WO2022178753A1 - Targeting conjugates comprising targeting moiety binding fragments and uses thereof - Google Patents

Targeting conjugates comprising targeting moiety binding fragments and uses thereof Download PDF

Info

Publication number
WO2022178753A1
WO2022178753A1 PCT/CN2021/077866 CN2021077866W WO2022178753A1 WO 2022178753 A1 WO2022178753 A1 WO 2022178753A1 CN 2021077866 W CN2021077866 W CN 2021077866W WO 2022178753 A1 WO2022178753 A1 WO 2022178753A1
Authority
WO
WIPO (PCT)
Prior art keywords
targeting
antibody
targeting conjugate
conjugate
targeting moiety
Prior art date
Application number
PCT/CN2021/077866
Other languages
French (fr)
Inventor
Jun Xiang
Wenlong Gao
Original Assignee
Shanghai Allygen Biologics Co., Ltd.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Shanghai Allygen Biologics Co., Ltd. filed Critical Shanghai Allygen Biologics Co., Ltd.
Priority to PCT/CN2021/077866 priority Critical patent/WO2022178753A1/en
Priority to PCT/CN2022/077725 priority patent/WO2022179571A1/en
Publication of WO2022178753A1 publication Critical patent/WO2022178753A1/en

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/42Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/10Immunoglobulin or domain(s) thereof as scaffolds for inserted non-Ig peptide sequences, e.g. for vaccination purposes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site

Definitions

  • the present application relates to targeting conjugates comprising targeting moiety binding fragments and uses thereof.
  • Antibodies have been successfully used as therapeutic and diagnostic agents for a variety of diseases.
  • a native antibody acts by binding to a specific target.
  • antibody targets can be expressed in both diseased (e.g. tumor) tissues and normal tissues.
  • diseased e.g. tumor
  • normal tissues e.g. tumor
  • the patient can experience undesirable, toxic side-effects, which can range from mild to severe or even life-threatening degree of intensity.
  • Such side effects can lead to a decreased effective dosage of the antibody, which can lower its therapeutic efficacy.
  • the antibody treatment may even be discontinued due to the side effects, which, in some cases, render the antibody therapeutic unavailable to human patients.
  • ADCs Antibody drug conjugates
  • ADCs are targeted therapeutics designed to preferentially direct drugs ( “payloads” ) to diseased tissues expressing a surface antigen recognized by the antibody.
  • ADCs are often composed of an antibody linked to therapeutically active agents (e.g. a cytotoxic drug) , via chemical linkers that enable release of therapeutically active agents in the diseased environment.
  • therapeutically active agents e.g. a cytotoxic drug
  • Trastuzumab emtansine and brentuzimab vedotin are among the most widely used ADCs in cancer treatment (see, for example, Jackson et al., Pharm Res (2015) 32: 3458-3469) .
  • ADCs small molecule drug-antibody conjugates.
  • Current ADCs incorporate standard chemotherapeutics such as antimitotics and antimetabolites, including auristatins monomethyl auristatin E (MMAE) , calicheamicin, and derivative of maytansin 1 (DM1) . See, for example, Polakis, Pharma Rev, 2016, 68 (1) 3-19.
  • MMAE monomethyl auristatin E
  • DM1 maytansin 1
  • ADCs have conceptual advantages and promising clinical results, the development of an effective ADC therapeutic remains remarkably challenging.
  • early ADCs in clinical trials suffer from immunogenicity of the mouse antibodies used, and recent advances in the development of ADCs rely on humanized antibodies.
  • ADCs include a) drug cargo impotency; b) premature release of drug leading to loss of efficacy and toxicity; c) level of target expression; d) suboptimal target selectivity; e) side effects such as thrombocytopenia and neuropathy as seen in and
  • the ADC platform as a highly specific cargo delivery system in vivo also lends itself to applications beyond small molecule drug delivery.
  • siRNAs can be fused to an antibody and developed into an efficient method for in vivo mRNA knockdown (see, et al., Nature Protocols, 2016, 11: 22-36) .
  • antibody-mediated siRNA delivery has shown promising results in colon cancer treatment (see, et al., Clin Cancer Res 2015 15; 21 (6) : 1383-94. ) .
  • the present application provides targeting conjugates comprising a targeting moiety and one or more effector molecules, compositions, methods of preparation and methods of use thereof.
  • a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein a conjugation site with the effector molecule can be released from the targeting conjugate via cleavage.
  • TBF targeting moiety binding fragment
  • the targeting conjugate comprises structure of Formula I:
  • A is a targeting moiety that specifically binds to the target molecule
  • B is a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide
  • P is a cleavage site
  • L is a linker
  • C is a conjugation site
  • D is the effector molecule
  • x 0 or 1
  • y 0 or 1
  • z 0 or 1
  • z 0.
  • y 0.
  • y 1.
  • x 0.
  • x 1.
  • a is 1 or more.
  • b is 1 or more. In some embodiments, d is 1 or more. In some embodiments, a is 2-10 (e.g., 2-6) . In some embodiments, b is 2-10 (e.g., 2-6) . In some embodiments, d is 2-10 (e.g., 2-6) .
  • the targeting conjugate comprises a targeting peptide.
  • the targeting conjugate comprises an antibody or antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment thereof is selected from the group consisting of: a human antibody, a humanized antibody, a chimeric antibody, a monospecific antibody, a multispecific antibody, a diabody, a nanobody, an scFv, an scFab, a Fab fragment, a Fab’fragment, a F (ab’) 2 fragment, and a dsFv.
  • the targeting moiety comprises an antibody-peptide fusion protein.
  • the antibody-peptide fusion protein comprises an Fc region.
  • the peptide is fused to the C-terminus of the Fc region.
  • the targeting conjugate comprises a targeting moiety that specifically binds to a target molecule (e.g., cell surface molecule) at a target site.
  • a target molecule e.g., cell surface molecule
  • the target site is a site of a disease.
  • the disease is tumor.
  • the target molecule is selected from the group consisting of: PD1, PD-L1, Trop2, CTLA-4, LAG-3, TIM-3, 4-1BB, CD40, OX40, CD47, SIRP ⁇ , HER2, HER3, EGFR, VEGF, VEGR2, CD19, CD20, CD22, CD30, CD33, CD38, CD79, integrin ⁇ v ⁇ 3, ⁇ v ⁇ 6, MUC1, PMSA, uPAR, and angiopep-2.
  • the cleavage is triggered by a condition at a target site for the targeting moiety.
  • the condition at a target site is selected from the group consisting of: protease, pH change, redox change, hypoxia, oxidative stress, hyperthermia, and extracellular ATP concentration.
  • the cleavage is by a protease.
  • the protease is selected from the group consisting of: urokinase plasminogen activator (uPA) , legumain, plasmin, TMPRSS3, TMPRSS4, TMPRSS6, MMPl, MMP2, MMP-3, MMP-9, MMP-8, MMP-14, MT1-MMP, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM 10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, TACE, human neutrophil elastase, beta-secretase,
  • uPA urokinase plasminogen activator
  • the effector molecule is selected from the group consisting of a therapeutic agent, an oligonucleotide, and a detectable label.
  • the effector molecule is a therapeutic agent.
  • the effector molecule is selected from the group consisting of a protein-based drug, a small molecule drug, a cytotoxic agent, a toxin, an immunomodulatory agent, an anti-inflammatory agent, an anti-infective agent, and an epigenetic modulating agent.
  • the effector molecule is an oligonucleotide. In some embodiments, the oligonucleotide is about 2 to about 100 nucleotides long.
  • the oligonucleotide is selected from the group consisting of: a double stranded DNA, a single stranded DNA, a double stranded RNA, a single stranded RNA, an antisense RNA, a small interference RNA, a microRNA, a short hairpin RNA (shRNA) , and a CpG (Cytosine-phosphodiester-Guanine) oligonucleotide.
  • the oligonucleotide is a CpG oligonucleotide.
  • the oligonucleotide comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 66-67.
  • the targeting conjugate comprises two or more oligonucleotides.
  • the effector molecule is a cytotoxic agent selected from the group consisting of consisting of an anthracycline, an auristatin, a camptothecin, a combretastatin, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a maytansine, a puromycin, a pyrrolobenzodiazepine dimer, a taxane, a vinca alkaloid, a tubulysin, a hemiasterlin, a spliceostatin, a pladienolide, and stereoisomers, isosteres, analogs, or derivatives thereof.
  • a cytotoxic agent selected from the group consisting of consisting of an anthracycline, an auristatin, a camptothecin, a combretastatin, a dolastatin,
  • the effector molecule is SN38 or a derivative thereof. In some embodiments, the effector molecule is MMAE or a derivative thereof. In some embodiments, the effector molecule is selected from compounds of Formulae (1) - (6) .
  • the targeting conjugate comprises two or more effector molecules.
