimeras find use in Camurati-Engelmann disease, or other diseases associated with inappropriate TGF signaling.
- the additional modified agent is a TGF family member (e.g. TGFa, TGF ) which has reduced affinity and/or activity, i.e. antagonistic activity (e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) at one or more of TGFBR1, TGFBR2, TGFBR3.
- the modified agent is a TGF family member (e.g . TGFa, TGF ) which also, optionally, has substantially reduced or ablated affinity and/or activity at one or more of TGFBR1, TGFBR2, TGFBR3.
- the additional modified agent is a TGF family member (e.g. TGFa, TGF ) which has reduced affinity and/or activity, i.e. antagonistic activity (e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) at TGFBRI and/or TGFBR2.
- the modified agent is a TGF family member (e.g. TGFa, TGF ) which also, optionally, has substantially reduced or ablated affinity and/or activity at TGFBR3.
- the additional modified signaling agent is IL-1.
- the modified signaling agent is IL-1a or IL-1 b.
- the modified signaling agent has reduced affinity and/or activity for IL-1 R1 and/or IL-1 RAcP.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-1 R1 and/or IL-1 RAcP.
- the modified signaling agent has reduced affinity and/or activity for IL-1 R2.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-1R2.
- the present modified IL-1 agents avoid interaction at IL-1 R2 and therefore substantially reduce its function as a decoy and/or sink for therapeutic agents.
- the wild type IL-1 b has the amino acid sequence of SEQ ID NO:240.
- IL-1 b is a proinflammatory cytokine and an important immune system regulator. It is a potent activator of CD4 T cell responses, increases proportion of Th17 cells and expansion of IFNy and IL-4 producing cells. IL-1 b is also a potent regulator of CD8 + T cells, enhancing antigen-specific CD8 + T cell expansion, differentiation, migration to periphery and memory. IL-1 b receptors comprise IL-1 R1 and IL-1R2. Binding to and signaling through the IL-1 R1 constitutes the mechanism whereby IL-1 b mediates many of its biological (and pathological) activities. IL1-R2 can function as a decoy receptor, thereby reducing IL-1 b availability for interaction and signaling through the IL-1R1.
- the modified IL-1 b has reduced affinity and/or activity (e.g. agonistic activity) for IL-1 R1 . In some embodiments, the modified IL-1 b has substantially reduced or ablated affinity and/or activity for IL-1 R2. In such embodiments, there is inducible or restorable IL-1 b / IL-1 R1 signaling and prevention of loss of therapeutic chimeras at IL-R2 and therefore a reduction in dose of IL-1 that is required (e.g. relative to wild type or a chimera bearing only an attenuation mutation for IL-R1). Such constructs find use in, for example, methods of treating cancer, including, for example, stimulating the immune system to mount an anti-cancer response.
- the modified I L-1 b has reduced affinity and/or activity (e.g. antagonistic activity, e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) for IL-1 R1 .
- the modified IL-1 b has substantially reduced or ablated affinity and/or activity for IL-1 R2.
- there is the IL- 1 b/IL-l R1 signaling is not inducible or restorable and prevention of loss of therapeutic chimeras at IL-R2 and therefore a reduction in dose of IL-1 b that is required (e.g. relative to wild type or a chimera bearing only an attenuation mutation for IL-R1).
- Such constructs find use in, for example, methods of treating autoimmune diseases, including, for example, suppressing the immune system.
- the modified signaling agent has a deletion of amino acids 52-54 which produces a modified human IL-1 b with reduced binding affinity for type I IL-1 R and reduced biological activity. See, for example, WO 1994/000491, the entire contents of which are hereby incorporated by reference.
- the modified human IL-1 b has one or more substitution mutations selected from A117G/P118G, R120X, L122A, T125G/L126G, R127G, Q130X, Q131G, K132A, S137G/Q138Y, L145G, H146X, L145A/L147A, Q148X, Q148G/Q150G, Q150G/D151A, M152G, F162A, F162A/Q164E, F166A, Q164E/E167K, N169G/D170G, I172A, V174A, K208E, K209X, K209A/K210A, K219X, E221X, E221 S/N224A, N224S/K225S, E244K, N245Q (where X can be any change in amino acid, e.g., a non-conservative change), which exhibit reduced binding to IL-1 R, as described, for example, in WO2015/
- the modified human IL-1 b may have one or more mutations selected from R120A, R120G, Q130A, Q130W, H146A, H146G, H146E, H146N, H146R, Q148E, Q148G, Q148L, K209A, K209D, K219S, K219Q, E221S and E221 K.
- the modified human IL-1 b comprises the mutations Q131G and Q148G.
- the modified human IL-1 b comprises the mutations Q148G and K208E.
- the modified human IL-1 b comprises the mutations R120G and Q131G.
- the modified human IL-1 b comprises the mutations R120G and H146G. In an embodiment, the modified human IL-1 b comprises the mutations R120G and K208E. In an embodiment, the modified human I L-1 b comprises the mutations R120G, F162A, and Q164E.
- the additional modified signaling agent is IL-3.
- the modified signaling agent has reduced affinity and/or activity for the IL-3 receptor, which is a heterodimer with a unique alpha chain paired with the common beta (beta c or CD131) subunit.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for the IL-3 receptor, which is a heterodimer with a unique alpha chain paired with the common beta (beta c or CD131) subunit.
- the additional modified signaling agent is IL-4.
- the modified signaling agent has reduced affinity and/or activity for type 1 and/or type 2 IL-4 receptors.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for type 1 and/or type 2 IL-4 receptors.
- Type 1 IL-4 receptors are composed of the IL-4Ra subunit with a common y chain and specifically bind IL-4.
- Type 2 IL-4 receptors include an IL-4Ra subunit bound to a different subunit known as I L- 13 Ra 1 .
- the modified signaling agent has substantially reduced or ablated affinity and/or activity the type 2 IL-4 receptors.
- the wild type IL-4 has the amino acid sequence of SEQ ID NO:242.
- the modified IL-4 agent has one or more mutations at amino acids R121 (R121A, R121D, R121 E, R121F, R121 H, R121I, R121 K, R121N, R121P, R121T, R121W), E122 (E122F), Y124 (Y124A, Y124Q, Y124R, Y124S, Y124T) and S125 (S125A).
- the additional modified signaling agent is IL-6.
- IL-6 signals through a cell-surface type I cytokine receptor complex including the ligand-binding IL-6R chain (CD126), and the signal-transducing component gp130.
- IL-6 may also bind to a soluble form of IL-6R (slL-6R), which is the extracellular portion of IL-6R.
- the si L-6R/I L-6 complex may be involved in neurites outgrowth and survival of neurons and, hence, may be important in nerve regeneration through remyelination.
- the modified signaling agent has reduced affinity and/or activity for IL-6R/gp130 and/or slL-6R.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-6R/gp130 and/or slL-6R.
- the wild type IL-6 has the amino acid sequence of SEQ ID NO:243.
- the modified signaling agent has one or more mutations at amino acids 58, 160, 163, 171 or 177.
- these modified IL-6 agents exhibit reduced binding affinity to IL-6Ralpha and reduced biological activity. See, for example, WO 97/10338, the entire contents of which are hereby incorporated by reference.
- the additional modified signaling agent is IL-10.
- the modified signaling agent has reduced affinity and/or activity for IL-10 receptor-1 and IL-10 receptor-2.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-10 receptor-1 and IL-10 receptor-2
- the additional modified signaling agent is IL-11 .
- the modified signaling agent has reduced affinity and/or activity for IL-11 Ra and/or IL-11 R and/or gp130.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for I L- 11 Ra and/or IL-11 R ⁇ and/or gp130.
- the additional modified signaling agent is IL-12.
- the modified signaling agent has reduced affinity and/or activity for IL-12R ⁇ i and/or IL-12R ⁇ 2.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-12R ⁇ i and/or IL-12R ⁇ 2.
- the additional modified signaling agent is IL-13.
- the modified signaling agent has reduced affinity and/or activity for the IL-4 receptor (IL-4Ra) and IL-13Ra1 .
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-4 receptor (IL-4Ra) or IL-13Ra 1.
- the wild type IL-13 has the amino acid sequence of SEQ ID NO:244.
- the modified IL-13 agent has one or more mutations at amino acids 13, 16, 17, 66, 69, 99, 102, 104, 105, 106, 107, 108, 109, 112, 113 and 114. Without wishing to be bound by theory, it is believed that these modified IL-13 agents exhibit reduced biological activity. See, for example, WO 2002/018422, the entire contents of which are hereby incorporated by reference.
- the signaling agent is a wild type or modified IL-15.
- the modified IL-15 has reduced affinity and/or activity for interleukin 15 receptor.
- the wild type IL-15 has the amino acid sequence of:
- the modified IL-15 agent has one or more mutations at amino acids S7, D8, K10, K11, E46, L47, V49, 150, D61, N65, L66, I67, I68, L69, N72, Q108 with respect to SEQ ID NO: 292.
- the additional modified signaling agent is IL-18.
- the modified signaling agent has reduced affinity and/or activity for I L-18Ra and/or IL-18R ⁇ .
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-18Ra and/or IL-18R ⁇ .
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for IL-18Ra type II, which is an isoform of IL-18Ra that lacks the TIR domain required for signaling.
- the wild type IL-18 has the amino acid sequence of SEQ ID NO:245.
- the modified IL-18 agent may comprise one or more mutations in amino acids or amino acid regions selected from Y37-K44, R49-Q54, D59-R63, E67-C74, R80, M87-A97, N 127-K129, Q139-M149, K165- K171, R183 and Q190-N191, as described in WO/2015/007542, the entire contents of which are hereby incorporated by reference (numbering based on the human IL-18 sequence, Genbank accession number AAV38697, version AAV38697.1, Gl: 54696650).
- the additional modified signaling agent is IL-33.
- the modified signaling agent has reduced affinity and/or activity for the ST-2 receptor and IL-1 RAcP.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for the ST-2 receptor and IL-1 RAcP.
- the wild type IL-33 has the amino acid sequence of SEQ ID NO:246.
- the modified IL-33 agent may comprise one or more mutations in amino acids or amino acid regions selected from 1113-Y122, S127-E139, E144-D157, Y163-M183, E200, Q215, L220-C227 and T260-E269, as described in WO/2015/007542, the entire contents of which are hereby incorporated by reference (numbering based on the human sequence, Genbank accession number NP_254274, version NP_254274.1, GL15559209).
- the modified signaling agent is epidermal growth factor (EGF).
- EGF is a member of a family of potent growth factors. Members include EGF, HB-EGF, and others such as TGFalpha, amphiregulin, neuregulins, epiregulin, betacellulin.
- EGF family receptors include EGFR (ErbB1), ErbB2, ErbB3 and ErbB4. These may function as homodimeric and /or heterodimeric receptor subtypes. The different EGF family members exhibit differential selectivity for the various receptor subtypes. For example, EGF associates with ErbB1/ErbB1, ErbB1/ErbB2, ErbB4/ErbB2 and some other heterodimeric subtypes.
- HB-EGF has a similar pattern, although it also associates with ErbB4/4.
- Modulation of EGF (EGF-like) growth factor signaling, positively or negatively, is of considerable therapeutic interest.
- EGF EGF-like growth factor
- inhibition of EGFRs signaling is of interest in the treatment of various cancers where EGFR signaling constitutes a major growth promoting signal.
- stimulation of EGFRs signaling is of therapeutic interest in, for example, promoting wound healing (acute and chronic), oral mucositis (a major side-effect of various cancer therapies, including, without limitation radiation therapy).
- the additional modified signaling agent has reduced affinity and/or activity for ErbB1 , ErbB2, ErbB3, and/or ErbB4.
- the modified signaling agent binds to one or more ErbB1, ErbB2, ErbB3, and ErbB4 and antagonizes the activity of the receptor.
- the modified signaling agent has reduced affinity and/or activity for ErbB1, ErbB2, ErbB3, and/or ErbB4 which allows for the activity of the receptor to be antagonized in an attenuated fashion.
- Such embodiments find use in, for example, treatments of cancer.
- the modified signaling agent has reduced affinity and/or activity for ErbBl ErbB1 is the therapeutic target of kinase inhibitors -most have side effects because they are not very selective (e.g ., gefitinib, erlotinib, afatinib, brigatinib and icotinib).
- attenuated antagonistic ErbBl signaling is more on-target and has less side effects than other agents targeting receptors for EGF.
- the additional modified signaling agent has reduced affinity and/or activity (e.g. antagonistic e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference) for ErbBl and/or substantially reduced or ablated affinity and/or activity for ErbB4 or other subtypes it may interact with.
- affinity and/or activity e.g. antagonistic e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference
- antagonistic e.g. natural antagonistic activity or antagonistic activity that is the result of one or more mutations, see, e.g., WO 2015/007520, the entire contents of which are hereby incorporated by reference
- anti-selective suppression e.g.
- the additional modified signaling agent has reduced affinity and/or activity (e.g. agonistic) for ErbB4 and/or other subtypes it may interact with.
- a selective activation of ErbBl signaling is achieved (e.g. epithelial cells).
- Such a construct finds use, in some embodiments, in the treatment of wounds (promoting would healing) with reduced side effects, especially for treatment of chronic conditions and application other than topical application of a therapeutic (e.g. systemic wound healing).
- the modified signaling agent is insulin or insulin analogs.
- the modified insulin or insulin analog has reduced affinity and/or activity for the insulin receptor and/or IGF1 or IGF2 receptor.
- the modified insulin or insulin analog has substantially reduced or ablated affinity and/or activity for the insulin receptor and/or IGF1 or IGF2 receptor. Attenuated response at the insulin receptor allows for the control of diabetes, obesity, metabolic disorders and the like while directing away from IGF1 or IGF2 receptor avoids pro-cancer effects.
- the modified signaling agent is insulin-like growth factor-l or insulin-like growth factor-ll (IGF-1 or IGF-2). In an embodiment, the modified signaling agent is IGF-1 . In such an embodiment, the modified signaling agent has reduced affinity and/or activity for the insulin receptor and/or IGF1 receptor. In an embodiment, the modified signaling agent may bind to the IGF1 receptor and antagonize the activity of the receptor. In such an embodiment, the modified signaling agent has reduced affinity and/or activity for IGF1 receptor which allows for the activity of the receptor to be antagonized in an attenuated fashion. In some embodiments, the modified signaling agent has substantially reduced or ablated affinity and/or activity for the insulin receptor and/or IGF1 receptor.
- the modified signaling agent has reduced affinity and/or activity for IGF2 receptor which allows for the activity of the receptor to be antagonized in an attenuated fashion.
- the modified signaling agent has substantially reduced or ablated affinity and/or activity for the insulin receptor and accordingly does not interfere with insulin signaling. In various embodiments, this applies to cancer treatment.
- the present agents may prevent IR isoform A from causing resistance to cancer treatments.
- the modified signaling agent is EPO.
- the modified EPO agent has reduced affinity and/or activity for the EPO receptor (EPOR) receptor and/or the ephrin receptor (EphR) relative to wild type EPO or other EPO based agents described herein.
- the modified EPO agent has substantially reduced or ablated affinity and/or activity for the EPO receptor (EPOR) receptor and/or the Eph receptor (EphR).
- Illustrative EPO receptors include, but are not limited to, an EPOR homodimer or an EPOR/CD131 heterodimer. Also included as an EPO receptor is beta-common receptor ( cR).
- Eph receptors include, but are not limited to, EPHA1 , EPHA2, EPHA3, EPHA4, EPHA5, EPHA6, EPHA7, EPHA8, EPHA9, EPHA10, EPHB1, EPHB2, EPHB3, EPHB4, EPHB5, and EPHB6.
- the modified EPO protein comprises one or more mutations that cause the EPO protein to have reduced affinity for receptors that comprise one or more different EPO receptors or Eph receptors (e.g . heterodimer, heterotrimers, etc., including by way of non-limitation: EPOR-EPHB4, EPOR- cR-EPOR).