  • C is present in a cationic peptide linked to B.
  • C is present in a neutral charge peptide linked to B.
  • C is a covalent conjugation site.
  • C is a non-covalent conjugation site.
  • the conjugation site comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-12.
  • the targeting moiety binding fragment is linked to the targeting moiety non-covalently.
  • the TBF is linked to the targeting moiety covalently.
  • the TBF is linked to the targeting moiety covalently via a chemically reactive moiety.
  • the TBF comprises a TBP selected from the group consisting of Fc-BP1, FcBP-2, and Fc-III and fragments thereof.
  • the TBF comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 75-79, 152, and 156.
  • the TBF comprises a sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  • the TBF comprises a crosslinker selected from the group consisting of disuccinimidyl glutarate (DSG) , disuccinimidyl suberate (DSS) , Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate (SMCC) , Maleimide-amido-PEG n -TFP (TFP: tetrafluorophenyl) , and Maleimide-PEG n -DBCO (DBCO: dibenzocyclooctyne) , wherein n is an integer of 1-12.
  • DSG disuccinimidyl glutarate
  • DSS disuccinimidyl suberate
  • SMCC Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate
  • DBCO Maleimide-PEG n -DBCO
  • the targeting conjugate comprises a structure represented by the formula: TBF-R- (PEG) m -VC-PAB- (DMAE) k -Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the targeting conjugate comprises a structure represented by the formula TBF-R- (PEG) m -P-PAB- (DMAE) k -Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, P is a cleavage site, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the targeting conjugate comprises a sequence that is selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  • the targeting conjugate comprises a structure of a formula selected from the group consisting of Formulae (13) - (26) (i.e., TBP1-TBP14) . In some embodiments, the targeting conjugate comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) .
  • L is represented by the formula: SH 2 -Spacer, MAL-Spacer, NH 2 -Spacer, or Osu-Spacer (Osu: oxysuccinimide) .
  • L is represented by the formula: R- (PEG) m -VC-PAB- (DMAE) k (Formula II) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the linker is represented by R- (PEG) m -P-PAB- (DMAE) k (Formula III) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m ⁇ 0, and k is 0 or 1, P is a cleavage site.
  • a targeting conjugate comprising a targeting moiety conjugated to a therapeutic agent having a structure of a formula selected from the group consisting of compounds of Formulae (1) - (6) .
  • a targeting conjugate comprising a targeting moiety conjugated to an effector molecule via a targeting moiety binding fragment, wherein the targeting moiety binding fragment comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 76-79, 152, and 156.
  • the targeting conjugate comprises a structure of a formula selected from the group consisting of Formulae (13) - (26) .
  • compositions comprising a plurality of any one of the targeting conjugates described above.
  • the average ratio of the effector molecule and the targeting moiety in the composition is at least about 1: 1.
  • at least two of the targeting conjugates in the composition comprise different numbers of effector molecules.
  • the composition is a pharmaceutical composition.
  • the effector molecule is a detectable label
  • the composition is a diagnostic composition.
  • a method of treating a disease in an individual comprising administering to the individual an effective amount of any one of the pharmaceutical compositions described above.
  • a method of diagnosing a disease in an individual comprising administering to the individual an effective amount of the diagnostic compositions described above, wherein the detection of the detectable label is indicative of the presence of the disease.
  • the method comprises conjugating the effector molecule to the targeting moiety.
  • the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • A a targeting moiety, such as an antibody or antigen-binding
  • the present application provides compositions and methods of treatment or diagnosis using targeting conjugates comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) , wherein the effector molecule can be released from the targeting conjugate via cleavage.
  • TBF targeting moiety binding fragment
  • the targeting moiety specifically binds to a target molecule, such as a cell surface molecule that is expressed on a diseased tissue or diseased cells (e.g., tumor cells) .
  • cleavage of one or more cleavage sites in the targeting conjugate may be triggered, which leads to release of the effector molecule at the target site.
  • the targeting conjugate is multispecific.
  • the targeting conjugates described herein may have more than one type of cargoes (e.g., oligonucleotides and small molecule drugs) conjugated to the conjugation site, and the targeting moiety can be a targeting peptide, an antibody or antigen binding fragment thereof (including a multispecific antibody) , or a combination thereof.
  • the targeting conjugates described herein can have enhanced selective target recognition capability and efficacy compared to traditional ADCs. Incorporating multiple conjugation sites and different types of cargos onto one targeting conjugate opens up potentials for more potent therapeutic effects.
  • the possibilities of combining oligonucleotides and other effector molecules (e.g., small molecule drugs) expand the scope of diseases that can be targeted by the targeting conjugates described herein.
  • one aspect of the present application provides a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein the effector molecule can be released from the targeting conjugate via cleavage.
  • TBF targeting moiety binding fragment
  • compositions, methods, kits and articles of manufacture for any one of the targeting conjugates described above are also provided.
  • targeting moiety refers to a polypeptide-based binding molecule that specifically binds to a target molecule, or a portion thereof that contributes to the specific binding. Both antibody-based and non-antibody based binding molecules or portions thereof are contemplated herein.
  • effector molecule refers to a molecule having a therapeutic or diagnostic effect.
  • the effector molecule may be of any suitable molecular entity, such as a small molecule drug or an oligonucleotide.
  • conjugation refers to chemically joining two chemical groups or moieties together via one or more covalent or non-covalent bonds. Conjugation may be direct between the two chemical groups or moieties, or indirect through a third chemical group or moiety (e.g., a linker) that bridges the two chemical groups or moieties.
  • a linker e.g., a linker
  • conjugation site refers to a site that directly joins two chemical moieties.
  • antibody is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) , full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity.
  • antibody moiety refers to a full-length antibody or an antigen-binding fragment thereof.
  • Antibodies and/or antigen binding fragments may be derived from murine antibodies, rabbit antibodies, human antibodies, fully humanized antibodies, camelid antibody variable domains and humanized versions, shark antibody variable domains and humanized versions, and camelized antibody variable domains.
  • a full-length antibody comprises two heavy chains and two light chains.
  • the variable regions of the light and heavy chains are responsible for antigen binding.
  • the variable domains of the heavy chain and light chain may be referred to as “VH” and “VL” , respectively.
  • the variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3) .
  • CDRs complementarity determining regions
  • CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991) .
  • the three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs) , which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops.
  • FRs framework regions
  • the constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions.
  • Antibodies are assigned to classes based on the amino acid sequence of the constant region of their heavy chain.
  • the five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ heavy chains, respectively.
  • Several of the major antibody classes are divided into subclasses such as lgG1 ( ⁇ 1 heavy chain) , lgG2 ( ⁇ 2 heavy chain) , lgG3 ( ⁇ 3 heavy chain) , lgG4 ( ⁇ 4 heavy chain) , lgA1 ( ⁇ 1 heavy chain) , or lgA2 ( ⁇ 2 heavy chain) .
  • antigen-binding fragment refers to an antibody fragment including, for example, a diabody, a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a bispecific dsFv (dsFv-dsFv’) , a disulfide stabilized diabody (ds diabody) , a single-chain Fv (scFv) , an scFv dimer (bivalent diabody) , a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
  • an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds.
  • an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
  • targeting moiety binding fragment refers to a fragment comprising a targeting moiety binding peptide ( “TBP” ) that specifically binds to a targeting moiety.
  • TBF may further comprise a chemical reactive moiety that can be covalently linked to the targeting moiety.
  • the TBF comprises a small molecule linker comprising the chemically reactive moiety.
  • the TBF does not comprise a chemical reactive moiety that can be covalently linked to the targeting moiety, i.e., the TBF non-covalently binds to the targeting moiety.
  • the targeting moiety binding peptide is an antibody binding peptide ( “ABP” ) , which is a polypeptide that specifically binds to an antibody.
  • ABPs include, but are not limited to, an FcBP-1, an FcBP-2, an Fc-III and fragments thereof.
  • a TBF comprising an ABP is referred herein as an “antibody binding fragment” or “ABF” .
  • link, ” “conjugate, ” “ligate” , and “fuse” are used interchangeably to refer to connection of two chemical moieties either covalently or non-covalently.
  • the connection may be direct or indirect, e.g., through a linker.
  • “Fv” is the minimum antibody fragment, which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy-and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv, ” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
  • Plückthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994) .
  • CDR complementarity determining region
  • CDR complementarity determining region
  • CDR prediction algorithms and interfaces are known in the art, including, for example, Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008) ; Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010) ; and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015) .
  • the contents of the references cited in this paragraph are incorporated herein by reference in their entireties for use in the present application and for possible inclusion in one or more claims herein.
  • the CDR sequences provided herein are based on IMGT definition.
  • the CDR sequences may be determined by the VBASE2 tool (www. vbase2. org/vbase2. php, see also Retter I, Althaus HH, Münch R, Müller W: VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan 1; 33 (Database issue) : D671-4, which is incorporated herein by reference in its entirety) .
  • treatment is an approach for obtaining beneficial or desired results including clinical results.
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: decreasing one more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease) , preventing or delaying the spread of the disease, preventing or delaying the occurrence or recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (whether partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing the quality of life, and/or prolonging survival.
  • treatment is a reduction of pathological consequence of the disease. The methods of the present application contemplate any one or more of these aspects of treatment.
  • the terms “individual, ” “subject” and “patient” are used interchangeably herein to describe a mammal, including humans.
  • the individual is human.
  • an individual suffers from a disease or condition (e.g., cancer) .
  • the individual is in need of treatment.
  • an “effective amount” refers to an amount of an agent (e.g., a targeting conjugate) sufficient to produce a desired therapeutic outcome (e.g., reducing the severity or duration of, stabilizing the severity of, or eliminating one or more symptoms of cancer) .
  • beneficial or desired results include, e.g., decreasing one or more symptoms resulting from the disease (biochemical, histologic and/or behavioral) , including its complications and intermediate pathological phenotypes presented during development of the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication, delaying the progression of the disease, and/or prolonging survival of patients.
  • an effective amount of the agent may extend survival (including overall survival and progression free survival) ; result in an objective response (including a complete response or a partial response) ; relieve to some extent one or more signs or symptoms of the disease or condition; and/or improve the quality of life of the subject.
  • Percent (%) amino acid sequence identity with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) , or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • %amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R.C., Nucleic Acids Research 32 (5) : 1792-1797, 2004; Edgar, R.C., BMC Bioinformatics 5 (1) : 113, 2004, each of which are incorporated herein by reference in their entirety for all purposes) .
  • amino acid substitution may include but are not limited to the replacement of one amino acid in a polypeptide with another amino acid. Exemplary substitutions are shown in Table 1. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
  • Amino acids may be grouped according to common side-chain properties:
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • polypeptide or “peptide” are used herein to encompass all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP-ribosylation, pegylation, biotinylation, etc. ) .
  • fusion refers to genetically joining two polypeptide fragments to provide a single continuous polypeptide ( “fusion polypeptide” ) .
  • the two polypeptide fragments may be directly joined to each other, or joined via another polypeptide disposed therebetween. Routine recombinant DNA techniques or chemical gene synthesis can be used to provide nucleic acids that genetically encode a fusion polypeptide.
  • epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody binds. Two antibodies or antigen binding fragments may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
  • the terms “specifically binds, ” “specifically recognizing, ” and “is specific for” refer to measurable and reproducible interactions, such as binding between a target and a targeting moiety (e.g., a targeting peptide or an antibody or antigen-binding fragment thereof) .
  • a targeting moiety e.g., a targeting peptide or an antibody or antigen-binding fragment thereof
  • specific binding is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules (e.g., cell surface receptors) .
  • a targeting moiety that specifically recognizes a target is a targeting moiety (e.g., antibody) that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other molecules.
  • the extent of binding of a targeting moiety to an unrelated molecule is less than about 10%of the binding of the targeting moiety to the target as measured, e.g., by a radioimmunoassay (RIA) .
  • a targeting moiety that specifically binds a target has a dissociation constant (KD) of ⁇ 10 -5 M, ⁇ 10 -6 M, ⁇ 10 -7 M, ⁇ 10 -8 M, ⁇ 10 -9 M, ⁇ 10 -10 M, ⁇ 10 -11 M, or ⁇ 10 -12 M.
  • KD dissociation constant
  • a targeting moiety specifically binds an epitope on a protein that is conserved among the protein from different species.
  • specific binding can include, but does not require exclusive binding.
  • Binding specificity of the targeting moiety can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA, RIA, ECL, IRMA, EIA, BIACORETM and peptide scans.
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a “pharmaceutically acceptable carrier” refers to one or more ingredients in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, cryoprotectant, toxicity agent, preservative, and combinations thereof.
  • Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration or other state/federal government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • An “article of manufacture” is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or condition (e.g., cancer) , or a probe for specifically detecting a biomarker described herein.
  • the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
  • references to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X” .
  • reference to “not” a value or parameter generally means and describes "other than” a value or parameter.
  • the method is not used to treat disease of type X means the method is used to treat disease of types other than X.
  • a and/or B is intended to include both A and B; A or B; A (alone) ; and B (alone) .
  • the term “and/or” as used herein a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone) ; B (alone) ; and C (alone) .
  • One aspect of the present application provides a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein the effector molecule can be released from the targeting conjugate via cleavage.
  • TBF targeting moiety binding fragment
  • a targeting conjugate comprising the structure of Formula I:
  • A is a targeting moiety that specifically binds to the target molecule
  • B is a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide
  • P is a cleavage site
  • L is a linker
  • C is a conjugation site
  • D is an effector molecule
  • L is a linker
  • x 0 or 1
  • y 0 or 1
  • z 0 or 1
  • Exemplary targeting conjugates are shown in FIGs. 1A-3B, and described in section F, “Exemplary targeting conjugates” below.
  • the targeting moiety (A) of the present application is conjugated to one or more effector molecules (D) , which may be therapeutic agents, oligonucleotides, detectable labels and combinations thereof.
  • the effector molecule is conjugated to the targeting moiety via a targeting moiety binding fragment (B) .
  • the effector molecule is conjugated to the targeting moiety binding fragment at a conjugation site (C) .
  • a cleavage site P, e.g., a protease cleavage site
  • P e.g., a protease cleavage site
  • no cleavage site (P, e.g., a protease cleavage site) is disposed between the conjugation site (C) and the targeting moiety binding fragment (B) .
  • the effector molecule is conjugated to the targeting moiety binding fragment (B) at a conjugation site endogenous to the TBF.
  • the effector molecule is conjugated at the conjugation site (C) via a linker (L) .
  • the effector molecule is conjugated to the targeting moiety at a conjugation site (C) directly without a linker (L) .
  • a cleavage site (P, e.g., a protease cleavage site) is disposed between the conjugation site (C) and the effector molecule (D) . In some embodiments, there is no cleavage site (P, e.g., a protease cleavage site) .
  • a targeting conjugate comprising the structure of Formula I:
  • A is an antibody or antigen binding fragment thereof;
  • B is an antibody binding fragment (ABF) (e.g., an Fc binding peptide) comprising an antibody binding peptide;
  • P is a cleavage site (e.g., a protease cleavage site such as a uPA cleavage site) ;
  • C is a conjugation site (e.g., a transglutaminase conjugation site) ;
  • L is a linker;
  • D is an effector molecule (e.g., a therapeutic agent, an oligonucleotide or a detectable label) ;
  • x 0 or 1;
  • y 0 or 1;
  • A is a multispecific (e.g., bispecific antibody) .
  • A is an antibody or antigen binding fragment that specifically binds to an immune checkpoint molecule, such as PD-L1.
  • B is covalently conjugated to A.
  • B is non-covalently conjugated to A.
  • a targeting conjugate comprising: (a) a first polypeptide chain comprising a first heavy chain of an anti-PD-L1 antibody; (b) a second polypeptide chain comprising a second heavy chain of the anti-PD-L1 antibody; (c) a third polypeptide chain comprising a first light chain of the anti-PD-L1 antibody; (d) a fourth polypeptide chain comprising a second light chain of the anti-PD-L1 antibody; (e) a first moiety comprising a first antibody binding fragment (ABF) conjugated to a first effector molecule via a first conjugation site, wherein the first ABF comprises a first ABP that specifically binds to the first heavy chain of the anti-PD-L1 antibody; and (f) a second moiety comprising a second ABF conjugated to a second effector molecule via a second conjugation site, wherein the second ABF comprises a second ABP that that specifically binds to the second heavy chain of the anti-PD-L1 antibody; and
  • the first moiety is covalently linked to the first heavy chain of the anti-PD-L1 antibody, and/or the second moiety is covalently linked to the second heavy chain of the anti-PD-L1 antibody. In some embodiments, the first moiety is non-covalently linked to the first heavy chain of the anti-PD-L1 antibody, and/or the second moiety is non-covalently linked to the second heavy chain of the anti-PD-L1 antibody.
  • the first moiety and/or the second moiety comprises a structure represented by the formula: ABF-R- (PEG) m -VC-PAB- (DMAE) k -Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the first moiety and/or the second moiety comprises a structure represented by the formula ABF-R- (PEG) m -P-PAB- (DMAE) k -Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, P is a cleavage site, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the first ABF and/or the second ABF comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 75-79, 152, and 156.
  • the first moiety and/or the second moiety comprises a structure represented by a formula selected from the group consisting of Formulae (13) - (26) (e.g., TBP1-TBP14) .
  • the first moiety and/or the second moiety comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) .
  • the first effector molecule and the second effector molecule are identical. In some embodiments, the first effector molecule and the second effector molecule are different.