- EPOR-EPHB4 EPOR- cR-EPOR
- the human EPO has the amino acid sequence of SEQ ID NO:247 (first 27 amino acids are the signal peptide).
- the human EPO protein is the mature form of EPO (with the signal peptide being cleaved off) which is a glycoprotein of 166 amino acid residues having the sequence of SEQ ID NO:248.
- the structure of the human EPO protein is predicted to comprise four-helix bundles including helices A, B, C, and D.
- the modified EPO protein comprises one or more mutations located in four regions of the EPO protein which are important for bioactivity, i.e., amino acid residues 10-20, 44-51, 96-108, and 142-156.
- the one or more mutations are located at residues 11-15, 44-51, 100-108, and 147-151.
- the modified EPO protein comprises mutations in residues between amino acids 41-52 and amino acids 147, 150, 151 , and 155. Without wishing to be bound by theory, it is believed that mutations of these residues have substantial effects on both receptor binding and in vitro biological activity. In some embodiments, the modified EPO protein comprises mutations at residues 11, 14, 15, 100, 103, 104, and 108.
- substitutions include, but are not limited to, one or more of Val11Ser, Arg14Ala, Arg14Gln, Tyr15lle, Pro42Asn, Thr44lle, Lys45Asp, Val46Ala, Tyr51Phe, Ser100Glu, Seri OOThr, Arg103Ala, Ser104lle, Ser104Ala, Leu108Lys, Asn147Lys, Arg150Ala, Gly151 Ala, and Leu155Ala.
- the modified EPO protein comprises mutations that effect bioactivity and not binding, e.g. those listed in Eliot, ef a/. Mapping of the Active Site of Recombinant Human Erythropoietin January 15, 1997; Blood : 89 (2), the entire contents of which are hereby incorporated by reference.
- the modified EPO protein comprises one or more mutations involving surface residues of the EPO protein which are involved in receptor contact. Without wishing to be bound by theory, it is believed that mutations of these surface residues are less likely to affect protein folding thereby retaining some biological activity. Illustrative surface residues that may be mutated include, but are not limited to, residues 147 and 150. In illustrative embodiments, the mutations are substitutions including, one or more of N147A, N147K, R150A and R150E.
- the modified EPO protein comprises one or more mutations at residues N59, E62, L67, and L70, and one or more mutations that affect disulfide bond formation. Without wishing to be bound by theory, it is believed that these mutations affect folding and/or are predicted be in buried positions and thus affects biological activity indirectly.
- the modified EPO protein comprises a K20E substitution which significantly reduces receptor binding. See Elliott, ef a/., (1997) Blood, 89:493-502, the entire contents of which are hereby incorporated by reference.
- the signaling agent is a toxin or toxic enzyme.
- the toxin or toxic enzyme is derived from plants and bacteria.
- Illustrative toxins or toxic enzymes include, but are not limited to, the diphtheria toxin, Pseudomonas toxin, anthrax toxin, ribosome-inactivating proteins (RIPs) such as ricin and saporin, modeccin, abrin, gelonin, and poke weed antiviral protein. Additional toxins include those disclosed in Mathew ef a/., (2009) Cancer Sci 100(8): 1359-65, the entire disclosures are hereby incorporated by reference.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be utilized to induce cell death in cell-type specific manner.
- the toxin may be modified, e.g. mutated, to reduce affinity and/or activity of the toxin for an attenuated effect, as described with other signaling agents herein.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, optionally comprise one or more linkers.
- the present chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes comprise a linker connecting the targeting moiety and the signaling agent (e.g., a modified IL-2).
- the present chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes comprise a signaling agent (e.g., a modified IL-2) that comprises a linker.
- the linker may be utilized to link various functional groups, residues, or moieties as described herein to the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes.
- the linker is a single amino acid or a plurality of amino acids that does not affect or reduce the stability, orientation, binding, neutralization, and/or clearance characteristics of the binding regions and the binding protein.
- the linker is selected from a peptide, a protein, a sugar, or a nucleic acid.
- vectors encoding the present chimeric proteins or chimeric protein complexes such as Fc- based chimeric protein complexes, linked as a single nucleotide sequence to any of the linkers described herein are provided and may be used to prepare such chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes.
- the substituents of the Fc-based chimeric protein complex are expressed as nucleotide sequences in a vector.
- the linker length allows for efficient binding of a targeting moiety and the signaling agent (e.g., a modified IL-2) to their receptors.
- the linker length allows for efficient binding of one of the targeting moieties and the signaling agent to receptors on the same cell.
- the linker length is at least equal to the minimum distance between the binding sites of one of the targeting moieties and the signaling agent to receptors on the same cell. In some embodiments the linker length is at least twice, or three times, or four times, or five times, or ten times, or twenty times, or 25 times, or 50 times, or one hundred times, or more the minimum distance between the binding sites of one of the targeting moieties and the signaling agent to receptors on the same cell.
- the linker length allows for efficient binding of one of the targeting moieties and the signaling agent to receptors on the same cell, the binding being sequential, e.g. targeting moiety/receptor binding preceding signaling agent/receptor binding.
- the linkers have lengths that allow for the formation of a site that has a disease cell and an effector cell without steric hindrance that would prevent modulation of the either cell.
- the linker may be derived from naturally-occurring multi-domain proteins or are empirical linkers as described, for example, in Chichili et al social (2013), Protein Sci. 22(2): 153-167, Chen et al friction (2013), Adv Drug Deliv Rev. 65(10): 1357-1369, the entire contents of which are hereby incorporated by reference.
- the linker may be designed using linker designing databases and computer programs such as those described in Chen etal., (2013), Adv Drug Deliv Rev. 65(10): 1357-1369 and Crasto et al., (2000), Protein Eng.
- the linker may be functional.
- the linker may function to improve the folding and/or stability, improve the expression, improve the pharmacokinetics, and/or improve the bioactivity of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- the linker is a polypeptide. In some embodiments, the linker is less than about 100 amino acids long. For example, the linker may be less than about 100, about 95, about 90, about 85, about 80, about 75, about 70, about 65, about 60, about 55, about 50, about 45, about 40, about 35, about 30, about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, or about 2 amino acids long. In some embodiments, the linker is a polypeptide. In some embodiments, the linker is greater than about 100 amino acids long.
- the linker may be greater than about 100, about 95, about 90, about 85, about 80, about 75, about 70, about 65, about 60, about 55, about 50, about 45, about 40, about 35, about 30, about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, or about 2 amino acids long.
- the linker is flexible. In another embodiment, the linker is rigid.
- a linker connects the two targeting moieties to each other, and this linker has a short length and a linker connects a targeting moiety and a signaling agent this linker is longer than the linker connecting the two targeting moieties.
- the difference in amino acid length between the linker connecting the two targeting moieties and the linker connecting a targeting moiety and a signaling agent may be about 100, about 95, about 90, about 85, about 80, about 75, about 70, about 65, about 60, about 55, about 50, about 45, about 40, about 35, about 30, about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, or about 2 amino acids.
- the linker is substantially comprised of glycine and serine residues ( e.g . about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or about 97% glycines and serines).
- the linker is (Gly4Ser) n , where n is from about 1 to about 8, e.g. 1, 2, 3, 4, 5, 6, 7, or 8 (SEQ ID NO:249 -SEQ ID NO:256, respectively).
- the linker is (Gly3Ser) n , where n is from about 1 to about 8, e.g.
- the linker sequence is GGSGGSGGGGSGGGGS (SEQ ID NO:257).
- the linker is one or more of GGGSE (SEQ ID NO: 272), GSESG (SEQ ID NO: 273), GSEGS (SEQ ID NO: 274), GEGGSGEGSSGEGSSSEGGGSEGGGSEGGGSEGGS (SEQ ID NO: 275), and a linker of randomly placed G, S, and E every 4 amino acid intervals.
- the linker is a hinge region of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g. lgG1, lgG2, lgG3, and lgG4, and lgA1 and lgA2)).
- the linker is a hinge region of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g. lgG1, lgG2, lgG3, and lgG4, and lgA1 and lgA2)).
- the hinge region acts as a flexible spacer, allowing the Fab portion to move freely in space.
- the hinge domains are structurally diverse, varying in both sequence and length among immunoglobulin classes and subclasses. For example, the length and flexibility of the hinge region varies among the IgG subclasses.
- the hinge region of lgG1 encompasses amino acids 216-231 and, because it is freely flexible, the Fab fragments can rotate about their axes of symmetry and move within a sphere centered at the first of two inter-heavy chain disulfide bridges.
- lgG2 has a shorter hinge than lgG1, with 12 amino acid residues and four disulfide bridges.
- the hinge region of lgG2 lacks a glycine residue, is relatively short, and contains a rigid poly-proline double helix, stabilized by extra inter-heavy chain disulfide bridges. These properties restrict the flexibility of the lgG2 molecule.
- lgG3 differs from the other subclasses by its unique extended hinge region (about four times as long as the lgG1 hinge), containing 62 amino acids (including 21 prolines and 11 cysteines), forming an inflexible poly-proline double helix.
- the Fab fragments are relatively far away from the Fc fragment, giving the molecule a greater flexibility.
- the elongated hinge in lgG3 is also responsible for its higher molecular weight compared to the other subclasses.
- the hinge region of lgG4 is shorter than that of lgG1 and its flexibility is intermediate between that of lgG1 and lgG2.
- the flexibility of the hinge regions reportedly decreases in the order lgG3>lgG1>lgG4>lgG2.
- the immunoglobulin hinge region can be further subdivided functionally into three regions: the upper hinge region, the core region, and the lower hinge region.
- the upper hinge region includes amino acids from the carboxyl end of C to the first residue in the hinge that restricts motion, generally the first cysteine residue that forms an interchain disulfide bond between the two heavy chains.
- the length of the upper hinge region correlates with the segmental flexibility of the antibody.
- the core hinge region contains the inter-heavy chain disulfide bridges, and the lower hinge region joins the amino terminal end of the CH2 domain and includes residues in CH2. Id.
- the core hinge region of wild-type human lgG1 contains the sequence Cys-Pro-Pro-Cys (SEQ ID NO: 276), which when dimerized by disulfide bond formation, results in a cyclic octapeptide believed to act as a pivot, thus conferring flexibility.
- the present linker comprises, one, or two, or three of the upper hinge region, the core region, and the lower hinge region of any antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses ( e.g . lgG1, lgG2, lgG3, and lgG4, and lgA1 and lgA2)).
- the hinge region may also contain one or more glycosylation sites, which include a number of structurally distinct types of sites for carbohydrate attachment.
- lgA1 contains five glycosylation sites within a 17-amino-acid segment of the hinge region, conferring resistance of the hinge region polypeptide to intestinal proteases, considered an advantageous property for a secretory immunoglobulin.
- the linker of the present invention comprises one or more glycosylation sites.
- the linker is a hinge-CH2-CH3 domain of a human lgG4 antibody.
- the linker is a synthetic linker such as PEG.
- the linker may be functional.
- the linker may function to improve the folding and/or stability, improve the expression, improve the pharmacokinetics, and/or improve the bioactivity of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- the linker may function to target the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex to a particular cell type or location.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may include one or more functional groups, residues, or moieties.
- the one or more functional groups, residues, or moieties are attached or genetically fused to any of the signaling agents or targeting moieties described herein.
- such functional groups, residues or moieties confer one or more desired properties or functionalities to the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention.
- each of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may by conjugated and/or fused with another agent to extend half-life or otherwise improve pharmacodynamic and pharmacokinetic properties.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be fused or conjugated with one or more of PEG, XTEN (e.g., as rPEG), polysialic acid (POLYXEN), albumin (e.g., human serum albumin or HAS), elastin- like protein (ELP), PAS, HAP, GLK, CTP, transferrin, and the like.
- each of the individual chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is fused to one or more of the agents described in BioDrugs (2015) 29:215-239, the entire contents of which are hereby incorporated by reference.
- the functional groups, residues, or moieties comprise a suitable pharmacologically acceptable polymer, such as poly(ethyleneglycol) (PEG) or derivatives thereof (such as methoxypoly(ethyleneglycol) or mPEG).
- PEG poly(ethyleneglycol)
- attachment of the PEG moiety increases the half- life and/or reduces the immunogenecity of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- any suitable form of pegylation can be used, such as the pegylation used in the art for antibodies and antibody fragments (including but not limited to single domain antibodies such as VHHs); see, for example, Chapman, Nat.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention is modified so as to suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the amino-and/or carboxy-terminus of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex, using techniques known in the art.
- the functional groups, residues, or moieties comprise N-linked or O-linked glycosylation.
- the N-linked or O-linked glycosylation is introduced as part of a co-translational and/or post- translational modification.
- the functional groups, residues, or moieties comprise one or more detectable labels or other signal-generating groups or moieties.
- Suitable labels and techniques for attaching, using and detecting them are known in the art and, include, but are not limited to, fluorescent labels (such as fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine and fluorescent metals such as Eu or others metals from the lanthanide series), phosphorescent labels, chemiluminescent labels or bioluminescent labels (such as luminal, isoluminol, theromatic acridinium ester, imidazole, acridinium salts, oxalate ester, dioxetane or GFP and its analogs), radio-isotopes, metals, metals chelates or metallic cations or other metals or metallic cations that are particularly suited
- VHHs and polypeptides of the invention may, for example, be used for in vitro, in vivo or in situ assays (including immunoassays known per se such as ELISA, RIA, EIA and other “sandwich assays,” etc.) as well as in vivo diagnostic and imaging purposes, depending on the choice of the specific label.
- the functional groups, residues, or moieties comprise a tag that is attached or genetically fused to the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may include a single tag or multiple tags.
- the tag for example is a peptide, sugar, or DNA molecule that does not inhibit or prevent binding of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex to its target or any other antigen of interest such as tumor antigens.
- the tag is at least about: three to five amino acids long, five to eight amino acids long, eight to twelve amino acids long, twelve to fifteen amino acids long, or fifteen to twenty amino acids long.
- Illustrative tags are described for example, in U.S. Patent Publication No. US2013/0058962.
- the tag is an affinity tag such as glutathione-S- transferase (GST) and histidine (His) tag.
- GST glutathione-S- transferase
- His histidine
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprises a His tag.
- the functional groups, residues, or moieties comprise a chelating group, for example, to chelate one of the metals or metallic cations.
- Suitable chelating groups include, without limitation, diethyl-enetriaminepentaacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
- the functional groups, residues, or moieties comprise a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair.
- a functional group may be used to link the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention to another protein, polypeptide or chemical compound that is bound to the other half of the binding pair, i.e., through formation of the binding pair.
- a chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be conjugated to biotin, and linked to another protein, polypeptide, compound or carrier conjugated to avidin or streptavidin.
- such a conjugated chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be used as a reporter, for example, in a diagnostic system where a detectable signal-producing agent is conjugated to avidin or streptavidin.
- binding pairs may, for example, also be used to bind the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex to a carrier, including carriers suitable for pharmaceutical purposes.
- a carrier including carriers suitable for pharmaceutical purposes.
- One non limiting example are the liposomal formulations described by Cao and Suresh, Journal of Drug Targeting, 8, 4, 257 (2000).
- Such binding pairs may also be used to link a therapeutically active agent to the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention.
- DNA sequences encoding the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention can be chemically synthesized using methods known in the art.
- Synthetic DNA sequences can be ligated to other appropriate nucleotide sequences, including, e.g., expression control sequences, to produce gene expression constructs encoding the desired chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes.
- the present invention provides for isolated nucleic acids comprising a nucleotide sequence encoding the chimeric proteins or chimeric protein complexes such as Fc- based chimeric protein complexes, of the invention.
- Nucleic acids encoding the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention can be incorporated (ligated) into expression vectors, which can be introduced into host cells through transfection, transformation, or transduction techniques.
- nucleic acids encoding the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention can be introduced into host cells by retroviral transduction.
- Illustrative host cells are £ coli cells, Chinese hamster ovary (CHO) cells, human embryonic kidney 293 (HEK 293) cells, FleLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), insect Sf9 cells, and myeloma cells.
- Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention.
- the present invention provides expression vectors comprising nucleic acids that encode the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention.
- the present invention additional provides host cells comprising such expression vectors.
- a gene is to be expressed in £. coli, it is first cloned into an expression vector by positioning the engineered gene downstream from a suitable bacterial promoter, e.g., Trp or Tac, and a prokaryotic signal sequence.
- a suitable bacterial promoter e.g., Trp or Tac
- a prokaryotic signal sequence e.g., Trp or Tac
- the engineered gene is to be expressed in eukaryotic host cells, e.g., CHO cells, it is first inserted into an expression vector containing for example, a suitable eukaryotic promoter, a secretion signal, enhancers, and various introns.
- the gene construct can be introduced into the host cells using transfection, transformation, or transduction techniques.
- the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the invention can be produced by growing a host cell transfected with an expression vector encoding the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, under conditions that permit expression of the protein. Following expression, the protein can be harvested and purified using techniques well known in the art, e.g., affinity tags such as glutathione-S-transferase (GST) and histidine tags or by chromatography.
- GST glutathione-S-transferase
- the present invention provides for a nucleic acid encoding a chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the present invention.
- the present invention provides for a host cell comprising a nucleic acid encoding a chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the present invention.
- IL-2, its variant, or a chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, comprising the IL-2 or its variant may be expressed in vivo, for instance, in a patient.
- the IL-2, its variant, or a chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes comprising the IL-2 or its variant may administered in the form of nucleic acid which encodes for the IL-2 or its variant or chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprising IL2 or its variant.
- the nucleic acid is DNA or RNA.
- the IL-2, its variant, or a chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex comprising the IL-2 or its variant is encoded by a modified mRNA, i.e. an mRNA comprising one or more modified nucleotides.
- the modified mRNA comprises one or modifications found in U.S. Patent No. 8,278,036, the entire contents of which are hereby incorporated by reference.
- the modified mRNA comprises one or more of m5C, m5U, m6A, s2U, Y, and 2'- O-methyl-U.
- the present invention relates to administering a modified mRNA encoding one or more of the present chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes.
- the present invention relates to gene therapy vectors comprising the same.
- the present invention relates to gene therapy methods comprising the same.
- the nucleic acid is in the form of an oncolytic virus, e.g. an adenovirus, reovirus, measles, herpes simplex, Newcastle disease virus or vaccinia.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, comprises a targeting moiety that is a VHH.
- the VHH is not limited to a specific biological source or to a specific method of preparation.
- the VHH can generally be obtained: (1) by isolating the VHH domain of a naturally occurring heavy chain antibody; (2) by expression of a nucleotide sequence encoding a naturally occurring VHH domain; (3) by “humanization” of a naturally occurring VHH domain or by expression of a nucleic acid encoding a such humanized VHH domain; (4) by “camelization” of a naturally occurring VH domain from any animal species, such as from a mammalian species, such as from a human being, or by expression of a nucleic acid encoding such a camelized VH domain; (5) by “camelization” of a “domain antibody” or “Dab” as described in the art, or by expression of a nucleic acid encoding such a camelized VH domain; (6) by using synthetic or semi-synthetic techniques for preparing proteins, polypeptides or other amino acid sequences known in the art; (7) by preparing a nucleic acid encoding a VH FI
- VHH sequences can generally be generated or obtained by suitably immunizing a species of Camelid with a molecule of based on the target of interest (e.g., XCR1 , Clec9a, CD8, SIRPIa, FAP, etc.) (i.e., so as to raise an immune response and/or heavy chain antibodies directed against the target of interest), by obtaining a suitable biological sample from the Camelid (such as a blood sample, or any sample of B-cells), and by generating VHH sequences directed against the target of interest, starting from the sample, using any suitable known techniques.
- a species of Camelid with a molecule of based on the target of interest (e.g., XCR1 , Clec9a, CD8, SIRPIa, FAP,
- naturally occurring VHH domains against the target of interest can be obtained from naive libraries of Camelid VHH sequences, for example, by screening such a library using the target of interest or at least one part, fragment, antigenic determinant or epitope thereof using one or more screening techniques known in the art.
- Such libraries and techniques are, for example, described in WO 9937681, WO 0190190, WO 03025020 and WO 03035694, the entire contents of which are hereby incorporated by reference.
- improved synthetic or semi-synthetic libraries derived from naive VHH libraries may be used, such as VHH libraries obtained from naive VHH libraries by techniques such as random mutagenesis and/or CDR shuffling, as for example, described in WO 0043507, the entire contents of which are hereby incorporated by reference.
- another technique for obtaining VHH sequences directed against a target of interest involves suitably immunizing a transgenic mammal that is capable of expressing heavy chain antibodies (i.e., so as to raise an immune response and/or heavy chain antibodies directed against the target of interest), obtaining a suitable biological sample from the transgenic mammal (such as a blood sample, or any sample of B-cells), and then generating VHH sequences directed against XCR1 starting from the sample, using any suitable known techniques.
- a suitable biological sample such as a blood sample, or any sample of B-cells
- VHH sequences directed against XCR1 starting from the sample, using any suitable known techniques.
- the heavy chain antibody-expressing mice and the further methods and techniques described in WO 02085945 and in WO 04049794 can be used.
- This can be performed using humanization techniques known in the art.
- possible humanizing substitutions or combinations of humanizing substitutions may be determined by methods known in the art, for example, by a comparison between the sequence of a VHH and the sequence of a naturally occurring human VH domain.
- the humanizing substitutions are chosen such that the resulting humanized VHHs still retain advantageous functional properties.
- the VHHs of the invention may become more “human-like,” while still retaining favorable properties such as a reduced immunogenicity, compared to the corresponding naturally occurring VHH domains.
- the humanized VHHs of the invention can be obtained in any suitable manner known in the art and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VHH domain as a starting material.
- such “camelizing” substitutions are inserted at amino acid positions that form and/or are present at the VH-VL interface, and/or at the so-called Camelidae hallmark residues (see, for example, WO9404678, the entire contents of which are hereby incorporated by reference).
- the VH sequence that is used as a starting material or starting point for generating or designing the camelized VHH is a VH sequence from a mammal, for example, the VH sequence of a human being, such as a VH3 sequence.
- the camelized VHHs can be obtained in any suitable manner known in the art (i.e., as indicated under points (1)-(8) above) and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VH domain as a starting material.
- both “humanization” and “camelization” can be performed by providing a nucleotide sequence that encodes a naturally occurring VHH domain or VH domain, respectively, and then changing, in a manner known in the art, one or more codons in the nucleotide sequence in such a way that the new nucleotide sequence encodes a “humanized” or “camelized” VHH, respectively.
- This nucleic acid can then be expressed in a manner known in the art, so as to provide the desired VHH of the invention.
- the amino acid sequence of the desired humanized or camelized VHH of the invention can be designed and then synthesized de novo using techniques for peptide synthesis known in the art.
- a nucleotide sequence encoding the desired humanized or camelized VHH can be designed and then synthesized de novo using techniques for nucleic acid synthesis known in the art, after which the nucleic acid thus obtained can be expressed in a manner known in the art, so as to provide the desired VHH of the invention.
- VHHs of the invention and/or nucleic acids encoding the same starting from naturally occurring VH sequences or VHH sequences, are known in the art, and may, for example, comprise combining one or more parts of one or more naturally occurring VH sequences (such as one or more FR sequences and/or CDR sequences), one or more parts of one or more naturally occurring VHH sequences (such as one or more FR sequences or CDR sequences), and/or one or more synthetic or semi-synthetic sequences, in a suitable manner, so as to provide a VHH of the invention or a nucleotide sequence or nucleic acid encoding the same.
- the chimeric proteins or chimeric protein complexes can possess a sufficiently basic functional group, which can react with an inorganic or organic acid, or a carboxyl group, which can react with an inorganic or organic base, to form a pharmaceutically acceptable salt.
- a pharmaceutically acceptable acid addition salt is formed from a pharmaceutically acceptable acid, as is well known in the art.
- Such salts include the pharmaceutically acceptable salts listed in, for example, Journal of Pharmaceutical Science, 66, 2-19 (1977) and The Handbook of Pharmaceutical Salts; Properties, Selection, and Use. P. H. Stahl and C. G.
- salts include, by way of non-limiting example, sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, camphorsulfonate, pamoate, phenylacetate, trifluoroacetate
- Suitable bases include, but are not limited to, hydroxides of alkali metals such as sodium, potassium, and lithium; hydroxides of alkaline earth metal such as calcium and magnesium; hydroxides of other metals, such as aluminum and zinc; ammonia, and organic amines, such as unsubstituted or hydroxy-substituted mono-, di-, or tri-alkylamines, dicyclohexylamine; tributyl amine; pyridine; N-methyl, N-ethylamine; diethylamine; triethylamine; mono-, bis-, or tris-(2-OH-lower alkylamines), such as mono-; bis-, or tris-(2-hydroxyethyl)amine, 2-hydroxy-tert-butylamine, or tris- (hydroxy
- compositions described herein are in the form of a pharmaceutically acceptable salt.
- the present invention pertains to pharmaceutical compositions comprising the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, described herein and a pharmaceutically acceptable carrier or excipient.
- Any pharmaceutical compositions described herein can be administered to a subject as a component of a composition that comprises a pharmaceutically acceptable carrier or vehicle.
- Such compositions can optionally comprise a suitable amount of a pharmaceutically acceptable excipient so as to provide the form for proper administration.
- pharmaceutical excipients can be liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- the pharmaceutical excipients can be, for example, saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like.
- auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used.
- the pharmaceutically acceptable excipients are sterile when administered to a subject. Water is a useful excipient when any agent described herein is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, specifically for injectable solutions.
- suitable pharmaceutical excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Any agent described herein, if desired, can also comprise minor amounts of wetting or emulsifying agents, or pH buffering agents. Other examples of suitable pharmaceutical excipients are described in Remington’s Pharmaceutical Sciences 1447-1676 (Alfonso R. Gennaro eds., 19th ed. 1995), incorporated herein by reference.
- the present invention includes the described pharmaceutical compositions (and/or additional therapeutic agents) in various formulations.
- Any inventive pharmaceutical composition (and/or additional therapeutic agents) described herein can take the form of solutions, suspensions, emulsion, drops, tablets, pills, pellets, capsules, capsules containing liquids, gelatin capsules, powders, sustained-release formulations, suppositories, emulsions, aerosols, sprays, suspensions, lyophilized powder, frozen suspension, dessicated powder, or any other form suitable for use.
- the composition is in the form of a capsule.
- the composition is in the form of a tablet.
- the pharmaceutical composition is formulated in the form of a soft-gel capsule.
- the pharmaceutical composition is formulated in the form of a gelatin capsule.
- the pharmaceutical composition is formulated as a liquid.
- inventive pharmaceutical compositions can also include a solubilizing agent.
- the agents can be delivered with a suitable vehicle or delivery device as known in the art.
- Combination therapies outlined herein can be co-delivered in a single delivery vehicle or delivery device.
- compositions comprising the inventive pharmaceutical compositions (and/or additional agents) of the present invention may conveniently be presented in unit dosage forms and may be prepared by any of the methods well known in the art of pharmacy. Such methods generally include the step of bringing the therapeutic agents into association with a carrier, which constitutes one or more accessory ingredients. Typically, the formulations are prepared by uniformly and intimately bringing the therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into dosage forms of the desired formulation (e.g., wet or dry granulation, powder blends, etc., followed by tableting using conventional methods known in the art).
- a carrier which constitutes one or more accessory ingredients.
- the formulations are prepared by uniformly and intimately bringing the therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into dosage forms of the desired formulation (e.g., wet or dry granulation, powder blends, etc., followed by tableting
- any pharmaceutical compositions (and/or additional agents) described herein is formulated in accordance with routine procedures as a composition adapted for a mode of administration described herein.
- Routes of administration include, for example: oral, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, sublingual, intranasal, intracerebral, intravaginal, transdermal, rectally, by inhalation, or topically.
- Administration can be local or systemic.
- the administering is effected orally.
- the administration is by parenteral injection.
- the mode of administration can be left to the discretion of the practitioner, and depends in-part upon the site of the medical condition. In most instances, administration results in the release of any agent described herein into the bloodstream.
- compositions for oral delivery can be in the form of tablets, lozenges, aqueous or oily suspensions, granules, powders, emulsions, capsules, syrups, or elixirs, for example.
- Orally administered compositions can comprise one or more agents, for example, sweetening agents such as fructose, aspartame or saccharin; flavoring agents such as peppermint, oil of wintergreen, or cherry; coloring agents; and preserving agents, to provide a pharmaceutically palatable preparation.
- compositions can be coated to delay disintegration and absorption in the gastrointestinal tract thereby providing a sustained action over an extended period of time.
- Selectively permeable membranes surrounding an osmotically active driving any chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex described herein are also suitable for orally administered compositions.
- fluid from the environment surrounding the capsule is imbibed by the driving compound, which swells to displace the agent or agent composition through an aperture.
- delivery platforms can provide an essentially zero order delivery profile as opposed to the spiked profiles of immediate release formulations.
- a time-delay material such as glycerol monostearate or glycerol stearate can also be useful.
- Oral compositions can include standard excipients such as mannitol, lactose, starch, magnesium stearate, sodium saccharin, cellulose, and magnesium carbonate.
- the excipients are of pharmaceutical grade.
- Suspensions in addition to the active compounds, may contain suspending agents such as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, tragacanth, etc., and mixtures thereof.
- Dosage forms suitable for parenteral administration include, for example, solutions, suspensions, dispersions, emulsions, and the like. They may also be manufactured in the form of sterile solid compositions (e.g. lyophilized composition), which can be dissolved or suspended in sterile injectable medium immediately before use. They may contain, for example, suspending or dispersing agents known in the art.
- Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl paraben
- antioxidants such as ascorbic acid or sodium bisulfite
- chelating agents such as EDTA
- buffers such as acetates, citrates or phosphates
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
- the carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol), and suitable mixtures thereof.
- the compositions provided herein, alone or in combination with other suitable components, can be made into aerosol formulations (i.e., “nebulized”) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
- compositions (and/or additional agents) described herein can be administered by controlled-release or sustained-release means or by delivery devices that are well known to those of ordinary skill in the art.
- delivery devices include, but are not limited to, those described in U.S. Patent Nos. 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595; 5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; and 5,733,556, each of which is incorporated herein by reference in its entirety.
- Such dosage forms can be useful for providing controlled-or sustained-release of one or more active ingredients using, for example, hydropropyl cellulose, hydropropylmethyl cellulose, polyvinylpyrrolidone, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, microspheres, or a combination thereof to provide the desired release profile in varying proportions.
- Suitable controlled- or sustained-release formulations known to those skilled in the art, including those described herein, can be readily selected for use with the active ingredients of the agents described herein.
- the invention thus provides single unit dosage forms suitable for oral administration such as, but not limited to, tablets, capsules, gelcaps, and caplets that are adapted for controlled- or sustained- release.
- Controlled- or sustained-release of an active ingredient can be stimulated by various conditions, including but not limited to, changes in pH, changes in temperature, stimulation by an appropriate wavelength of light, concentration or availability of enzymes, concentration or availability of water, or other physiological conditions or compounds.
- a controlled-release system can be placed in proximity of the target area to be treated, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).
- Other controlled-release systems discussed in the review by Langer, 1990, Science 249:1527-1533 may be used.
- compositions preferably are sterile. Sterilization can be accomplished, for example, by filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.
- the actual dose of the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, to be administered according to the present invention will vary according to the particular dosage form, and the mode of administration. Many factors that may modify the action of the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes. For example, body weight, gender, diet, time of administration, route of administration, rate of excretion, condition of the subject, drug combinations, genetic disposition and reaction sensitivities) can be taken into account by those skilled in the art. Administration can be carried out continuously or in one or more discrete doses within the maximum tolerated dose. Optimal administration rates for a given set of conditions can be ascertained by those skilled in the art using conventional dosage administration tests.