  • the first effector molecule (including the first linker) , and/or the second effector molecule (including the second linker) is a therapeutic agent selected from SN38, MMAE and derivatives thereof, e.g., compounds of Formulae (1) - (6) .
  • the first effector molecule and/or the second effector molecule is an oligonucleotide, such as a CpG oligonucleotide.
  • the CpG oligonucleotide comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 66-67.
  • the oligonucleotide is conjugated to the TBF via an oligonucleotide binding polypeptide.
  • the oligonucleotide binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65.
  • the first effector molecule and/or the second effector molecule is a detectable label.
  • two or more effector molecules are conjugated to the first conjugation site and/or the second conjugation site.
  • the cleavage site comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 50-55.
  • the first polypeptide and/or the second polypeptide comprises an amino acid sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%, or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 100, 102, 104, 106, 108, 110, and 112.
  • the third polypeptide and/or the fourth polypeptide comprises an amino acid sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%, or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 101, 103, 105, 107, 109, 111, and 113.
  • the targeting conjugate may comprise any suitable number of the cleavage sites (P) , the conjugation sites (C) , the linkers (L) , and the effector molecules (D) .
  • the number of cleavage site P can be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • the number of the conjugation site C can be any one of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • the number of linker L can be any one of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • the number of the effector molecules D can be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • the target conjugate may comprise any one of the targeting moiety, targeting moiety binding fragments, conjugation sites, cleavage sites (e.g., protease cleavage sites) , linkers, and effector molecules described in sections A-E described below.
  • the targeting conjugate comprises a single effector molecule. In some embodiments, the targeting conjugate comprises a plurality of effector molecules. In some embodiments, the targeting conjugate comprises a single molecule of the effector molecule. In some embodiments, the targeting conjugate comprises two or more of the same effector molecule. In some embodiments, the targeting conjugate comprises two or more different effector molecules. In some embodiments, the targeting conjugate comprises a single copy of each effector molecule. In some embodiments, the targeting conjugate comprises two or more copies of each effector molecule.
  • the targeting conjugate has a high drug loading.
  • drug loading refers to the ratio between the number of effector molecules to the targeting moiety (e.g., an antibody or antigen-binding fragment thereof) in the targeting conjugate. For example, an antibody conjugated to a total of 8 effector molecules has a drug loading of 8.
  • Each molecule of a targeting conjugate has an integer value of drug loading.
  • different molecules of a targeting conjugate may have different values of drug loading.
  • a composition may have an average drug loading of an integer value or a non-integer value.
  • the drug loading of the targeting conjugate is at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 60: 1, 70: 1, 80: 1, 90: 1, 100: 1 or more.
  • the drug loading of the targeting conjugate is no more than about any one of 100: 1, 90: 1, 80: 1, 70: 1, 60: 1, 50: 1, 40: 1, 30: 1, 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1.
  • the drug loading of the targeting conjugate is about any one of 2: 1-4: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-9: 1, 2: 1-8: 1, 2: 1-7: 1, 2: 1-6: 1, 2: 1-5: 1, 2: 1-4: 1, 2: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 20: 1-40: 1, 40: 1-100: 1, 2: 1-20: 1, 2: 1-40: 1, or 10: 1-40: 1.
  • the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, or 20: 1.
  • the effector molecule e.g., therapeutic agent, oligonucleotide and/or detectable label
  • the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of no more than about any one of 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1.
  • the effector molecule e.g., therapeutic agent, oligonucleotide and/or detectable label
  • the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of about any one of 1: 1-2: 1, 2: 1-4: 1, 4: 1-8: 1, 1: 1-10: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-9: 1, 2: 1-8: 1, 2: 1-7: 1, 2: 1-6: 1, 2: 1-5: 1, 2: 1-4: 1, 1: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 1: 1-20: 1, or 2: 1-20: 1.
  • the effector molecule e.g., therapeutic agent, oligonucleotide and/or detectable label
  • the targeting conjugates of the present applications comprise one or more targeting moieties.
  • the targeting moiety comprises an antibody, or an antigen binding fragment thereof. In some embodiments, the target moiety is a fusion protein comprising an antibody or antigen binding fragment thereof. In some embodiments, the targeting moiety is a monoclonal antibody. In some embodiments, the targeting moiety is a full-length antibody. In some embodiments, the targeting moiety is an antigen-binding fragment.
  • Exemplary antigen-binding fragments include, but are not limited to, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’) 2 , an Fv, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2 , a single-domain antibody (e.g., VHH) , an Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
  • the targeting moiety comprises an scFv.
  • the scFv comprises from the N-terminus to the C-terminus: VL-VH, wherein the dash is a bond or a peptide linker.
  • the scFv comprises from the N-terminus to the C-terminus: VH-VL, wherein the dash is a bond or a peptide linker.
  • the targeting moiety is a fusion protein comprising an scFv.
  • the fusion protein is an scFv-Fc fusion protein.
  • the fusion protein is an scFv-Fv fusion protein.
  • the fusion protein is an scFv-full length antibody fusion protein.
  • the N terminus of the scFv is covalently fused to the C-terminus of a heavy chain or a light chain of a full length antibody.
  • the targeting moiety is a Fab or Fab’.
  • the targeting moiety is a Fab-containing polypeptide, which may comprise part or all of a wild-type hinge sequence (generally at the carboxyl terminus of the Fab portion of the polypeptide) .
  • a Fab-containing polypeptide may be obtained or derived from any suitable immunoglobulin.
  • a Fab-containing polypeptide may be a Fab-fusion protein that combines a Fab fragment with a fusion partner, such as the target-binding region of a receptor, an adhesion molecule, a ligand, an enzyme, a cytokine, a chemokine, or some other protein or protein domain.
  • the targeting peptide is a domain or a portion of a target protein.
  • the targeting moiety comprises a nanobody, also known as a single domain antibody (sdAb) .
  • sdAbs include, but are not limited to, heavy chain variable domains from heavy-chain only antibodies (e.g., VHH or V NAR ) , binding molecules naturally devoid of light chains, single domains (such as VH or VL) derived from conventional 4-chain antibodies, humanized heavy-chain only antibodies, human sdAbs produced by transgenic mice or rats expressing human heavy chain segments, and engineered domains and single domain scaffolds other than those derived from antibodies.
  • the targeting moiety comprises a VHH.
  • the targeting moiety comprises a multispecific antibody.
  • the targeting moiety is a multispecific antibody.
  • the multispecific antibody is a bispecific antibody.
  • Exemplary bispecific antibodies include full-length and Fab2 constructs, as well as diabodies.
  • the diabody is a noncovalent dimer of single-chain Fv (scFv) fragments connected by a peptide linker.
  • another form of diabody is single-chain (Fv) , in which two scFv fragments are covalently linked to each other.
  • the multispecific antibody is a trispecific antibody.
  • Exemplary trispecific antibodies include Fab3 and triabodies, with the latter being the three-scFv-version of diabodies.
  • scFv-Fc are made of two linked single chain variable fragments fused to an intact Fc region.
  • minibodies are similar to scFv-Fc, but only contain a CH1 domain rather than a full Fc region.
  • Other multivalent constructs include IgNAR and hcIgG.
  • the targeting conjugate comprises a first targeting moiety that specifically binds to a first target molecule a second targeting moiety that specifically binds to a second target molecule.
  • the first targeting moiety and the second targeting moiety are identical.
  • the first targeting moiety and the second targeting moiety are different.
  • the first targeting moiety and the second targeting moiety specifically bind to the same targeting molecule.
  • the first targeting moiety and the second targeting moiety specifically bind to different targeting molecule.
  • a cleavage site e.g., a protease cleavage site
  • the targeting moiety is a chimeric, human, partially humanized, fully humanized, or semi-synthetic antibody.
  • Antibodies and/or antibody fragments may be derived from murine antibodies, rabbit antibodies, human antibodies, fully humanized antibodies, camelid antibody variable domains and humanized versions, shark antibody variable domains and humanized versions, and camelized antibody variable domains.
  • the targeting moiety is an antagonist antibody or antigen-binding fragment thereof. In some embodiments, the targeting moiety is an agonist antibody or antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment thereof comprises one or more antibody constant regions, such as human antibody constant regions.
  • the heavy chain constant region is of an isotype selected from IgA, IgG, IgD, IgE, and IgM.
  • the human light chain constant region is of an isotype selected from ⁇ and ⁇ .
  • the antibody or antigen-binding fragment thereof comprises an IgG constant region, such as a human IgG1, IgG2, IgG3, or IgG4 constant region.
  • an antibody comprising a human IgG1 heavy chain constant region or a human IgG3 heavy chain constant region may be selected.
  • an antibody comprising a human IgG4 or IgG2 heavy chain constant region may be selected.
  • the antibody comprises a human IgG4 heavy chain constant region.
  • the antibody or antigen binding fragment thereof comprises a stabilizing domain.
  • the stabilizing domain comprises an Fc domain.
  • the term “Fc region, ” “Fc domain” or “Fc” refers to a C-terminal non-antigen binding region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native Fc regions and variant Fc regions.
  • the Fc domain is selected from the group consisting of Fc fragments of IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof.
  • the Fc domain is derived from a human IgG.
  • the Fc domain comprises the Fc domain of human IgG1, IgG2, IgG3, IgG4, or a combination or hybrid IgG.
  • the Fc domain has a reduced effector function as compared to corresponding wild type Fc domain (such as at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, or 95%reduced effector function as measured by the level of antibody-dependent cellular cytotoxicity (ADCC) ) .
  • a human IgG heavy chain Fc region extends from Cys226 to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present, without affecting the structure or stability of the Fc region.
  • the targeting moiety comprises a variant Fc region has at least one amino acid substitution compared to the Fc region of a wild type IgG or a wild-type antibody.
  • an antibody may consist of two identical light protein chains (light chains) and two identical heavy protein chains (heavy chains) , all held together covalently by interchain disulfide linkages. The N-terminal regions of the light and heavy chains together can form the antigen recognition site of the antibody. Structurally, various functions of an antibody can be confined to discrete protein domains or regions.
  • the antibody comprises an antigen binding portion comprises a heavy chain comprising the VH and a light chain comprising the VL.
  • Antigen-binding antigen binding fragments, including single-chain antibodies may comprise the variable region (s) alone or in combination with the entirety or a portion of the following: hinge region, CH1, CH2, and CH3 domains.
  • the antibody is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed. In some embodiments, the antibody is altered to increase or decrease the reactivity of the reactive functional groups on the antibody. In some embodiments, the antibody is altered to increase or decrease the number of reactive functional groups. In some embodiments, the antibody is altered to increase or decrease the extent to which reactive functional groups are exposed.
  • the reactive functional groups can be at the N terminus, the C terminus, or in the sidechains of the amino acids of the antibody. The reactive functional group can be naturally occurring in the antibody or incorporated.
  • the reactive functional group can be an amine or a derivative thereof, a carboxyl group or a derivative thereof, a nitro, or other functional groups.
  • the reactive functional group is an amine.
  • the amine is in the Fc region of the antibody.
  • Antibodies that specifically bind to a target molecule can be obtained using methods known in the art, such as by immunizing a non-human mammal and obtaining hybridomas therefrom, or by cloning a library of antibodies using molecular biology techniques known in the art and subsequence selection or by using phage display. Nucleic acid constructs encoding any one of the antibodies or antigen-binding fragments described herein, vectors, and host cells for preparation are also provided.
  • the targeting moiety comprises a targeting peptide.
  • targeting peptide refers to a non-antibody based polypeptide that specifically binds to a target molecule, e.g., a cell surface molecule at a target site.
  • the targeting moiety is a fusion protein comprising an antibody or antigen-binding fragment thereof fused to a targeting peptide.
  • the targeting polypeptide comprises a non-antibody scaffold.
  • Non-antibody scaffolds are engineered protein scaffolds that yield specificities towards different kinds of targets. Compared with antibodies, engineered protein scaffolds offer a much smaller size and simpler architecture that facilitates recombinant gene expression, the construction of bifunctional fusion proteins, and tissue penetration. See, for example, Skerra, Curr. Opin. Biotech. 2007, 18: 298-304. Over 50 different non-antibody scaffolds have been reported. See, for example, Vazquez-Lombardi, Rodrigo, et al. Drug discovery today 20.10 (2015) : 1271-1283.
  • non-antibody scaffolds include, but are not limited to, a lipocalin, an anticalin (artificial antibody mimetic proteins that are derived from human lipocalins) , 'T-body' , a peptide (e.g., a BICYCLE TM peptide) , an affibody (antibody mimetics composed of alpha helices, e.g.
  • a peptibody peptide-Fc fusion
  • a DARPin designed ankyrin repeat proteins, engineered antibody mimetic proteins consisting repeat motifs
  • an affimer an avimer
  • a knottin aprotein structural motif containing 3 disulfide bridges
  • a monobody an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, and a centryin.
  • the targeting moiety comprises an anticalin.
  • Anticalins are among the more actively developed non-antibody scaffolds, with a high number of lead compounds under preclinical development directed against CTLA-4, hepcidin, hepatocyte growth factor receptor (HGFR; MET) , IL-4Ra and IL-23/IL-17.
  • PRS-050 Pieris
  • a VEGF-A targeting DARPin, MP0112 (Molecular Partners/Allergan) targeting retinal angiogenic disorders is also currently being assessed in clinical studies.
  • FDA-approved single non-antibody scaffolds include the Kunitz domain (ecallantide; Dyax) , a plasma kallikrein inhibitor used for the treatment of hereditary angioedema; (CSL-Behring) , and (ViroPharma/Shire) , as well as the bradykinin receptor antagonist (Shire) . See, for example, Vazquez-Lombardi, Rodrigo, et al. Drug discovery today 20.10 (2015) : 1271-1283.
  • the targeting peptide comprises a polypeptide derived from a receptor or a ligand of the target molecule.
  • the targeting polypeptide is an inhibitory polypeptide that blocks the binding of the target molecule and its ligand or receptor completely or partially such as by at least about any one of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 95%.
  • the targeting peptide is at least about any one of 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500 or more amino acids in length.
  • the targeting peptide comprises a stabilizing domain.
  • the stabilizing domain can be any suitable domain that stabilizes the targeting peptide.
  • the stabilizing domain extends the half-life of the targeting peptide in vivo.
  • the stabilizing domain is an Fc domain, such as any one of the Fc domains described in the “Antibodies or antigen-binding fragment thereof” section.
  • the stabilizing domain is an albumin domain.
  • the targeting peptide and the stabilization domain are fused to each other via a linker, such as a peptide linker.
  • a peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence.
  • a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker.
  • the peptide linker can be of any suitable length.
  • the peptide linker tends not to adopt a rigid three-dimensional structure, but rather provide flexibility to a polypeptide.
  • the peptide linker is a flexible linker.
  • Exemplary flexible linkers include glycine polymers, glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art.
  • the peptide linker comprises substrate sequences for enzymatic reactions.
  • the peptide linker comprises substrate sequences for enzymes that ligates the targeting peptide and a stabilizing domain.
  • the targeting peptide may be obtained using known methods in the art, such as by screening a library of polypeptides.
  • the polypeptides can be prepared using chemical synthesis or produced using recombinant DNA techniques.
  • Nucleic acid constructs encoding any one of the targeting peptides described herein, vectors, and host cells for preparation are also provided.
  • Target molecule and exemplary targeting moieties are provided.
  • the targeting moiety specifically binds to one or more target molecules.
  • the targeting moiety is monospecific, i.e., specifically binds to a single target molecule.
  • the targeting moiety is multispecific, i.e., specifically binds to two or more different target sites in a single target molecule, or two or more different target molecules.
  • the targeting moiety has a single target binding site. In some embodiments, the targeting moiety has two or more target binding sites.
  • the targeting moiety specifically binds to a cell surface molecule.
  • the cell surface molecule is a cell surface molecule at a target site.
  • the target site is site of a disease.
  • the disease is a tumor.
  • the disease is an inflammatory disease.
  • the disease is a fibrotic disease.
  • the disease is an infection.
  • the disease is an autoimmune disease.
  • the disease is an immunodeficiency disease.
  • target molecules include but are not limited to proteins, glycans, lipids, other small molecules, or a combination thereof.
  • the cell surface molecule is a tumor-specific marker/tumor antigen.
  • a tumor-specific marker or a “tumor antigen” refers to a molecular marker that can be expressed on a neoplastic tumor cell and/or within a tumor microenvironment.
  • a tumor antigen can be a tumor specific antigen and/or a tumor associated antigen.
  • a tumor antigen can be an antigen expressed on a cell associated with a tumor, such as a neoplastic cell, stromal cell, endothelial cell, fibroblast, or tumor-infiltrating immune cell.
  • a tumor antigen Her2/Neu can be overexpressed by certain types of breast and ovarian cancer.
  • a tumor antigen can also be ectopically expressed by a tumor and contribute to deregulation of the cell cycle, reduced apoptosis, metastasis, and/or escape from immune surveillance.
  • Tumor antigens are generally proteins or polypeptides derived therefrom, but can be glycans, lipids, or other small organic molecules.
  • a tumor antigen can arise through increases or decreases in post-translational processing exhibited by a cancer cell compared to a normal cell, for example, protein glycosylation, protein lipidation, protein phosphorylation, or protein acetylation.
  • the tumor antigen is a cell-surface carbohydrate.
  • the cell-surface carbohydrate is a monosaccharide.
  • the cell-surface glycan is an oligosaccharide.