- a suitable dosage of the chimeric proteins or chimeric protein complexes is in a range of about 0.01 ⁇ g/kg to about 100 mg/kg of body weight of the subject, about 0.01 ⁇ g/kg to about 10 mg/kg of body weight of the subject, or about 0.01 ⁇ g/kg to about 1 mg/kg of body weight of the subject for example, about 0.01 ⁇ g/kg, about 0.02 ⁇ g/kg, about 0.03 ⁇ g/kg, about 0.04 ⁇ g/kg, about 0.05 ⁇ g/kg, about 0.06 ⁇ g/kg, about 0.07 ⁇ g/kg, about 0.08 ⁇ g/kg, about 0.09 ⁇ g/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about
- chimeric proteins or chimeric protein complexes can be administered in unit dosage forms (e.g ., tablets, capsules, or liquid formulations) containing, for example, from about 1 ⁇ g to about 100 mg, from about 1 ⁇ g to about 90 mg, from about 1 g to about 80 mg, from about 1 ⁇ g to about 70 mg, from about 1 ⁇ g to about 60 mg, from about 1 ⁇ g to about 50 mg, from about 1 ⁇ g to about 40 mg, from about 1 ⁇ g to about 30 mg, from about 1 ⁇ g to about 20 mg, from about 1 ⁇ g to about 10 mg, from about 1 ⁇ g to about 5 mg, from about 1 ⁇ g to about 3 mg, from about 1 ⁇ g to about 1 mg per unit dosage form, or from about 1 ⁇ g to about 50 ⁇ g per unit dosage form.
- unit dosage forms e.g ., tablets, capsules, or liquid formulations
- unit dosage forms e.g ., tablets, capsules, or liquid formulations
- unit dosage forms
- a unit dosage form can be about 1 ⁇ g, about 2 ⁇ g, about 3 ⁇ g, about 4 ⁇ g, about 5 ⁇ g, about 6 ⁇ g, about 7 ⁇ g, about 8 ⁇ g, about 9 ⁇ g, about 10 ⁇ g, about 11 ⁇ g, about 12 ⁇ g, about 13 ⁇ g, about 14 ⁇ g, about 15 ⁇ g, about 16 ⁇ g, about 17 ⁇ g, about 18 ⁇ g, about 19 ⁇ g, about 20 ⁇ g, about 21 ⁇ g, about 22 ⁇ g, about 23 ⁇ g, about 24 ⁇ g, about 25 ⁇ g, about 26 ⁇ g, about 27 ⁇ g, about 28 ⁇ g, about 29, about 30 ⁇ g, about 35 ⁇ g, about 40 ⁇ g, about 45 ⁇ g, about 50 ⁇ g, about 60 ⁇ g, about 70 ⁇ g, about 80 ⁇ g, about 90 ⁇ g, about 0.1 mg, about 0.2 mg, about 0.3 mg, about 0.4 mg, about
- the chimeric proteins or chimeric protein complexes is administered at an amount of from about 1 ⁇ g to about 100 mg daily, from about 1 ⁇ g to about 90 mg daily, from about 1 ⁇ g to about 80 mg daily, from about 1 ⁇ g to about 70 mg daily, from about 1 ⁇ g to about 60 mg daily, from about 1 ⁇ g to about 50 mg daily, from about 1 ⁇ g to about 40 mg daily, from about 1 ⁇ g to about 30 mg daily, from about 1 ⁇ g to about 20 mg daily, from about 01 ⁇ g to about 10 mg daily, from about 1 ⁇ g to about 5 mg daily, from about 1 ⁇ g to about 3 mg daily, or from about 1 ⁇ g to about 1 mg daily.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is administered at a daily dose of about 1 ⁇ g, about 2 ⁇ g, about 3 ⁇ g, about 4 ⁇ g, about 5 ⁇ g, about 6 ⁇ g, about 7 ⁇ g, about 8 ⁇ g, about 9 ⁇ g, about 10 ⁇ g, about 11 ⁇ g, about 12 ⁇ g, about 13 ⁇ g, about 14 ⁇ g, about 15 ⁇ g, about 16 ⁇ g, about 17 ⁇ g, about 18 ⁇ g, about 19 ⁇ g, about 20 ⁇ g tone about 21 ⁇ g, about 22 ⁇ g, about 23 ⁇ g, about 24 ⁇ g, about 25 ⁇ g, about 26 ⁇ g, about 27 ⁇ g, about 28 ⁇ g, about 29, about 30 ⁇ g, about 35 ⁇ g, about 40 ⁇ g, about 45 ⁇ g, about 50 ⁇ g, about 60 ⁇ g, about 70 ⁇ g, about 80 ⁇ g,
- the pharmaceutical composition comprising the chimeric proteins or chimeric protein complexes may be administered, for example, more than once daily (e.g ., about two times, about three times, about four times, about five times, about six times, about seven times, about eight times, about nine times, or about ten times daily), about once per day, about every other day, about every third day, about once a week, about once every two weeks, about once every month, about once every two months, about once every three months, about once every six months, or about once every year.
- the pharmaceutical composition comprising the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes is administered about three times a week.
- the present chimeric proteins or chimeric protein complexes may be administered for a prolonged period.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complexes, may be administered as described herein for at least about 1 week, at least about 2 weeks, at least about 3 weeks, at least about 4 weeks, at least about 5 weeks, at least about 6 weeks, at least about 7 weeks, at least about 8 weeks, at least about 9 weeks, at least about 10 weeks, at least about 11 weeks, or at least about 12 weeks.
- the chimeric proteins or chimeric protein complexes may be administered for 12 weeks, 24 weeks, 36 weeks or 48 weeks.
- the chimeric proteins or chimeric protein complexes are administered for at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, or at least about 12 months
- the chimeric proteins or chimeric protein complexes may be administered for at least about 1 year, at least about 2 years, at least about 3 years, at least about 4 years, or at least about 5 years.
- the pharmaceutical composition of the present invention is co-administered in conjunction with additional therapeutic agent(s). Co-administration can be simultaneous or sequential.
- the additional therapeutic agent and the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, of the present invention are administered to a subject simultaneously.
- the term “simultaneously” as used herein, means that the additional therapeutic agent and the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, are administered with a time separation of no more than about 60 minutes, such as no more than about 30 minutes, no more than about 20 minutes, no more than about 10 minutes, no more than about 5 minutes, or no more than about 1 minute.
- Administration of the additional therapeutic agent and the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes can be by simultaneous administration of a single formulation (e.g., a formulation comprising the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex) or of separate formulations (e.g., a first formulation including the additional therapeutic agent and a second formulation including the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex).
- a single formulation e.g., a formulation comprising the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex
- separate formulations e.g., a first formulation including the additional therapeutic agent and a second formulation including the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex.
- Co-administration does not require the therapeutic agents to be administered simultaneously, if the timing of their administration is such that the pharmacological activities of the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex overlap in time, thereby exerting a combined therapeutic effect.
- the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex can be administered sequentially.
- the term “sequentially” as used herein means that the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex are administered with a time separation of more than about 60 minutes.
- the time between the sequential administration of the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex can be more than about 60 minutes, more than about 2 hours, more than about 5 hours, more than about 10 hours, more than about 1 day, more than about 2 days, more than about 3 days, more than about 1 week apart, more than about 2 weeks apart, or more than about one month apart.
- the optimal administration times will depend on the rates of metabolism, excretion, and/or the pharmacodynamic activity of the additional therapeutic agent and the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex being administered. Either the additional therapeutic agent or the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex cell may be administered first.
- Co-administration also does not require the therapeutic agents to be administered to the subject by the same route of administration. Rather, each therapeutic agent can be administered by any appropriate route, for example, parenterally or non-parenterally.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex described herein acts synergistically when co-administered with another therapeutic agent.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and the additional therapeutic agent may be administered at doses that are lower than the doses employed when the agents are used in the context of monotherapy.
- the present invention pertains to chemotherapeutic agents as additional therapeutic agents.
- such combination of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and chemotherapeutic agent find use in the treatment of cancers, as described elsewhere herein.
- chemotherapeutic agents include, but are not limited to, alkylating agents such as thiotepa and CYTOXAN cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (e.g., bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; cally statin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (e.g., cryptophycin
- dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L- norleucine, ADRIAMYCIN doxorubicin (including morpholino- doxorubicin, cyanomorpholino-doxorubicin, 2- pyrrolino-doxorubicin and deoxy doxorubicin), epirub
- irinotecan Camptosar, CPT-11 (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); lapatinib (Tykerb); inhibitors of PKC-a, Raf, H-Ras, EGFR (e.g., erlotinib (Tarceva)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- the methods of treatment can further include the use
- the present invention pertains to anti-infectives as additional therapeutic agents.
- the anti-infective is an anti-viral agent including, but not limited to, Abacavir, Acyclovir, Adefovir, Amprenavir, Atazanavir, Cidofovir, Darunavir, Delavirdine, Didanosine, Docosanol, Efavirenz, Elvitegravir, Emtricitabine, Enfuvirtide, Etravirine, Famciclovir, and Foscarnet.
- the anti-infective is an anti-bacterial agent including, but not limited to, cephalosporin antibiotics (cephalexin, cefuroxime, cefadroxil, cefazolin, cephalothin, cefaclor, cefamandole, cefoxitin, cefprozil, and ceftobiprole); fluoroquinolone antibiotics (cipro, Levaquin, floxin, tequin, avelox, and norflox); tetracycline antibiotics (tetracycline, minocycline, oxytetracycline, and doxycycline); penicillin antibiotics (amoxicillin, ampicillin, penicillin V, dicloxacillin, carbenicillin, vancomycin, and methicillin); monobactam antibiotics (aztreonam); and carbapenem antibiotics (ertapenem, doripenem, imipenem/cilastatin, and meropenem).
- cephalosporin antibiotics ce
- the anti-infectives include anti-malarial agents (e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfadoxine/pyrimethamine), metronidazole, tinidazole, ivermectin, pyrantel pamoate, and albendazole.
- anti-malarial agents e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfadoxine/pyrimethamine
- metronidazole e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfa
- the present invention pertains to the use of hepatitis therapeutics as additional therapeutic agents.
- the hepatitis therapeutics include, but are not limited to, IFN-a such as INTRON A or pegylated IFN-a such as Pegasys or PEG-INTRON, ribavirin, boceprevir, simeprevir, sofosbuvir, simeprevir, daclatasvir, ledipasvir/sofosbuvir (Harvoni), ombitasvir/paritaprevir/ritonavir (Technivie), ombitasvir/paritaprevir/ritonavir/dasabuvir (Viekira Pak), lamivudine, adefovir, entecavir, telbivudine, entecavir, tenofovir, velpatasvir, elbasvir, grazoprevir, dasabuvir, and
- the additional therapeutic agent is IFN-a (e.g., INTRON A) or pegylated IFN-a (e.g., Pegasys or PEG-INTRON).
- the additional therapeutic agent is ribavirin.
- the present invention relates to combination therapies using the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and an immunosuppressive agent. In some embodiments, the present invention relates to administration of the Clec9A binding agent to a patient undergoing treatment with an immunosuppressive agent.
- the immunosuppressive agent is TNF.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex act synergistically when co-administered with TNF.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex acts synergistically when co-administered with TNF for use in treating tumor or cancer.
- co-administration of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the present invention and TNF may act synergistically to reduce or eliminate the tumor or cancer, or slow the growth and/or progression and/or metastasis of the tumor or cancer.
- the combination of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and TNF may exhibit improved safety profiles when compared to the agents used alone in the context of monotherapy.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and TNF may be administered at doses that are lower than the doses employed when the agents are used in the context of monotherapy.
- the additional therapeutic agent is an immunosuppressive agent that is an anti-inflammatory agent such as a steroidal anti-inflammatory agent or a non-steroidal anti-inflammatory agent (NSAID).
- an anti-inflammatory agent such as a steroidal anti-inflammatory agent or a non-steroidal anti-inflammatory agent (NSAID).
- NSAID non-steroidal anti-inflammatory agent
- Steroids particularly the adrenal corticosteroids and their synthetic analogues, are well known in the art.
- NSAIDS that may be used in the present invention, include but are not limited to, salicylic acid, acetyl salicylic acid, methyl salicylate, glycol salicylate, salicylmides, benzyl-2, 5-diacetoxybenzoic acid, ibuprofen, fulindac, naproxen, ketoprofen, etofenamate, phenylbutazone, and indomethacin.
- the immunosupressive agent may be cytostatics such as alkylating agents, antimetabolites (e.g., azathioprine, methotrexate), cytotoxic antibiotics, antibodies (e.g., basiliximab, daclizumab, and muromonab), anti-immunophilins (e.g., cyclosporine, tacrolimus, sirolimus), inteferons, opioids, TNF binding proteins, mycophenolates, and small biological agents (e.g., fingolimod, myriocin). Additional anti-inflammatory agents are described, for example, in U.S. Patent No. 4,537,776, the entire contents of which is incorporated by reference herein.
- the present invention pertains to various agents used for treating obesity as additional therapeutic agents.
- agents used for treating obesity include, but are not limited to, orlistat (e.g . ALL1, XENICAL), loracaserin ⁇ e.g. BELVIQ), phentermine-topiramate ⁇ e.g. QSYMIA), sibutramme ⁇ e.g. REDUCTIL or MERJDIA), rimonabant (ACOMPLLA), exenatide ⁇ e.g. BYETTA), pramlintide ⁇ e.g. SYMLIN) phentermine, benzphetamine, diethylpropion, phendimetrazme, bupropion, and metformin.
- orlistat e.g . ALL1, XENICAL
- loracaserin ⁇ e.g. BELVIQ
- phentermine-topiramate e.g. QSYMIA
- sibutramme ⁇ e.g. REDUCTIL
- Agents that interfere with the body's ability to absorb specific nutrients in food are among the additional agents, e.g. orlistat (e.g. ALU, XENICAL), glucomannan, and guar gum.
- Agents that suppress apetite are also among the additional agents, e.g. catecholamines and their derivatives (such as phenteimine and other amphetamine-based drugs), various antidepressants and mood stabilizers (e.g. bupropion and topiramate), anorectics (e.g. dexedrine, digoxin).
- Agents that increase the body's metabolism are also among the additional agents.
- additional therapeutic agents may be selected from among appetite suppressants, neurotransmitter reuptake inhibitors, dopaminergic agonists, serotonergic agonists, modulators of GABAergic signaling, anticonvulsants, antidepressants, monoamine oxidase inhibitors, substance P (NK1) receptor antagonists, melanocortin receptor agonists and antagonists, lipase inhibitors, inhibitors of fat absorption, regulators of energy intake or metabolism, cannabinoid receptor modulators, agents for treating addiction, agents for treating metabolic syndrome, peroxisome proliferator-activated receptor (PPAR) modulators; dipeptidyl peptidase 4 (DPP- 4) antagonists, agents for treating cardiovascular disease, agents for treating elevated triglyceride levels, agents for treating low HDL, agents for treating hypercholesterolemia, and agents for treating hypertension.
- PPAR peroxisome proliferator-activated receptor
- statins e.g. lovastatin, atorvastatin, fluvastatin, rosuvastatin, simvastatin and pravastatin
- omega-3 agents e.g. LOVAZA, EPANQVA, VASCEPA, esterified omega-3's in general, fish oils, krill oils, algal oils.
- additional agents may be selected from among amphetamines, benzodiazepines, suifonyl ureas, meglitinides, thiazolidinediones, biguanides, beta- blockers, XCE inhibitors, diuretics, nitrates, calcium channel blockers, phenlermine, sibutramine, iorcaserin, cetilistat, rimonabant, taranabant, topiramate, gabapentin, valproate, vigabatrin, bupropion, tiagabine, sertraline, fluoxetine, trazodone, zonisamide, methylphenidate, varenicline, naltrexone, diethylpropion, phendimetrazine, rcpaglini.de, nateglinide, glimepiride, metformin, pioglitazone, rosiglilazone, and sitagliptin.
- the present invention pertains to an agent used for treating diabetes as additional therapeutic agents.
- Illustrative anti-diabetic agents include, but are not limited to, sulfonylurea (e.g., DYMELOR (acetohexamide), DIABINESE (chlorpropamide), ORINASE (tolbutamide), and TOLINASE (tolazamide), GLUCOTROL (glipizide), GLUCOTROL XL (extended release), DIABETA (glyburide), MICRONASE (glyburide), GLYNASE PRESTAB (glyburide), and AMARYL (glimepiride)); a Biguanide (e.g.
- metformin GLUCOPHAGE, GLUCOPHAGE XR, RIOMET, FORTAMET, and GLUMETZA
- a thiazolidinedione e.g. ACTOS (pioglitazone) and AVANDIA (rosiglitazone); an alpha-glucosidase inhibitor (e.g., PRECOSE (acarbose) and GLYSET (miglitol); a Meglitinide (e.g., PRANDIN (repaglinide) and STARLIX (nateglinide)); a Dipeptidyl peptidase IV (DPP-IV) inhibitor (e.g., JANUVIA (sitagliptin), NESINA (alogliptin), ONGLYZA (saxagliptin), and TRADJENTA (linagliptin)); Sodium-glucose co-transporter 2 (SGLT2) inhibitor (e.g.
- SGLT2 Sodium-glu
- INVOKANA canaglifozin
- a combination pill e.g. GLUCOVANCE, which combines glyburide (a sulfonylurea) and metformin
- METAGLIP which combines glipizide (a sulfonylurea) and metformin
- AVANDAMET which uses both metformin and rosiglitazone (AVANDIA) in one pill
- KAZANO alogliptin and metformin
- OSENI alogliptin plus pioglitazone
- METFORMIN oral ACTOS oral, BYETTA subcutaneous, JANUVIA oral, WELCHOL oral, JANUMET oral, glipizide oral, glimepiride oral, GLUCOPHAGE oral, LANTUS subcutaneous, glyburide oral, ONGLYZA oral, AMARYI oral, LANTUS SOLOSTAR subcutaneous, BYDUREON subcutaneous, LEVEMIR FLEXPEN subcutaneous
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the present invention act synergistically when used in combination with Chimeric Antigen Receptor (CAR) T-cell therapy.
- CAR Chimeric Antigen Receptor
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex acts synergistically when used in combination with CAR T-cell therapy in treating tumor or cancer.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex agent acts synergistically when used in combination with CAR T-cell therapy in treating blood-based tumors.
- the chimeric proteins or chimeric protein complexes acts synergistically when used in combination with CAR T-cell therapy in treating solid tumors.
- use of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and CAR T-cells may act synergistically to reduce or eliminate the tumor or cancer, or slow the growth and/or progression and/or metastasis of the tumor or cancer.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention induces CAR T-cell division.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention induces CAR T-cell proliferation. In various embodiments, the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention prevents anergy of the CAR T cells.
- the CAR T-cell therapy comprises CAR T cells that target antigens (e.g., tumor antigens) such as, but not limited to, carbonic anhydrase IX (CAIX), 5T4, CD19, CD20, CD22, CD30, CD33, CD38, CD47, CS1, CD138, Lewis-Y, L1-CAM, MUC16, ROR-1, IL13Ra2, gp100, prostate stem cell antigen (PSCA), prostate- specific membrane antigen (PSMA), B-cell maturation antigen (BCMA), human papillomavirus type 16 E6 (HPV- 16 E6), CD171, folate receptor alpha (FR-a), GD2, human epidermal growth factor receptor 2 (FIE R2), mesothelin, EGFRvlll, fibroblast activation protein (FAP), carcinoembryonic antigen (CEA), and vascular endothelial growth factor receptor 2 (VEGF-R2), as well as other tumor antigens (e.
- Additional illustrative tumor antigens include, but are not limited to MART-1/Melan-A, gp100, Dipeptidyl peptidase IV (DPPIV), adenosine deaminase-binding protein (ADAbp), cyclophilin b, Colorectal associated antigen (CRC)-0017-1A/GA733, Carcinoembryonic Antigen (CEA) and its immunogenic epitopes CAP-1 and CAP-2, etv6, aml1, Prostate Specific Antigen (PSA) and its immunogenic epitopes PSA-1, PSA-2, and PSA-3, T-cell receptor/CD3-zeta chain, MAGE- family of tumor antigens (e.g., MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-A10, MAGE-A11, MAGE-A12,
- Illustrative CAR T-cell therapy include, but are not limited to, JCAR014 (Juno Therapeutics), JCAR015 (Juno Therapeutics), JCAR017 (Juno Therapeutics), JCAR018 (Juno Therapeutics), JCAR020 (Juno Therapeutics), JCAR023 (Juno Therapeutics), JCAR024 (Juno Therapeutics), CTL019 (Novartis), KTE-C19 (Kite Pharma), BPX- 401 (Bellicum Pharmaceuticals), BPX-501 (Bellicum Pharmaceuticals), BPX-601 (Bellicum Pharmaceuticals), bb2121 (Bluebird Bio), CD-19 Sleeping Beauty cells (Ziopharm Oncology), UCART19 (Cellectis), UCART123 (Cellectis), UCART38 (Cellectis), UCARTCS1 (Cellectis), OXB-302 (Oxford BioMedica, MB-101 (Mustang Bio) and
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the present invention is used in a method of treating multiple sclerosis (MS) in combination with one or more MS therapeutics including, but not limited to, 3-interferons, glatiramer acetate, T-interferon, IFN -2 (U. S. Patent Publication No.
- MS multiple sclerosis
- MS therapeutics including, but not limited to, 3-interferons, glatiramer acetate, T-interferon, IFN -2 (U. S. Patent Publication No.
- spirogermaniums e.g., N-(3-dimethylaminopropyl)-2-aza-8,8-dimethyl-8- germanspiro [4:5] decane, N-(3-dimethylaminopropyl)-2-aza-8,8-diethyl-8- germaspiro [4:5] decane, N-(3- dimethylaminopropyl)-2-aza-8,8-dipropyl-8-germaspiro [4:5] decane, and N-(3-dimethylaminopropyl)-2-aza-8, 8- dibutyl-8-germaspiro [4:5] decane), vitamin D analogs (e.g., 1,25 (OH) 2D3, (see, e.g., U.S.
- vitamin D analogs e.g., 1,25 (OH) 2D3, (see, e.g., U.S.
- Patent No. 5,716,946 prostaglandins (e.g., latanoprost, brimonidine, PGE1, PGE2 and PGE3, see, e.g., U. S. Patent Publication No. 2002/0004525), tetracycline and derivatives (e.g., minocycline and doxycycline, see, e.g., U.S. Patent Publication No. 20020022608), a VLA-4 binding antibody (see, e.g., U.S. Patent Publication No.
- adrenocorticotrophic hormone corticosteroid, prednisone, methylprednisone, 2-chlorodeoxyadenosine, mitoxantrone, sulphasalazine, methotrexate, azathioprine, cyclophosphamide, cyclosporin, fumarate, anti-CD20 antibody (e.g., rituximab), and tizanidine hydrochloride.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is used in combination with one or more therapeutic agents that treat one or more symptoms or side effects of MS.
- agents include, but are not limited to, amantadine, baclofen, papaverine, meclizine, hydroxyzine, sulfamethoxazole, ciprofloxacin, docusate, pemoline, dantrolene, desmopressin, dexamethasone, tolterodine, phenyloin, oxybutynin, bisacodyl, venlafaxine, amitriptyline, methenamine, clonazepam, isoniazid, vardenafil, nitrofurantoin, psyllium hydrophilic mucilloid, alprostadil, gabapentin, nortriptyline, paroxetine, propantheline bromide, modafinil,
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is used in a method of treating multiple sclerosis in combination with one or more of the disease modifying therapies (DMTs) described herein (e.g. the agents of Table 6).
- DMTs disease modifying therapies
- the present invention provides an improved therapeutic effect as compared to use of one or more of the DMTs described herein (e.g. the agents listed in Table 6 below) without the one or more disclosed binding agent.
- the combination of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex and the one or more DMTs produces synergistic therapeutic effects.
- Illustrative disease modifying therapies include, but are not limited to:
- the present invention relates to combination therapy with a blood transfusion.
- the present compositions may supplement a blood transfusion.
- the present invention relates to combination therapy with iron supplements.
- the present invention relates to combination therapy with one or more EPO-based agents.
- the present compositions may be used as an adjuvant to other EPO-based agents.
- the present compositions are used as a maintenance therapy to other EPO-based agents.
- EPO-based agents include the following: epoetin alfa, including without limitation, DARBEPOETIN (ARANESP), EPOCEPT (LUPIN PHARMA), NANOKINE (NANOGEN PHARMACEUTICAL), EPOFIT (INTAS PHARMA), EPOGEN (AMGEN), EPOGIN, EPREX, (JANSSEN-CILAG), BINOCRIT7 (SANDOZ), PROCRIT; epoetin beta, including without limitation, NEORECORMON (HOFFMANN-LA ROCHE), RECORMON, Methoxy polyethylene glycol-epoetin beta (MIRCERA, ROCHE); epoetin delta, including without limitation, DYNEPO (erythropoiesis stimulating protein, SHIRE PLC); epoetin omega, including without limitation, EPOMAX; epoetin zeta, including without limitation, SILAPO (STADA) and RETACRIT (HOSPIRA) and other EPOs,
- the present invention relates to combination therapy with one or more immune-modulating agents, for example, without limitation, agents that modulate immune checkpoint.
- the immune-modulating agent targets one or more of PD-1, PD-L1, and PD-L2.
- the immune- modulating agent is PD-1 inhibitor.
- the immune-modulating agent is an antibody specific for one or more of PD-1, PD-L1, and PD-L2.
- the immune-modulating agent is an antibody such as, by way of non-limitation, nivolumab, (ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB), pembrolizumab (KEYTRUDA, MERCK), pidilizumab (CT-011, CURE TECH), MK- 3475 (MERCK), BMS 936559 (BRISTOL MYERS SQUIBB), MPDL3280A (ROCHE).
- the immune-modulating agent targets one or more of CD137 or CD137L.
- the immune- modulating agent is an antibody specific for one or more of CD137 orCD137L.
- the immune-modulating agent is an antibody such as, by way of non-limitation, urelumab (also known as BMS- 663513 and anti-4-1 BB antibody).
- urelumab also known as BMS- 663513 and anti-4-1 BB antibody.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is combined with urelumab (optionally with one or more of nivolumab, lirilumab, and urelumab) for the treatment of solid tumors and/or B-cell non-Hodgkins lymphoma and/or head and neck cancer and/or multiple myeloma.
- the immune-modulating agent is an agent that targets one or more of CTLA-4, AP2M1, CD80, CD86, SHP-2, and PPP2R5A.
- the immune-modulating agent is an antibody specific for one or more of CTLA-4, AP2M1, CD80, CD86, SHP-2, and PPP2R5A.
- the immune-modulating agent is an antibody such as, by way of non-limitation, ipilimumab (MDX-010, MDX-101, Yervoy, BMS) and/or tremelimumab (Pfizer).
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is combined with ipilimumab (optionally with bavituximab) for the treatment of one or more of melanoma, prostate cancer, and lung cancer.
- the immune-modulating agent targets CD20.
- the immune-modulating agent is an antibody specific CD20.
- the immune-modulating agent is an antibody such as, by way of non-limitation, Ofatumumab (GENMAB), obinutuzumab (GAZYVA), AME-133v (APPLIED MOLECULAR EVOLUTION), Ocrelizumab (GENENTECH), TRU- 015 (TRUBION/EMERGENT), veltuzumab (IMMU-106).
- GenMAB Ofatumumab
- GAZYVA obinutuzumab
- AME-133v APPLIED MOLECULAR EVOLUTION
- Ocrelizumab GENENTECH
- TRU- 015 TRUBION/EMERGENT
- veltuzumab veltuzumab
- the present invention relates to combination therapy with one or more chimeric agents described in WO 2013/10779, WO 2015/007536, WO 2015/007520, WO 2015/007542, and WO 2015/007903, the entire contents of which are hereby incorporated by reference in their entireties.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex described herein, include derivatives that are modified, /. e. , by the covalent attachment of any type of molecule to the composition such that covalent attachment does not prevent the activity of the composition.
- derivatives include composition that have been modified by, inter alia, glycosylation, lipidation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex described herein further comprise a cytotoxic agent, comprising, in illustrative embodiments, a toxin, a chemotherapeutic agent, a radioisotope, and an agent that causes apoptosis or cell death.
- a cytotoxic agent comprising, in illustrative embodiments, a toxin, a chemotherapeutic agent, a radioisotope, and an agent that causes apoptosis or cell death.
- agents may be conjugated to a composition described herein.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex described herein may thus be modified post-tran si ati on al ly to add effector moieties such as chemical linkers, detectable moieties such as for example fluorescent dyes, enzymes, substrates, bioluminescent materials, radioactive materials, and chemiluminescent moieties, or functional moieties such as for example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic agent, and radioactive materials.
- effector moieties such as chemical linkers, detectable moieties such as for example fluorescent dyes, enzymes, substrates, bioluminescent materials, radioactive materials, and chemiluminescent moieties, or functional moieties such as for example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic agent, and radioactive materials.
- Illustrative cytotoxic agents include, but are not limited to, methotrexate, aminopterin, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine; alkylating agents such as mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU), mitomycin C, lomustine (CCNU), 1-methylnitrosourea, cyclothosphamide, mechlorethamine, busulfan, dibromomannitol, streptozotocin, mitomycin C, cis-dichlorodiamine platinum (II) (DDP) cisplatin and carboplatin (paraplatin); anthracyclines include daunorubicin (formerly daunomycin), doxorubicin (adriamycin), detorubicin, carminomycin, idarubicin, epirubicin, mitoxan
- cytotoxic agents include paclitaxel (taxol), ricin, pseudomonas exotoxin, gemcitabine, cytochalasin B, gramicidin D, ethidium bromide, emetine, etoposide, tenoposide, colchicin, dihydroxy anthracin dione, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, procarbazine, hydroxyurea, asparaginase, corticosteroids, mytotane (0,P'-(DDD)), interferons, and mixtures of these cytotoxic agents.
- taxol taxol
- ricin pseudomonas exotoxin
- gemcitabine cytochalasin B
- gramicidin D ethidium bromide
- emetine emetine
- etoposide tenoposide
- cytotoxic agents include, but are not limited to, chemotherapeutic agents such as carboplatin, cisplatin, paclitaxel, gemcitabine, calicheamicin, doxorubicin, 5-fluorouracil, mitomycin C, actinomycin D, cyclophosphamide, vincristine, bleomycin, VEGF antagonists, EGFR antagonists, platins, taxols, irinotecan, 5- fluorouracil, gemcytabine, leucovorine, steroids, cyclophosphamide, melphalan, vinca alkaloids (e.g., vinblastine, vincristine, vindesine and vinorelbine), mustines, tyrosine kinase inhibitors, radiotherapy, sex hormone antagonists, selective androgen receptor modulators, selective estrogen receptor modulators, PDGF antagonists, TNF antagonists, IL-1 antagonists, interleukins (e.g.
- IL-12 or IL-2 IL-12R antagonists
- Toxin conjugated monoclonal antibodies tumor antigen specific monoclonal antibodies
- Erbitux Avastin
- Pertuzumab anti-CD20 antibodies
- Rituxan ocrelizumab
- ofatumumab DXL625, HERCEPTIN®, or any combination thereof.
- Toxic enzymes from plants and bacteria such as ricin, diphtheria toxin and Pseudomonas toxin may be conjugated to the therapeutic agents (e.g. antibodies) to generate cell-type-specific-killing reagents (Youle, ef a/., Proc. Nat'l Acad. Sci.