  • the cell-surface carbohydrate is a polysaccharide.
  • the cell-surface carbohydrate is a glycan.
  • the cell-surface carbohydrate is a glycoconjugate, such as a glycoprotein, glycolipid, or a proteoglycan.
  • the cell-surface glycan is selected from the group consisting of GD2, GD3, GM2, Le y , sLe, polysialic acid, fucosyl GMl, Tn, STn, BM3, or GloboH.
  • the tumor antigen is a cell-surface protein.
  • the cell-surface protein is selected from the group consisting of CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-1, PD-Ll, B7-H3, B7-DC (PD-L2) , HLA-DR, carcinoembryonic antigen (CEA) , TAG-72, MUC1, MUC15, MUC16, folate-binding protein, A33, G250, prostate specific membrane antigen (PSMA) , CA-125, CA19-9, epidermal growth factor, HER2, IL-2 receptor, EGFRvIII (de2-7 EGFR) , EGFR, fibroblast activation protein (FAP) , tenascin, a metalloproteinase, endosialin, vascular endothelial growth factor, av ⁇ 3, WTl, LMP2, HP
  • the tumor antigen is selected from the group consisting of PD1, PD-L1, Trop2, CTLA-4, LAG-3, TIM-3, 4-1BB, CD40, OX40, CD47, SIRP ⁇ , HER2, HER3, EGFR, VEGF, VEGR2, CD19, CD20, CD22, CD30, CD33, CD38, CD79, integrin ⁇ v ⁇ 3, ⁇ v ⁇ 6, MUC1, PMSA, uPAR, and Angiopep-2.
  • the tumor antigen is Trop2.
  • Trop-2 also known as epithelial glycoprotein-1, gastrointestinal antigen 733-1, membrane component surface marker-1, and tumor-associated calcium signal transducer-2, is the protein product of the TACSTD2 gene.
  • Trop-2 is a transmembrane glycoprotein that is upregulated in all cancer types independent of baseline levels of Trop-2 expression.
  • Trop-2 is an ideal candidate for targeted therapeutics due to it being a transmembrane protein with an extracellular domain overexpressed on a wide variety of tumors as well as its upregulated expression relative to normal cells. See, for example, Onco Targets Ther. 2019; 12: 1781–1790.
  • the target molecule is associated with fibrotic or inflammatory disease.
  • the target molecule is selected from the group consisting of Cadherin 11, PDPN, LRRC15, Integrin a, 4f37, Integrin a2f31, MADCAM, Nephrin, Podocin, IFNARI, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFRf3, Integrin avf31, Integrin avf33, Integrin avf38, GARP, Endosialin, CTGF, Integrin avf36, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, LRRC15, MMP14, GPX8, and F2RL2.
  • the target molecule is associated with an infection or an immunodeficiency disease.
  • the target molecule is a protein of an infectious agent, such as a pathogenic bacterium or a virus.
  • the targeting moiety specifically binds to an immune checkpoint protein.
  • Immune checkpoint proteins regulate immune activation.
  • some cancers can protect themselves from attack by stimulating immune checkpoint targets. See, for example, Nature Reviews. Cancer. 12 (4) : 252–64.
  • Inhibitory checkpoint molecules are targets for cancer immunotherapy due to their potential for use in multiple types of cancers.
  • the targeting moiety comprises an immune checkpoint inhibitor.
  • Immune checkpoint inhibitors are compounds that inhibit the activity of control mechanisms of the immune system.
  • Immune system checkpoints, or immune checkpoints are inhibitory pathways in the immune system that generally act to maintain self-tolerance or modulate the duration and amplitude of physiological immune responses to minimize collateral tissue damage.
  • Immune checkpoint inhibitors can inhibit an immune system checkpoint by stimulating the activity of a stimulatory checkpoint molecule, or inhibiting the activity of an inhibitory checkpoint molecule in the pathway.
  • Immune system checkpoint molecules include, but are not limited to, cytotoxic T-lymphocyte antigen 4 (CTLA-4) , programmed cell death 1 protein (PD-1) , programmed cell death 1 ligand 1 (PD-L1) , programmed cell death 1 ligand 2 (PD-L2) , lymphocyte activation gene 3 (LAG3) , B7-1, B7-H3, B7-H4, T cell membrane protein 3 (TIM3) , B-and T-lymphocyte attenuator (BTLA) , V-domain immunoglobulin (Ig) -containing suppressor of T-cell activation (VISTA) , Killer-cell immunoglobulin-like receptor (KIR) , and A2A adenosine receptor (A2aR) .
  • CTLA-4 cytotoxic T-lymphocyte anti
  • immune checkpoint inhibitors include antagonists of CTLA-4, PD-1, PD-L1, PD-L2, LAG3, B7-1, B7-H3, B7-H4, BTLA, VISTA, KIR, A2aR, and TIM3.
  • antibodies that bind to CTLA-4, PD-1, PD-L1, PD-L2, LAG3, B7-1, B7-H3, B7-H4, BTLA, VISTA, KIR, A2aR, or TIM3 and antagonize their function are immune checkpoint inhibitors.
  • the targeting moiety comprises an antibody or antigen-binding fragment that specifically binds to an immune checkpoint molecule. In some embodiments, the targeting moiety comprises an anti-PD-L1 antibody or antigen binding fragment thereof. In some embodiments, the anti-PD-L1 antibody is derived from any anti-PD-L1 antibodies known in the art.
  • anti-PD-L1 antibodies include, but are not limited to, atezolizumab, avelumab, durvalumab (imfinzi) , BGB-A333, SHR-1316 (HTI-1088) , CK-301, BMS-936559, envafolimab (KN035, ASC22) , CS1001, MDX-1105 (BMS-936559) , LY3300054, STI-A1014, FAZ053, CX-072, INCB086550, GNS-1480, CA-170, CK-301, M-7824, HTI-1088 (HTI-131 , SHR-1316) , MSB-2311, AK-106, AVA-004, BBI-801, CA-327, CBA-0710, CBT-502, FPT-155, IKT-201, IKT-703, 10-103, JS-003, KD-033, KY-1003, MCLA-145, MT-5050, SNA-02
  • the antibodies that compete with any of these art-recognized antibodies for binding to PD-L1 also can be used.
  • the anti-PD-L1 antibody is a derivative of any one of the anti-PD-L1 antibodies described herein.
  • the anti-PD-L1 antibody is derived from an antibody selected from the group consisting of durvalumab, atezolizumab, and avelumab.
  • the anti-PD-L1 antibody is derived from durvalumab. In some embodiments, the targeting moiety binds competitively to the same or substantially the same epitope as durvalumab.
  • the anti-PD-L1 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of RYWMS (SEQ ID NO: 86) , a CDR H2 comprising the amino acid sequence of NIKQDGSEKYYVDSVKG (SEQ ID NO: 87) , and a CDR H3 comprising the amino acid sequence of EGGWFGELAFDY (SEQ ID NO: 88) ; and wherein the VL comprises a CDR L1 comprising the amino acid sequence of RASQRVSSSYLA (SEQ ID NO: 89) , a CDR L2 comprising the amino acid sequence of DASSRAT (SEQ ID NO: 90) , and a CDR L3 compris
  • the anti-PD-L1 antibody comprises a heavy chain comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK
  • the anti-PD-L1 antibody is derived from atezolizumab. In some embodiments, the targeting moiety binds competitively to the same or substantially the same epitope as atezolizumab.
  • the anti-PD-L1 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of DSWIH (SEQ ID NO: 94) , a CDR H2 comprising the amino acid sequence of WISPYGGSTYYADSVKG (SEQ ID NO: 95) , and a CDR H3 comprising the amino acid sequence of RHWPGGFDY (SEQ ID NO: 96) ; and wherein the VL comprises a CDR L1 comprising the amino acid sequence of RASQRVSSSYLA (SEQ ID NO: 97) , a CDR L2 comprising the amino acid sequence of DASSRAT (SEQ ID NO: 98) , and a CDR L3 comprising the
  • the anti-PD-L1 antibody comprises a heavy chain comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
  • the targeting moiety comprises a variant of the targeting moieties described herein.
  • a variant of an antibody may comprise one or more modifications of the amino acid sequences of an illustrative antibody ( “parent antibody” ) while conserving the overall molecular structure of the parent antibody amino acid sequence.
  • Amino acid sequences of any regions of the parent antibody chains may be modified, such as framework regions, CDR regions, or constant regions. Types of modifications include substitutions, insertions, deletions, or combinations thereof, of one or more amino acids of the parent antibody.
  • the antibody variant comprises a CDR (e.g., CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, or CDR L3) having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) sequence identity to the corresponding CDR of a parent antibody.
  • the antibody variant comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the VH of a parent antibody.
  • the antibody variant comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the VL of a parent antibody.
  • the antibody variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 additions and/or deletions to an amino acid sequence as set forth in any of the VH, VL, heavy chain or light chain of a parent antibody.