- cytotoxic agents include cytotoxic ribonucleases as described by Goldenberg in U.S. Pat. No. 6,653,104.
- Embodiments of the invention also relate to radioimmunoconjugates where a radionuclide that emits alpha or beta particles is stably coupled to the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex, with or without the use of a complex-forming agent.
- radionuclides include beta-emitters such as Phosphorus-32, Scandium-47, Copper-67, Gallium-67, Yttrium-88, Yttrium-90, Iodine-125, Iodine-131, Samarium- 153, Lutetium-177, Rhenium-186 or Rhenium-188, and alpha-emitters such as Astatine-211, Lead-212, Bismuth- 212, Bismuth-213 or Actinium-225.
- beta-emitters such as Phosphorus-32, Scandium-47, Copper-67, Gallium-67, Yttrium-88, Yttrium-90, Iodine-125, Iodine-131, Samarium- 153, Lutetium-177, Rhenium-186 or Rhenium-188
- alpha-emitters such as Astatine-211, Lead-212, Bismuth- 212, Bismuth-213 or Actinium-225.
- Illustrative detectable moieties further include, but are not limited to, horseradish peroxidase, acetylcholinesterase, alkaline phosphatase, beta-galactosidase and luciferase.
- Further illustrative fluorescent materials include, but are not limited to, rhodamine, fluorescein, fluorescein isothiocyanate, umbelliferone, dichlorotriazinylamine, phycoerythrin and dansyl chloride.
- Further illustrative chemiluminescent moieties include, but are not limited to, luminol.
- Further illustrative bioluminescent materials include, but are not limited to, luciferin and aequorin.
- Further illustrative radioactive materials include, but are not limited to, Iodine-125, Carbon-14, Sulfur-35, Tritium and Phosphorus-32.
- Methods of Treatment have application to treating various diseases and disorders, including, but not limited to cancer, infections, immune disorders, anemia, autoimmune diseases, cardiovascular diseases, wound healing, ischemia-related diseases, neurodegenerative diseases, metabolic diseases and many other diseases and disorders.
- any of the present agents may be for use in the treating, or the manufacture of a medicament for treating, various diseases and disorders, including, but not limited to cancer, infections, immune disorders, inflammatory diseases or conditions, and autoimmune diseases.
- the present invention relates to the treatment of, or a patient having one or more of chronic granulomatous disease, osteopetrosis, idiopathic pulmonary fibrosis, Friedreich’s ataxia, atopic dermatitis, Chagas disease, cancer, heart failure, autoimmune disease, sickle cell disease, thalassemia, blood loss, transfusion reaction, diabetes, vitamin B12 deficiency, collagen vascular disease, Shwachman syndrome, thrombocytopenic purpura, Celiac disease, endocrine deficiency state such as hypothyroidism or Addison's disease, autoimmune disease such as Crohn's Disease, systemic lupus erythematosis, rheumatoid arthritis or juvenile rheumatoid arthritis, ulcerative colitis immune disorders such as eosinophilic fasciitis, hypoimmunoglobulinemia, or thymoma/thymic carcinoma, graft versus host disease, preleuk
- Felty syndrome hemolytic uremic syndrome, myelodysplasic syndrome, nocturnal paroxysmal hemoglobinuria, osteomyelofibrosis, pancytopenia, pure red-cell aplasia, Schoenlein-Flenoch purpura, malaria, protein starvation, menorrhagia, systemic sclerosis, liver cirrhosis, hypometabolic states, and congestive heart failure.
- the present invention is related to a method for treating cancer, comprising administering an effective amount of i) the chimeric protein, the chimeric protein complex and/or the Fc-based chimeric protein complex to a patient in need thereof; ii) a recombinant nucleic acid encoding the chimeric protein, the chimeric protein complex and/or the Fc-based chimeric protein complex to a patient in need thereof; or iii) a host cell comprising the recombinant nucleic acid encoding the chimeric protein, the chimeric protein complex and/or the Fc-based chimeric protein complex to a patient in need thereof.
- the present invention relates to the treatment of, or a patient having one or more of chronic granulomatous disease, osteopetrosis, idiopathic pulmonary fibrosis, Friedreich’s ataxia, atopic dermatitis, Chagas disease, mycobacterial infections, cancer, scleroderma, hepatitis, hepatitis C, septic shock, and rheumatoid arthritis.
- the present invention relates to the treatment of, or a patient having cancer.
- cancer refers to any uncontrolled growth of cells that may interfere with the normal functioning of the bodily organs and systems, and includes both primary and metastatic tumors.
- Primary tumors or cancers that migrate from their original location and seed vital organs can eventually lead to the death of the subject through the functional deterioration of the affected organs.
- a metastasis is a cancer cell or group of cancer cells, distinct from the primary tumor location, resulting from the dissemination of cancer cells from the primary tumor to other parts of the body. Metastases may eventually result in death of a subject.
- cancers can include benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases.
- Illustrative cancers that may be treated include, but are not limited to, carcinomas, e.g. various subtypes, including, for example, adenocarcinoma, basal cell carcinoma, squamous cell carcinoma, and transitional cell carcinoma), sarcomas (including, for example, bone and soft tissue), leukemias (including, for example, acute myeloid, acute lymphoblastic, chronic myeloid, chronic lymphocytic, and hairy cell), lymphomas and myelomas (including, for example, Hodgkin and non-Hodgkin lymphomas, light chain, non-secretory, MGUS, and plasmacytomas), and central nervous system cancers (including, for example, brain (e.g.
- gliomas e.g. astrocytoma, oligodendroglioma, and ependymoma
- meningioma e.g. astrocytoma, oligodendroglioma, and ependymoma
- pituitary adenoma e.g. astrocytoma, oligodendroglioma, and ependymoma
- spinal cord tumors e.g. meningiomas and neurofibroma
- Illustrative cancers that may be treated include, but are not limited to, basal cell carcinoma, biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the peritoneum; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer; cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer (including gastrointestinal cancer); glioblastoma; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer; lung cancer (e.g., small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung, and squamous carcinoma of the lung); melanoma; myeloma; neuroblastoma; oral cavity cancer (lip, tongue, mouth, and pharynx); ovarian cancer; pancre
- the present invention relates to the treatment of leukemia including hairy cell leukemia.
- the present invention relates to the treatment of melanoma including malignant melanoma.
- the present invention relates to the treatment of Kaposi’s sarcoma including AIDS-related Kaposi's sarcoma.
- the present invention relates to the treatment of, or a patient having a microbial infection and/or chronic infection.
- Illustrative infections include, but are not limited to, Chagas disease, HIV/AIDS, tuberculosis, osteomyelitis, hepatitis B, hepatitis C, Epstein-Barr virus or parvovirus, T cell leukemia virus, bacterial overgrowth syndrome, fungal or parasitic infections.
- the present invention relates to the treatment of hepatitis.
- Illustrative hepatitis that may be treated include, but is not limited to, hepatitis A, hepatitis B, hepatitis C, hepatitis D, hepatitis E, autoimmune hepatitis, alcoholic hepatitis, acute hepatitis, and chronic hepatitis.
- the present invention relates to the treatment of chronic hepatitis C.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be utilized to treat a patient infected with any one of the hepatitis C genotypes, including genotype 1 (e.g., 1 a, 1 b), genotype 2 ( e.g .
- genotype 3 e.g., 3a, 3b, 3c, 3d, 3e, and 3f
- genotype 4 e.g., 4a, 4b, 4c, 4d, 4e, 4f, 4g, 4h, 4i and 4j
- genotype 5a and genotype 6a.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be utilized to treat patients who are poorly or non-responsive to standard of care antiviral therapy or who are otherwise difficult to treat with standard of care hepatitis C treatment.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be utilized to treat a patient who shows low or no response to IL-2 therapy with or without ribavirin.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be utilized to treat a patient who shows low or no response to combination therapy of pegylated interferon and ribavirin.
- the present invention is directed to the treatment of patients infected with hepatitis C genotype 1 or any other genotype who did not respond to previous IL-2 therapy.
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be used to treat a patient with high baseline viral load (e.g., greater than 800,000 lU/mL).
- the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention may be utilized to treat patients with severe liver damage including those patients with advanced liver fibrosis and/or liver cirrhosis.
- the present invention relates to the treatment of patients who are naive to antiviral therapy. In other embodiments, the present invention relates to the treatment of patients who did not respond to previous antiviral therapy. In some embodiments, the present chimeric proteins or chimeric protein complexes such as Fc- based chimeric protein complex may be used to treat relapsed patients.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be effective in treating hepatitis infection in all ethnic groups including white, African- American, Hispanic, and Asian.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be particularly effective in treating African-Americans who are otherwise poorly responsive to IL-2 therapy with or without ribavirin.
- the targeted chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention provides improved safety compared to, e.g., untargeted IFNal or an unmodified, wildtype IL-2 or a modified IL-2.
- administration of the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex is associated with minimal side effects (e.g., influenza-like symptoms, myalgia, leucopenia, thrombocytopenia, neutropenia, depression, and weight loss) such as those side effects associated with the use of the untargeted IL-2 or an unmodified, wildtype IL-2 or a modified IL-2.
- the targeted chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention shows improved therapeutic activity compared to untargeted IL-2 or an unmodified, wildtype IL-2, or a modified IL-2.
- the targeted chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex of the invention shows improved pharmacokinetic profile (e.g., longer serum half-life and stability) compared to untargeted IL-2 or an unmodified, wildtype IL-2 or a modified IL-2.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be used to treat patients at high dosages and/or for prolonged periods of time.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be used at high dosages for initial induction therapy against chronic hepatitis C infection.
- the present chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex may be used for long-term maintenance therapy to prevent disease relapse.
- the present compositions are used to treat or prevent one or more inflammatory diseases or conditions, such as inflammation, acute inflammation, chronic inflammation, respiratory disease, atherosclerosis, restenosis, asthma, allergic rhinitis, atopic dermatitis, septic shock, rheumatoid arthritis, inflammatory bowel disease, inflammatory pelvic disease, pain, ocular inflammatory disease, celiac disease, Leigh Syndrome, Glycerol Kinase Deficiency, Familial eosinophilia (FE), autosomal recessive spastic ataxia, laryngeal inflammatory disease; Tuberculosis, Chronic cholecystitis, Bronchiectasis, Silicosis and other pneumoconioses.
- inflammatory diseases or conditions such as inflammation, acute inflammation, chronic inflammation, respiratory disease, atherosclerosis, restenosis, asthma, allergic rhinitis, atopic dermatitis, septic shock, rheumatoid arthritis
- the present compositions are used to treat or prevent one or more autoimmune diseases or conditions, such as multiple sclerosis, diabetes mellitus, lupus, celiac disease, Crohn's disease, ulcerative colitis, Guillain-Barre syndrome, scleroderms, Goodpasture's syndrome, Wegener's granulomatosis, autoimmune epilepsy, Rasmussen's encephalitis, Primary biliary sclerosis, Sclerosing cholangitis, Autoimmune hepatitis, Addison's disease, Flashimoto's thyroiditis, Fibromyalgia, Menier's syndrome; transplantation rejection (e.g., prevention of allograft rejection) pernicious anemia, rheumatoid arthritis, systemic lupus erythematosus, dermatomyositis, Sjogren's syndrome, lupus erythematosus, multiple sclerosis, myasthenia
- the present compositions are used to treat, control or prevent cardiovascular disease, such as a disease or condition affecting the heart and vasculature, including but not limited to, coronary heart disease (CHD), cerebrovascular disease (CVD), aortic stenosis, peripheral vascular disease, atherosclerosis, arteriosclerosis, myocardial infarction (heart attack), cerebrovascular diseases (stroke), transient ischemic attacks (TIA), angina (stable and unstable), atrial fibrillation, arrhythmia, vavular disease, and/or congestive heart failure.
- cardiovascular disease such as a disease or condition affecting the heart and vasculature, including but not limited to, coronary heart disease (CHD), cerebrovascular disease (CVD), aortic stenosis, peripheral vascular disease, atherosclerosis, arteriosclerosis, myocardial infarction (heart attack), cerebrovascular diseases (stroke), transient ischemic attacks (TIA), angina (stable and unstable), atrial fibrillation,
- the present invention is useful for the treatment, controlling or prevention of diabetes, including Type 1 and Type 2 diabetes and diabetes associated with obesity.
- the compositions and methods of the present invention are useful for the treatment or prevention of diabetes-related disorders, including without limitation diabetic nephropathy, hyperglycemia, impaired glucose tolerance, insulin resistance, obesity, lipid disorders, dyslipidemia, hyperlipidemia, hypertriglyceridemia, hypercholesterolemia, low HDL levels, high LDL levels, atherosclerosis and its sequelae, vascular restenosis, irritable bowel syndrome, inflamatory bowel disease, including Crohn's disease and ulcerative colitis, other inflammatory conditions, pancreatitis, abdominal obesity, neurodegenerative disease, retinopathy, neoplastic conditions, adipose cell tumors, adipose cell carcinomas, such as liposarcoma, prostate cancer and other cancers, including gastric, breast, bladder and colon cancers, angiogenesis, Alzheimer's disease, psoriasis,
- a person has three or more of the following disorders: abdominal obesity, hypertriglyceridemia, low HDL cholesterol, high blood pressure, and high fasting plasma glucose), ovarian hyperandrogenism (polycystic ovary syndrome), and other disorders where insulin resistance is a component, such as sleep apnea.
- the compositions and methods of the present invention are useful for the treatment, control, or prevention of obesity, including genetic or environmental, and obesity-related disorders.
- the obesity-related disorders herein are associated with, caused by, or result from obesity.
- obesity-related disorders include obesity, diabetes, overeating, binge eating, and bulimia, hypertension, elevated plasma insulin concentrations and insulin resistance, dyslipidemia, hyperlipidemia, endometrial, breast, prostate, kidney and colon cancer, osteoarthritis, obstructive sleep apnea, gallstones, heart disease, abnormal heart rhythms and arrythmias, myocardial infarction, congestive heart failure, coronary heart disease, sudden death, stroke, polycystic ovary disease, craniopharyngioma, Prader-Willi Syndrome, Frohlich's syndrome, GH-deficient subjects, normal variant short stature, Turner's syndrome, and other pathological conditions showing reduced metabolic activity or a decrease in resting energy expenditure as a percentage of total fat-free mass, e.g, children with acute lymphoblastic leukemia.
- obesity-related disorders are Metabolic Syndrome, insulin resistance syndrome, reproductive hormone abnormalities, sexual and reproductive dysfunction, such as impaired fertility, infertility, hypogonadism in males and hirsutism in females, fetal defects associated with maternal obesity, gastrointestinal motility disorders, such as obesity-related gastro-esophageal reflux, respiratory disorders, such as obesity-hypoventilation syndrome (Pickwickian syndrome), breathlessness, cardiovascular disorders, inflammation, such as systemic inflammation of the vasculature, arteriosclerosis, hypercholesterolemia, lower back pain, gallbladder disease, hyperuricemia, gout, and kidney cancer, and increased anesthetic risk.
- the compositions and methods of the present invention are also useful to treat Alzheimer's disease.
- the present compositions are used to treat or prevent one or more respiratory diseases, such as idiopathic pulmonary fibrosis (IPF), asthma, chronic obstructive pulmonary disease (COPD), bronchiectasis, allergic rhinitis, sinusitis, pulmonary vasoconstriction, inflammation, allergies, impeded respiration, respiratory distress syndrome, cystic fibrosis, pulmonary hypertension, pulmonary vasoconstriction, emphysema, Hantavirus pulmonary syndrome (HPS), Loeffler's syndrome, Goodpasture's syndrome, Pleurisy, pneumonitis, pulmonary edema, pulmonary fibrosis, Sarcoidosis, complications associated with respiratory syncitial virus infection, and other respiratory diseases.
- respiratory diseases such as idiopathic pulmonary fibrosis (IPF), asthma, chronic obstructive pulmonary disease (COPD), bronchiectasis, allergic rhinitis, sinusitis, pulmonary vasocons
- the present invention is used to treat or prevent one or more neurodegenerative disease.
- neurodegenerative diseases include, but are not limited to, Friedreich’s Ataxia, multiple sclerosis (including without limitation, benign multiple sclerosis; relapsing-remitting multiple sclerosis (RRMS); secondary progressive multiple sclerosis (SPMS); progressive relapsing multiple sclerosis (PRMS); and primary progressive multiple sclerosis (PPMS)), Alzheimer's disease (including, without limitation, Early-onset Alzheimer's, Late-onset Alzheimer’s, and Familial Alzheimer’s disease (FAD), Parkinson’s disease and parkinsonism (including, without limitation, Idiopathic Parkinson's disease, Vascular parkinsonism, Drug-induced parkinsonism, Dementia with Lewy bodies, Inherited Parkinson's, Juvenile Parkinson's), Huntington's disease, Amyotrophic lateral sclerosis (ALS, including, without limitation, Sporadic ALS, Familial ALS, Western Pacific ALS, Juvenile Parkinson's),
- the present chimeric proteins or chimeric protein complexes finds use in treating wounds, e.g., a non-healing wound, an ulcer, a burn, or frostbite, a chronic or acute wound, open or closed wound, internal or external wound (illustrative external wounds are penetrating and non-penetrating wound.
- wounds e.g., a non-healing wound, an ulcer, a burn, or frostbite, a chronic or acute wound, open or closed wound, internal or external wound (illustrative external wounds are penetrating and non-penetrating wound.
- the present chimeric proteins or chimeric protein complexes find use in treating ischemia, by way of non-limiting example, ischemia associated with acute coronary syndrome, acute lung injury (ALI), acute myocardial infarction (AMI), acute respiratory distress syndrome (ARDS), arterial occlusive disease, arteriosclerosis, articular cartilage defect, aseptic systemic inflammation, atherosclerotic cardiovascular disease, autoimmune disease, bone fracture, bone fracture, brain edema, brain hypoperfusion, Buerger's disease, burns, cancer, cardiovascular disease, cartilage damage, cerebral infarct, cerebral ischemia, cerebral stroke, cerebrovascular disease, chemotherapy-induced neuropathy, chronic infection, chronic mesenteric ischemia, claudication, congestive heart failure, connective tissue damage, contusion, coronary artery disease (CAD), critical limb ischemia (CLI), Crohn's disease, deep vein thrombosis, deep wound, delayed ulcer healing, delayed wound
- CAD coronary artery disease
- CLI critical limb
- the present invention relates to the treatment of one or more of anemia, including anemia resulting from chronic kidney disease (e.g . from dialysis) and/or an anti-cancer agent (e.g . chemotherapy and/or HIV treatment (e.g. Zidovudine (INN) or azidothymidine (AZT)), inflammatory bowel disease (e.g. Crohn's disease and ulcer colitis), anemia linked to inflammatory conditions (e.g. arthritis, lupus, IBD), anemia linked to diabetes, schizophrenia, cerebral malaria, as aplastic anemia, and myelodysplasia from the treatment of cancer (e.g. chemotherapy and/or radiation), and various myelodysplastic syndrome diseases (e.g. sickle cell anemia, hemoglobin SC disease, hemoglobin C disease, alpha- and beta-thalassemias, neonatal anemia after premature birth, and comparable conditions).
- anemia including anemia resulting from chronic kidney disease (e.g . from dialysis) and/or
- the present invention relates to the treatment of, or a patient having anemia, i.e. a condition in which the number of red blood cells and/or the amount of hemoglobin found in the red blood cells is below normal.
- the anemia may be acute or chronic.
- the present anemias include but are not limited to iron deficiency anemia, renal anemia, anemia of chronic diseases/inflammation, pernicious anemia such as macrocytic achylic anemia, juvenile pernicious anemia and congenital pernicious anemia, cancer- related anemia, anti-cancer-related anemia (e.g.
- anemia may cause serious symptoms, including hypoxia, chronic fatigue, lack of concentration, pale skin, low blood pressure, dizziness and heart failure.
- the present invention relates to the treatment of anemia resulting from chronic renal failure. In some embodiments, the present invention relates to the treatment of anemia resulting from the use of one or more renal replacement therapies, inclusive of dialysis, hemodialysis, peritoneal dialysis, hemofiltration, hemodiafiltration, and renal transplantation.
- the present invention relates to the treatment of anemia in patients with chronic kidney disease who are not on dialysis.
- the present invention relates to patients in stage 1 CKD, or stage 2 CKD, or stage 3 CKD, or stage 4 CKD, or stage 5 CKD.
- the present patient is stage 4 CKD or stage 5 CKD.
- the present patient has undergone a kidney transplant.
- the present invention relates to the treatment of anemia is a patient having an acute kidney injury (AKI).
- the anemia is induced by chemotherapy.
- the chemotherapy may be any myelosuppressive chemotherapy.
- the chemotherapy is one or more of Revlimid, Thalomid, dexamethasone, Adriamycin and Doxil.
- the chemotherapy is one or more platinum-based drugs including cisplatin (e.g . PLATINOL) and carboplatin ( e.g . PARAPLATIN).
- the chemotherapy is any one of the chemotherapeutic agents described herein.
- the chemotherapy is any agent described in Groopman ef a/. J Natl Cancer Inst (1999) 91 (19): 1616-1634, the contents of which are hereby incorporated by reference in their entireties.
- the present compositions and methods are used in the treatment of chemotherapy-related anemia in later stage cancer patients (e.g. a stage IV, or stage III, or stage II cancer). In some embodiments, the present compositions and methods are used in the treatment of chemotherapy-related anemia in cancer patients receiving dose-dense chemotherapy or other aggressive chemotherapy regimens.
- the present invention relates to the treatment of anemia in a patient having one or more blood-based cancers, such as leukemia, lymphoma, and multiple myeloma. Such cancers may affect the bone marrow directly. Further, the present invention relates to metastatic cancer that has spread to the bone or bone marrow. In some embodiments, the present invention relates to the treatment of anemia in a patient undergoing radiation therapy. Such radiation therapy may damage the bone marrow, lowering its ability to make red blood cells. In further embodiments, the present invention relates to the treatment of anemia in a patient having a reduction or deficiency of one or more of iron, vitamin B12, and folic acid.
- blood-based cancers such as leukemia, lymphoma, and multiple myeloma.
- the present invention relates to metastatic cancer that has spread to the bone or bone marrow.
- the present invention relates to the treatment of anemia in a patient undergoing radiation therapy. Such radiation therapy may damage the bone marrow
- the present invention relates to the treatment of anemia in a patient having excessive bleeding including without limitation, after surgery or from a tumor that is causing internal bleeding. In further embodiments, the present invention relates to the treatment of anemia in a patient having anemia of chronic disease.
- the present methods and compositions stimulate red blood cell production. In some embodiments, the present methods and compositions stimulate division and differentiation of committed erythroid progenitors in the bone marrow.
- the present methods and compositions are particularly useful for treating chemotherapy-induced anemia in cancer patients.
- the present methods and compositions allows for continued administration of the chimeric proteins or chimeric protein complexes such as Fc-based chimeric protein complex after a cancer patient’s chemotherapy is finished.
- the present methods and compositions allows for treatment of a cancer patient without dose reduction relative to a non-cancer patient.
- the present methods and compositions allows for treatment of a cancer patient receiving chemotherapy and considered curable.
- the cancer patient has one or more of a history of blood clots, recent surgery, prolonged periods of bed rest or limited activity, and treatment with a chemotherapeutic agent.
- kits for the administration of any agent described herein e.g. the chimeric proteins or chimeric protein complexes, such as Fc-based chimeric protein complexes, with or without various additional therapeutic agents.
- the kit is an assemblage of materials or components, including at least one of the inventive pharmaceutical compositions described herein.
- the kit contains at least one of the pharmaceutical compositions described herein.
- the kit is configured for the purpose of treating human subjects.
- Instructions for use may be included in the kit.
- Instructions for use typically include a tangible expression describing the technique to be employed in using the components of the kit to effect a desired outcome, such as to treat cancer.
- the kit also contains other useful components, such as, diluents, buffers, pharmaceutically acceptable carriers, syringes, catheters, applicators, pipetting or measuring tools, bandaging materials or other useful paraphernalia as will be readily recognized by those of skill in the art.
- the materials and components assembled in the kit can be provided to the practitioner stored in any convenience and suitable ways that preserve their operability and utility.
- the components can be provided at room, refrigerated or frozen temperatures.
- the components are typically contained in suitable packaging materials.
- the packaging material is constructed by well-known methods, preferably to provide a sterile, contaminant-free environment.
- the packaging material may have an external label which indicates the contents and/or purpose of the kit and/or its components.
- a chimeric protein or protein complex of the present invention may be indicated by the term “AcTaleukin-2” and/or “ALN2”.
- the term “about” when used in connection with a referenced numeric indication means the referenced numeric indication plus or minus up to 10% of that referenced numeric indication, e.g., within (plus or minus) 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value.
- the language “about 50” covers the range of 45 to 55.
- an “effective amount,” when used in connection with medical uses is an amount that is effective for providing a measurable treatment, prevention, or reduction in the rate of pathogenesis of a disease of interest.
- something is “decreased” if a read-out of activity and/or effect is reduced by a significant amount, such as by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, or more, up to and including at least about 100%, in the presence of an agent or stimulus relative to the absence of such modulation.
- activity is decreased and some downstream read-outs will decrease but others can increase.
- activity is “increased” if a read-out of activity and/or effect is increased by a significant amount, for example by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, or more, up to and including at least about 100% or more, at least about 2-fold, at least about 3-fold, at least about 4-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8- fold, at least about 9-fold, at least about 10-fold, at least about 50-fold, at least about 100-fold, in the presence of an agent or stimulus, relative to the absence of such agent or stimulus.
- compositional percentages are by weight of the total composition, unless otherwise specified.
- the word “include,” and its variants is intended to be non-limiting, such that recitation of items in a list is not to the exclusion of other like items that may also be useful in the compositions and methods of this technology.
- the terms “can” and “may” and their variants are intended to be non-limiting, such that recitation that an embodiment can or may comprise certain elements or features does not exclude other embodiments of the present technology that do not contain those elements or features.
- the words “preferred” and “preferably” refer to embodiments of the technology that afford certain benefits, under certain circumstances. However, other embodiments may also be preferred, under the same or other circumstances. Furthermore, the recitation of one or more preferred embodiments does not imply that other embodiments are not useful, and is not intended to exclude other embodiments from the scope of the technology.
- compositions described herein needed for achieving a therapeutic effect may be determined empirically in accordance with conventional procedures for the particular purpose.
- the therapeutic agents are given at a pharmacologically effective dose.
- a “pharmacologically effective amount,” “pharmacologically effective dose,” “therapeutically effective amount,” or “effective amount” refers to an amount sufficient to produce the desired physiological effect or amount capable of achieving the desired result, particularly for treating the disorder or disease.
- An effective amount as used herein would include an amount sufficient to, for example, delay the development of a symptom of the disorder or disease, alter the course of a symptom of the disorder or disease (e.g., slow the progression of a symptom of the disease), reduce or eliminate one or more symptoms or manifestations of the disorder or disease, and reverse a symptom of a disorder or disease.
- Therapeutic benefit also includes halting or slowing the progression of the underlying disease or disorder, regardless of whether improvement is realized.
- Effective amounts, toxicity, and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to about 50% of the population) and the ED50 (the dose therapeutically effective in about 50% of the population).
- the dosage can vary depending upon the dosage form employed and the route of administration utilized.
- the dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50.
- compositions and methods that exhibit large therapeutic indices are preferred.
- a therapeutically effective dose can be estimated initially from in vitro assays, including, for example, cell culture assays.
- a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 as determined in cell culture, or in an appropriate animal model.
- Levels of the described compositions in plasma can be measured, for example, by high performance liquid chromatography.
- the effects of any particular dosage can be monitored by a suitable bioassay. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
- the effect will result in a quantifiable change of at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 70%, or at least about 90%. In some embodiments, the effect will result in a quantifiable change of about 10%, about 20%, about 30%, about 50%, about 70%, or even about 90% or more.
- Therapeutic benefit also includes halting or slowing the progression of the underlying disease or disorder, regardless of whether improvement is realized.
- compositions for treating the diseases or disorders described herein are equally applicable to use of a composition for treating the diseases or disorders described herein and/or compositions for use and/or uses in the manufacture of a medicaments for treating the diseases or disorders described herein.
- This invention is further illustrated by the following non-limiting examples.
- a chimeric protein or protein complex of the present invention may be indicated by the term “AcTaleukin-2” and/or “ALN2”.
- EXAMPLE 1 IL-2 and Fc-IL-2 Drive STAT5 Phosphorylation in Peripheral Blood Mononuclear Cells (PBMCs)
- PBMCs Peripheral Blood Mononuclear Cells
- This Example describes how lnterleukin-2 (IL-2) can be modified in such a way that only targeted cells are activated, and cells with negative or adverse effects are no longer activated.
- IL-2 lnterleukin-2
- anti-tumor activities of CD8 expressing T cells e.g. cytotoxic T cells or CTLs
- CTLs regulatory T cells
- This uncoupling of cellular functions can, in part, be achieved based on the use of IL-2 receptors (IL-2R) in these cells: while signaling in CTLs is mediated by an intermediate-affinity IL- 2R complex composed of the I ⁇ b (CD 122) and y common (yc; CD 132) chains, in Tregs the high-affinity IL-2R complex additionally includes an I L-2 Ra (CD25) chain.
- the strategy for development of CTL-specific IL-2 activity includes: (i) CD8 targeting, (ii) elimination of the CD25 binding and thus involvement of this receptor in signaling, and (iii) the selection of a loss-of-function beta- and gamma-mutations that can be restored upon (CD8) targeting.
- Fc sequences contained the L234A_L235A_K322Q effector mutations and the ‘hole’ modifications Y349C_T366S_L368A_Y407V (in sequence hFc3) or ‘knob’ mutations S354C_T366W (in sequence hFc4-hlL- 2_C125A).
- the free cysteine on position 125 in IL-2 was mutated to an alanine (C125A).
- Resulting AcTaleukin-2 was tested for STAT5 phosphorylation in (i) CD8 positive T cells (CD8+); (ii) CD25 negative conventional T cells (CD25- Tconv); (iii) CD25 positive conventional T cells (CD25+ Tconv); or (iv) regulatory T cells (Treg) defined as CD4+CD25+FoxP3+.
- PBMCs from buffy coats of healthy donors were isolated using density gradient centrifugation using Lymphoprep (StemCell technologies). Cells were stimulated with a serial dilution wild type recombinant IL-2 or Fc-IL-2 for 30 minutes at 37°C.
- Figure 20 illustrates that (i) the Treg cells are much more sensitive to IL-2 compared to other cell-types, and (ii) that Fc-fusion affects signaling in all tested populations.
- Fc-IL-2 is ⁇ 20-fold less active than IL-2 on Tregs and the fusion is hardly active on CD8 positive cells.
- CD25 knock-out mutations diminish I L-2 signaling in all cell-types (independent of CD25 expression), and CD8 targeting partly restores signaling in CD8 expressing cells.
- Flowever such ALN2 molecules with mutated CD25 binding-site still clearly signal in Treg cells with an EC 50 of 50 to 250 ng/ml.
- Candidate residues D20 and N88 were mutated to any other amino acid (excluding C and M) in the hFc4-hlL- 2_C125A construct (see sequences below). Resulting constructs were combined with CD8-hFc3 for expression in ExpiCHO. Recombinant proteins were purified from the supernatant using protein A spin plates (ThermoFisher), quantified and purity tested using SDS-PAGE.