  • the targeting moiety specifically binds to a calcium signal transducer.
  • Intracellular calcium signal transducer is involved in cell signaling, migration, proliferation, and differentiation. It has been shown that intracellular calcium signal transducers have oncogenic potential via its capacity to upregulate various proto-oncogenes and cell cycle-related pathways.
  • the intracellular calcium signal transducer is a tumor-associated calcium signal transducer. Tumor-associated calcium signal transducers are targets for cancer immunotherapy due to their differential expression in multiple types of cancers.
  • the targeting moiety specifically binds to tumor-associated calcium signal transducer 2 (Trop-2) .
  • Trop-2 is also known as trophoblast cell-surface antigen 2, M1S1, GA733-1, EGP-1, or TACSTD2.
  • Trop-2 is a cell surface glycoprotein originally identified in human placental trophoblast and subsequently found to be highly expressed in most human carcinomas, but showed only restricted or limited expression in normal adult tissues. See, e.g., Varughese et al., Gynecologic Oncology, 122: 171-177, 2011. Without being bound by any theory or hypothesis, Trop-2 is involved in several cell signaling pathways, of which many are associated with tumorigenesis. For example, in thyroid cancer cell invasion, Trop-2 signal transduction has been seen as a downstream effect of the ERK and JNK pathways. Stoyanova et al.
  • Trop-2 signaling enhances stem cell-like properties of cancer cells, as Trop-2 regulates proliferation and self-renewal through b-catenin signaling. It has been speculated that phosphatidylinositol 4, 5-bisphosphate (PIP2) may regulate Trop-2 phosphorylation and calcium signal transduction, as the cytoplasmic domain of Trop-2 contains a PIP2-binding sequence overlapping with a protein kinase C phosphorylation site. See, for example, Zaman et al, Onco Targets Ther. 2019; 12: 1781–1790. Trop-2 has been shown to play a role in tumor progression and metastasis. See, for example, Lin et al., EMBO Mol Med.
  • Trop-2 has been shown to be prognostic for cancer recurrence including the prostate cancer. See, for example, Hsu et al., PNAS, 2020; 117 (4) : 2032-2042. Trop-2 has emerged as a promising therapeutic target due to its overexpression in multiple cancers. Sacituzumab govitecan (IMMU-132) , an anti-Trop2 antibody conjugated with SN-38, a cytotoxic agent that targets DNA replication, has shown therapeutic activity in several malignances, including triple negative breast cancer, advanced non-small cell lung cancer, and metastatic platinum-resistant urothelial carcinoma.
  • IMMU-132 an anti-Trop2 antibody conjugated with SN-38
  • a cytotoxic agent that targets DNA replication has shown therapeutic activity in several malignances, including triple negative breast cancer, advanced non-small cell lung cancer, and metastatic platinum-resistant urothelial carcinoma.
  • the targeting moiety comprises an anti-Trop-2 antibody or fragments thereof. In some embodiments, the targeting moiety comprises an anti-Trop-2 scFv. In some embodiments, the targeting moiety comprises an anti-Trop-2 scFab. In some embodiments, the targeting moiety comprises an anti-Trop-2 nanobody.
  • the anti-Trop-2 scFv, scFab, or nanobody may be derived from any anti-Trop-2 antibodies known in the art.
  • Exemplary anti-Trop-2 antibodies include, but are not limited to, hRS7, 162-46.2, MAB650, K5-70, K5-107, K5-116-2-1, T6-16, T5-86, BR110, 3E9, 6G11, 7E6, 15E2, 18B1, 77220, KM4097, KM4590, A1, A3, 162-25.3, and antibodies produced by hybridomas AR47A6.4.2, AR52A301.5, PTA-12871, PTA-12872, PD 08019, PD 08020, and PD 08021, biosimilars thereof, and derivatives thereof.
  • the antibodies that compete with any of these art-recognized antibodies for binding to Trop-2 can also be used.
  • the anti-Trop-2 scFv, scFab, or nanobody is a derivative of any one of the anti-Trop-2 antibodies described herein.
  • the anti-Trop-2 scFv, scFab, or nanobody is derived from a group consisting of hRS7, 162-46.2 and MAB650.
  • the anti-Trop-2 scFv, scFab, or nanobody is derived from hRS7.
  • the anti-Trop-2 antibody is derived from hRS7. See, for example, U.S. Pat. No. 7,238,785.
  • the targeting moiety binds competitively to the same or substantially the same epitope as hRS7.
  • the anti-Trop-2 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of NYGMN (SEQ ID NO: 134) , a CDR H2 comprising the amino acid sequence of WINTYTGEPTYTDDFKG (SEQ ID NO: 135) , and a CDR H3 comprising the amino acid sequence of GGFGSSYWYFDV (SEQ ID NO: 136) ; and wherein the VL comprises a CDR L1 comprising the amino acid sequence of KASQDVSIAVA (SEQ ID NO: 137) , a CDR L2 comprising the amino acid sequence of SASYRYT (SEQ ID NO: 138) , and a CDR L3 comprising the amino acid sequence of QQHYITPLT (SEQ ID NO: 139) .
  • the VH comprises a CDR H1 comprising the amino acid sequence of NYGMN (SEQ ID NO: 134) , a CDR H2 comprising the amino acid
  • the anti-Trop-2 antibody comprises a VH comprising the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS (SEQ ID NO: 140) , and/or a VL comprising the amino acid sequence of DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAA (SEQ ID NO: 141) , DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIK
  • the anti-Trop-2 scFab comprises the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGSGGGGSGGGGGGGGGGGGSDIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAAPSVFIFPPSDEQLKSGTA
  • the anti-Trop-2 scFv comprises the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAA (SEQ ID NO: 131) , DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAA (SEQ ID NO: 131) , DIQLTQSPSS
  • the targeting conjugate comprises one or more effector molecules.
  • Exemplary effector molecules include, but are not limited to, therapeutic agents, oligonucleotides, and detectable labels.
  • the targeting conjugate may comprise a single type of effector molecule, or different types of effector molecules.
  • the targeting conjugate comprises one or more therapeutic agents.
  • the targeting conjugate comprises one or more oligonucleotides.
  • the targeting conjugate comprises one or more detectable labels.
  • the targeting conjugate comprises a therapeutic agent and an oligonucleotide.
  • the targeting conjugate comprises a detectable label and a therapeutic agent.
  • the targeting conjugate comprises a detectable label and an oligonucleotide.
  • the targeting conjugate comprises a first effector molecule and a second effector molecule.
  • the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is at least about any one of 1: 10, 1: 9, 1: 8, 1: 7, 1: 6, 1: 5, 1: 4, 1: 3, 1: 2, 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, or 10: 1.
  • the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is no more than about any one of 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, 1: 1, 1: 2, 1: 3, 1: 4, 1: 5, 1: 6, 1: 7, 1: 8, 1: 9, or 1: 10.
  • the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is about any one of 1: 10 to 10: 1, 1: 9 to about 9: 1, 1: 8 to 8: 1, 1: 7 to 7: 1, 1: 6 to 6: 1, 1: 5 to 5: 1, 1: 4 to 4: 1, 1: 3 to 3: 1, 1: 2 to 2: 1, 1: 10 to 1: 5, 1: 5 to 1: 1, 1: 1 to 5: 1, 5: 1 to or 5: 10.
  • the effector molecule is a therapeutic agent.
  • therapeutic agents include, but are not limited to, drugs, toxins, immunomodulators, hormones, hormone antagonists, enzymes, enzyme inhibitors, radionuclides, angiogenesis inhibitors, chemotherapeutic agent, etc.
  • the therapeutic agent is a small molecule drug.
  • the therapeutic agent is a chemotherapeutic agent.
  • chemotherapeutic agents may be used in accordance with the present embodiments.
  • a “chemotherapeutic agent” refers a compound or composition that is administered in the treatment of cancer. These agents or drugs are categorized by their mode of activity within a cell, for example, whether and at what stage they affect the cell cycle. Alternatively, an agent may be characterized based on its ability to directly cross-link DNA, to intercalate into DNA, or to induce chromosomal and mitotic aberrations by affecting nucleic acid synthesis.
  • chemotherapeutic agents include, but are not limited to, alkylating agents, such as thiotepa and cyclosphosphamide; alkyl sulfonates, such as busulfan, improsulfan, and piposulfan; aziridines, such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines, including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide, and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone) ; a camptothecin (including the synthetic analogue topotecan) ; bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues) ; cryptophycins (particularly cryptophycins
  • the effector molecule is a kinase inhibitor.
  • the group of targeted kinases comprises receptor tyrosine kinases e.g. BCR-ABL, B-Raf, EGFR, HER-2/ErbB2, IGF-IR, PDGFR-a, PDGFR- ⁇ , cKit, Flt-4, Flt3, FGFR1, FGFR3, FGFR4, CSF1R, c-Met, RON, c-Ret, ALK, cytoplasmic tyrosine kinases e.g. c-SRC, c-YES, Abl, JAK-2, serine/threonine kinases e.g.