- PBMCs were blocked human FcR Blocking Reagent (Miltenyi Biotec) and stained fluorescently labelled Ab’s specific for CD4, CD8, and CD25. After staining and washing, cells were stimulated with a serial dilution ALN2 variants as indicated for 30 min at 37°C. Cells were subsequently fixed with Lyse/Fix buffer (BD Biosciences) and permeabilized using the Perm Buffer III (BD Biosciences) according to the manufacturer’s guidelines. After overnight staining with a pSTAT5 specific Ab, samples were analyzed on a MACSQuant X instrument (Miltenyi Biotec) and analyzed using the FlowLogic software (Miltenyi Biotec).
- Figures 23A-R (screening of D20 mutants) and Figures 24A-R (screening of N88 mutants) illustrate that most mutations have a drastic effect on the pSTAT5 outcome.
- Variants that retained most activity were D20E, D20V, N88A, N88G (and to a lesser extent D20S, D20T, N88D, N88Q, N88H, and N88T) with EC 50 values between 3 and 18 ng/ml.
- Data also clearly illustrate that even with a mutation of the I ⁇ -2Rb site and CD8 targeting, clear pSTAT5 can be detected at concentrations of 1 ⁇ g/ml in the CD4 + CD25 + population, of which the hyper-sensitive Tregs are very small portion.
- CD25 knock-out mutations e.g., R38A_F42K
- the best performing IL-2f3 ⁇ 4-mutations e.g., D20E, D20V, N88A and N88G
- Resulting constructs were combined with the CD8 VHH-hFc3 partner and tested for STAT5 phosphorylation in CD8 + , CD25- Tconv, CD25 + Tconv and Treg cells as described in Example 1.
- Data in Figures 26A-J and summary Table 7 illustrate that: i. CD25 knock-out (e.g., R38A_K42K) mutations affect signaling in all sub-populations independent of CD25 expression (Fig. 26A and Fig.
- Treg cells are on average 100,000-fold more sensitive to wild type IL-2 compared to CD8+ T cells.
- a combination of CD8-targeting, CD25-binding knock-out, and selected recoverable IL-2f3 ⁇ 4 mutations resulted in an ALN2 molecule with a specificity of 1,000-fold in favor of the CD8 expressing cells and no detectable Treg activity up to 1,000 or even 10,000 pM which equals concentrations of about 0.1- 1 ⁇ g/ml.
- IL-2 molecules with only IL-2Ra mutations already display maximal activation of Tregs at 10,000 pM ( Figures 26A-J).
- IL-2 modified IL-2 molecules that are targeted to the CD25 receptor which is highly expressed on these cells.
- targeting domains scFv variants of two non-neutralizing anti-CD25 antibodies (MA251 and 7G7B6) were chosen.
- VH and VL sequences were fused via a 3*GGGGS-liner in two orientations (VH-VL and VL-VH) and linked to the hFc3 sequence with effector and hole mutations (see sequences below).
- Resulting constructs were combined with a hFc4 expressing plasmid (in order to generate unarmed knob-in-hole Fc constructs) for production in ExpiCHO cells.
- Resulting proteins were purified as described above and initially tested for (i) binding to CD25 expressing cells, and (ii) for neutralization of IL-2 signaling.
- two HEK derived cell-lines HEK-Blue-IL-2 (expressing afunctional IL-2R; InvivoGen) and HEK-Blue-IL-1 (expressing afunctional IL- 1R; InvivoGen) were incubated with a serial dilution of MA251 and 7G7B6 scFv unarmed proteins for 2 hours at 4°C.
- CD25 targeting here, using the 7G7B6 scFv_VFI-VL targeting domain
- CD25 here, F38A_F42K
- IL2Rbeta mutations here, N88A and N88G
- R38A_F42K_N88A and R38A_F42K_N88G was investigated.
- hFc4-hlL-2 constructs with these mutations were combined with CD8 VHH-hFc3 or with hFc3 constructs for production and purification in ExpiCHO cells.
- CD25 targeting allows specific restoration of loss-of-function caused by CD25 and/or b mutations in CD25 expressing cells vs. CD25 negative cells.
- an IL-2/IL-15 mimic that lacks the CD25 binding-site but still can efficiently signal through I ⁇ -2Rb and y c receptors was designed de novo (see, Silva et al., “De novo design of potent and selective mimics of IL-2 and IL-15,” Nature, vol. 565, pp. 186-191, 2019).
- This 101 amino acid IL-2_mimic elicits downstream cell signaling (e.g. STAT5 phosphorylation) independently of I L-2 Ra and IL-15Ra, and has superior therapeutic activity to IL-2 in mouse models of melanoma and colon cancer.
- this IL-2_mimic sequence was fused via a flexible linker 20*GGS-linker C-terminally of an hlgG1 Fc with effector and knob mutations (hFc4-IL-2_mimic; see sequence below).
- residue D15 (equivalent to D20 in human IL-2) was mutated to T or H
- residue N40 (equivalent to N88 in human IL-2) was mutated to I, G, and R in order to try to attenuate binding to the IL-2R ⁇ -chain
- Resulting constructs (wild type or mutant) were combined with CD8 VHH-hFc3 for production in ExpiCHO cells.
- Resulting IL-2_mimic (neoleukin) variants were tested for STAT5 phosphorylation in CD8 + , CD25- Tconv, CD25 + Tconv and Treg cells as described in Example 1 .
- FIGS 30A-H Data in Figures 30A-H illustrate that: i. Different cell populations depicted the following sensitivity to wild type IL-2: CD8+ ⁇ CD25- Tconv ⁇ CD25+ Tconv « ⁇ Treg ( Figure 30A). ii. An untargted IL-2_mimic Fc-variant is more or less equally active on all tested PBMC subpopulations (e.g., EC50 values of 6.1 pM; 9.6 pM; 2.3 pM; and 8.0 pM for respectively CD8+; CD25- Tconv; Treg; and CD25+ Tconv cells) ( Figure 30B). iii.
- CD8 targeting is able to restore, at least in part, loss of signaling resulting in EC50 values of 38 pM (D15T); 169 pM (D15H); 53 pM (N40I); and 12 pM (N40R) ( Figures 30D, 30E, 30F and 30H) and a selectivity index which is improved by 10-100 fold compared to targeted wild type IL-2 mimic in
- Figure 30C vi.
- the loss-of-function is less severe for the N40G mutation, both on CD8 positive and CD8 negative cells (Figure 30G) but the selectivity index is improved by 10-100 fold compared to targeted wild type IL-2 mimic in Figure 30C.
- CD8 targeting and mutation of residues D15 and N40 of IL-2_mimic clearly increases selectivity towards signaling in CD8 positive over CD8 negative cells.
- Targeting of wild type IL-2_mimic results only in a modest increase in selectivity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Animal Behavior & Ethology (AREA)
- Gastroenterology & Hepatology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Toxicology (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2023012131A MX2023012131A (es) | 2021-04-16 | 2022-04-16 | Construcciones de il-2. |
| IL307574A IL307574A (en) | 2021-04-16 | 2022-04-16 | Il-2 based constructs |
| JP2023563256A JP2024522949A (ja) | 2021-04-16 | 2022-04-16 | Il-2系構築物 |
| AU2022258840A AU2022258840A1 (en) | 2021-04-16 | 2022-04-16 | Il-2 based constructs |
| US18/286,147 US20240199714A1 (en) | 2021-04-16 | 2022-04-16 | Il-2 based constructs |
| CN202280043198.4A CN117580855A (zh) | 2021-04-16 | 2022-04-16 | 基于il-2的构建体 |
| CA3215204A CA3215204A1 (en) | 2021-04-16 | 2022-04-16 | Il-2 based constructs |
| EP22789066.2A EP4323392A4 (en) | 2021-04-16 | 2022-04-16 | IL-2-BASED CONSTRUCTS |
| KR1020237039240A KR20240021155A (ko) | 2021-04-16 | 2022-04-16 | Il-2 기반 작제물 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163175827P | 2021-04-16 | 2021-04-16 | |
| US63/175,827 | 2021-04-16 | ||
| US202263297330P | 2022-01-07 | 2022-01-07 | |
| US63/297,330 | 2022-01-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022221746A1 true WO2022221746A1 (en) | 2022-10-20 |
Family
ID=83639788
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/025143 Ceased WO2022221746A1 (en) | 2021-04-16 | 2022-04-16 | Il-2 based constructs |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20240199714A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4323392A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024522949A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240021155A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022258840A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3215204A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL307574A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2023012131A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022221746A1 (cg-RX-API-DMAC7.html) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11896648B2 (en) | 2020-10-22 | 2024-02-13 | Gilead Sciences, Inc. | Interleukin-2 variant proteins fused to human IgG4 Fc and uses thereof |
| WO2024119193A3 (en) * | 2022-12-02 | 2024-07-11 | AskGene Pharma, Inc. | Mutant il-2 polypeptides and il-2 prodrugs |
| WO2024118878A3 (en) * | 2022-11-30 | 2024-08-02 | The Regents Of The University Of California | Multispecific engineered biomolecules and uses thereof |
| US12459980B2 (en) | 2018-07-25 | 2025-11-04 | AskGene Pharma, Inc. | IL-21 prodrugs and methods of use thereof |
| WO2026015864A1 (en) * | 2024-07-12 | 2026-01-15 | Outpace Bio, Inc. | Cd8 binding polypeptides and methods of use |
| US12600762B2 (en) | 2020-01-11 | 2026-04-14 | AskGene Pharma, Inc. | Masked cytokines and methods of use thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20190359672A1 (en) * | 2018-03-28 | 2019-11-28 | Bristol-Myers Squibb Company | Interleukin-2/interleukin-2 receptor alpha fusion proteins and methods of use |
| US20200024319A1 (en) * | 2015-04-10 | 2020-01-23 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| US20210024631A1 (en) * | 2018-03-28 | 2021-01-28 | Orionis Biosciences, Inc. | Bi-functional proteins and construction thereof |
| US20210094996A1 (en) * | 2017-05-24 | 2021-04-01 | Pandion Therapeutics, Inc. | Targeted Immunotolerance |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6955807B1 (en) * | 1998-05-15 | 2005-10-18 | Bayer Pharmaceuticals Corporation | IL-2 selective agonists and antagonists |
| AU2015301936B2 (en) * | 2014-08-11 | 2019-03-07 | Delinia, Inc. | Modified IL-2 variants that selectively activate regulatory T cells for the treatment of autoimmune diseases |
| JP7422480B2 (ja) * | 2016-05-04 | 2024-01-26 | アムジエン・インコーポレーテツド | 制御性t細胞の増殖のためのインターロイキン-2変異タンパク質 |
| EP3538548A4 (en) * | 2016-11-08 | 2020-08-19 | Delinia, Inc. | IL-2 VARIANTS FOR THE TREATMENT OF AUTOIMMUNE DISEASES |
| JP7148539B2 (ja) * | 2017-04-03 | 2022-10-05 | エフ・ホフマン-ラ・ロシュ・アクチェンゲゼルシャフト | 免疫抱合体 |
| KR102777151B1 (ko) * | 2017-11-21 | 2025-03-05 | 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 | 인터루킨-2의 부분 효능제 |
| KR20250156190A (ko) * | 2018-06-22 | 2025-10-31 | 큐진 인크. | 인터루킨-2 변이체 및 이의 사용 방법 |
| EP3980051A4 (en) * | 2019-06-05 | 2023-09-13 | Asher Biotherapeutics, Inc. | FUSIONS OF MUTANT INTERLEUKIN-2 POLYPEPTIDES WITH ANTIGEN-BINDING MOLECULES TO MODULATE THE FUNCTION OF IMMUNE CELLS |
| WO2020252421A2 (en) * | 2019-06-14 | 2020-12-17 | Cugene, Inc. | Novel interleukin-2 variants and bifunctional fusion molecules thereof |
-
2022
- 2022-04-16 EP EP22789066.2A patent/EP4323392A4/en active Pending
- 2022-04-16 AU AU2022258840A patent/AU2022258840A1/en active Pending
- 2022-04-16 WO PCT/US2022/025143 patent/WO2022221746A1/en not_active Ceased
- 2022-04-16 IL IL307574A patent/IL307574A/en unknown
- 2022-04-16 KR KR1020237039240A patent/KR20240021155A/ko active Pending
- 2022-04-16 MX MX2023012131A patent/MX2023012131A/es unknown
- 2022-04-16 US US18/286,147 patent/US20240199714A1/en active Pending
- 2022-04-16 JP JP2023563256A patent/JP2024522949A/ja active Pending
- 2022-04-16 CA CA3215204A patent/CA3215204A1/en active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200024319A1 (en) * | 2015-04-10 | 2020-01-23 | Amgen Inc. | Interleukin-2 muteins for the expansion of t-regulatory cells |
| US20210094996A1 (en) * | 2017-05-24 | 2021-04-01 | Pandion Therapeutics, Inc. | Targeted Immunotolerance |
| US20190359672A1 (en) * | 2018-03-28 | 2019-11-28 | Bristol-Myers Squibb Company | Interleukin-2/interleukin-2 receptor alpha fusion proteins and methods of use |
| US20210024631A1 (en) * | 2018-03-28 | 2021-01-28 | Orionis Biosciences, Inc. | Bi-functional proteins and construction thereof |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4323392A4 * |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12459980B2 (en) | 2018-07-25 | 2025-11-04 | AskGene Pharma, Inc. | IL-21 prodrugs and methods of use thereof |
| US12600762B2 (en) | 2020-01-11 | 2026-04-14 | AskGene Pharma, Inc. | Masked cytokines and methods of use thereof |
| US11896648B2 (en) | 2020-10-22 | 2024-02-13 | Gilead Sciences, Inc. | Interleukin-2 variant proteins fused to human IgG4 Fc and uses thereof |
| WO2024118878A3 (en) * | 2022-11-30 | 2024-08-02 | The Regents Of The University Of California | Multispecific engineered biomolecules and uses thereof |
| WO2024119193A3 (en) * | 2022-12-02 | 2024-07-11 | AskGene Pharma, Inc. | Mutant il-2 polypeptides and il-2 prodrugs |
| WO2026015864A1 (en) * | 2024-07-12 | 2026-01-15 | Outpace Bio, Inc. | Cd8 binding polypeptides and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240199714A1 (en) | 2024-06-20 |
| KR20240021155A (ko) | 2024-02-16 |
| IL307574A (en) | 2023-12-01 |
| EP4323392A4 (en) | 2025-03-19 |
| CA3215204A1 (en) | 2022-10-20 |
| EP4323392A1 (en) | 2024-02-21 |
| JP2024522949A (ja) | 2024-06-24 |
| MX2023012131A (es) | 2024-01-11 |
| AU2022258840A1 (en) | 2023-10-26 |
| AU2022258840A9 (en) | 2023-11-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12473338B2 (en) | Targeted engineered interferon and uses thereof | |
| US12522641B2 (en) | Targeted mutant interferon-gamma and uses thereof | |
| US20220281992A1 (en) | Targeted chimeric proteins and uses thereof | |
| US12583898B2 (en) | Therapeutic interferon alpha 1 proteins | |
| EP4059957A1 (en) | Bispecific signaling agents and uses thereof | |
| CA3108795A1 (en) | Sirp1a targeted chimeric proteins and uses thereof | |
| WO2017194782A2 (en) | Therapeutic targeting of non-cellular structures | |
| US20240199714A1 (en) | Il-2 based constructs | |
| US12410225B2 (en) | Modulation of dendritic cell lineages | |
| US20220378925A1 (en) | Conjugated chimeric proteins | |
| WO2026076281A1 (en) | Interleukin-6 agonist chimeric proteins | |
| HK40081287A (en) | Bispecific signaling agents and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22789066 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 307574 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022258840 Country of ref document: AU Ref document number: 3215204 Country of ref document: CA Ref document number: 2022258840 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/012131 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023563256 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2022258840 Country of ref document: AU Date of ref document: 20220416 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202317074539 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020237039240 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022789066 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202307791T Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2022789066 Country of ref document: EP Effective date: 20231116 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280043198.4 Country of ref document: CN |