  • Exemplary small molecule kinase inhibitors include, e.g., PHA-739358, Nilotinib, Dasatinib, and PD166326, NSC 74341 1, Lapatinib (GW-572016) , Canertinib (CI-1033) , Semaxinib (SU5416) , Vatalanib (PTK787/ZK222584) , Sutent (SU1 1248) , Sorafenib (BAY 43-9006) and Leflunomide (SU101) .
  • Zhang et al. 2009 Targeting cancer with small molecule kinase inhibitors. Nature Reviews Cancer 9, 28-39. ”
  • the chemotherapeutic agent is an anti-DNA repair agent.
  • the DNA damage repair and response inhibitor is selected from the group comprising a topoisomerase inhibitor, a PARP inhibitor, a RAD51 inhibitor, and an inhibitor of a DNA damage response kinase selected from CHCK1, ATM, or ATR.
  • the chemotherapeutic agent comprises a topoisomerase inhibitor.
  • the chemotherapeutic agent comprises a topoisomerase I inhibitor, such as camptothecins and related compounds.
  • Topoisomerase I (TOP1) enzymes are essential in higher eukaryotes, as they are required to relax DNA supercoiling generated by transcription, replication and chromatin remodeling.
  • Topoisomerases are particularly vulnerable to topoisomerase I inhibitors during their cleavage reaction, and can be trapped by anticancer drugs as it cleaves DNA.
  • An alkaloid isolated from the Chinese tree Camptotheca acuminate, camptothecin is a natural product of which TOP1 is the only cellular target. Without being bound by any theory or hypothesis, camptothecin and its derivatives function by inhibition of TOP1 activity, resulting in DNA double-strand breaks and cell death. Derivatives of camptothecin have been developed for clinical use.
  • camptothecin derivatives include, but are not limited to, topotecan hydrochloride (Hycamtin) , irinotecan hydrochloride (Camptosar) , SN-38 (the active form of irinotecan) , 9-NC, 9-AC, DE-310, lurtotecan GI-147211 NX 211, gimatecan (ST-1481) , PEG–camptothecin, BNP-1350, DB-67, BN 80915.
  • Two camptothecin derivatives have recently been approved by the FDA: topotecan for ovarian and lung cancers and irinotecan for colorectal cancer. See, for example, Pommier, Nature Reviews Cancer 6, 789–802 (2006) .
  • the therapeutic agent is 7-ethyl-10-hydroxy-20 (S) -camptothecin (SN-38) .
  • SN-38 is the active metabolite of irinotecan, but has 1000 times more activity than irinotecan itself.
  • In vitro cytotoxicity assays show that the potency of SN-38 relative to irinotecan varies from 2-to 2000-fold. Due to its low solubility and ultratoxicity, SN-38 has been developed into drug conjugates for better therapeutic effects. See, for example, U.S. Pat. Nos. 7,999,083 and 8,080,250.
  • SN-38 is conjugated to the targeting moiety at its 10-hydroxyl position.
  • Methods for selective regeneration of the 10-hydroxyl group in the presence of the C-20 carbonate in preparations of drug-linker precursor involving CPT analogs such as SN-38 are known in the art. See, for example, U.S. Pat. No. 10,266,605.
  • SN-38 is conjugated to the targeting conjugate at the 20-hydroxyl position.
  • t-butyldimethylsilyl or t-butyldiphenylsilyl may also be used, and these are deprotected by tetrabutylammonium fluoride prior to linking of the derivatized drug to an antibody-coupling moiety.
  • the 10-hydroxyl group of CPT analogs is alternatively protected as an ester or carbonate.
  • SN-38 is conjugated to the targeting moiety via a linker.
  • the therapeutic agent comprises a mitotic inhibitor.
  • the chemotherapeutic agent comprises a tubulin disrupting agent.
  • Microtubule/tubulin inhibitors can be classified into two major categories according to their mechanisms of action: agents promoting tubulin polymerization and stabilizing microtubule structures (e.g., paclitaxel) and agents inhibiting tubulin polymerization and destabilizing microtubule structures (such as maytansinoids, auristatins, vinblastine and vincristine) . See, for example, Chen et al., Molecules 22: 1281, 2017.
  • Exemplary tubulin-disrupting agents include, but are not limited to, an auristatin, a tubulysin, a colchicine, a vinca alkaloid, a taxane, a cryptophycin, a maytansinoid, a hemiasterlin, and other tubulin disrupting agents.
  • Auristatins are derivatives of the natural product dolastatin.
  • Exemplary auristatins include dolastatin-10, MMAE (N-methylvaline-valine-dolaisoleuine-dolaproine-norephedrine) and MMAF (N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine) , and derivatives thereof.
  • MMAE N-methylvaline-valine-dolaisoleuine-dolaproine-norephedrine
  • MMAF N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine
  • Tubulysins include, but are not limited to, tubulysin D, tubulysin M, tubuphenylalanine, tubutyrosine, and derivatives thereof.
  • Colchicines include, but are not limited to, colchicine, CA-4, and derivatives thereof.
  • Vinca alkaloids include, but are not limited to, Vinblastine (VBL) , vinorelbine (VRL) , vincristine (VCR) , vindesine (VDS) , and derivatives thereof.
  • Taxanes include, but are not limited to, paclitaxel, docetaxel, and derivatives thereof.
  • Cryptophycins include but are not limited to cryptophycin-1, cryptophycin-52, and derivatives thereof.
  • Maytansinoids include, but are not limited to, maytansine, maytansinol, maytansine analogs, DM1, DM3, DM4, ansamatocin-2, and derivatives thereof.
  • Exemplary maytansinoid drug moieties include those having a modified aromatic ring, such as: C-19-dechloro (prepared by lithium aluminum hydride reduction of ansamytocin P2) ; C-20-hydroxy (or C-20-demethyl) +/-C-19-dechloro (U.S. Pat. Nos.
  • Tubulin disrupting agents have been used in antibody drug conjugates for leukemia.
  • Brentuximab vedotin is an antibody-drug conjugate composed of an anti-CD30 monoclonal antibody conjugated by a protease-cleavable linker to the microtubule disrupting agent, monomethyl auristatin E.
  • Brentuximab vedotin has been approved for the treatment of classical Hodgkin lymphoma patients after failure of autologous stem cell transplant (ASCT) or after failure of at least 2 prior multi-agent chemotherapy regimens in patients who are not ASCT candidates, and as consolidation post-ASCT for Hodgkin lymphoma patients at increased risk of relapse/progression.
  • ASCT autologous stem cell transplant
  • the tubulin disrupting agent comprises an auristatin.
  • the therapeutic agent is monomethyl auristatin E (MMAE) .
  • MMAE is a synthetic derivative of dolastatin 10 and functions as a very potent anti-mitotic agent by inhibiting tubulin polymerization. The synthesis and structure of MMAE is described in U.S. Pat. No. 6,884,869 incorporated by reference herein in its entirety.
  • the therapeutic agent further comprises a drug linker.
  • the drug linker is conjugated to the therapeutic agent via a cleavable linker.
  • the drug linker is conjugated to the therapeutic agent via a non-cleavable linker.
  • the linker is an amine donor group linker.
  • the linker is a non-cleavable linker. Suitable non-cleavable linkers include, but are not limited to, NH 2 -R-X, NH 2 NH-R-X, and NH 2 -O-R-X, wherein R is alkyl or polyethylene glycol group (also referred to as PEG) , wherein X is the active moiety.
  • a polyethylene glycol group or PEG group may have a formula of - (CH 2 CH 2 O) n -, wherein n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) .
  • the linker is a cleavable linker.
  • Suitable cleavable linkers include, but are not limited to, Lys-Phe-X, Lys-Val-Cit-PAB-X, NH 2 - (CH 2 CH 2 O) n -Val-Cit-PAB-X, and NH 2 - (CH 2 CH 2 O) n - (Val-Cit-PAB-X) 2 , wherein X is the active moiety, and n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) .
  • PAB refers to p-aminobenzyloxycarbonyl.
  • Cit refers to citrulline.
  • exemplary amine donor group-linkers include, but are not limited to, Ac-Lys-Gly, aminocaproic acid, Ac-Lys-beta -Ala, amino-PEG 2 (Polyethylene Glycol) -C2, amino-PEG 3 -C2, amino-PEG 6 -C2, Ac-Lys-Val (valine) -Cit (citrulline) -PAB (p-aminobenzyloxycarbonyl) , aminocaproyl-Val-Cit-PAB, putrescine, and Ac-Lys-putrescine.
  • the linker is R- (PEG) m -VC-PAB- (DMAE) k (Formula II) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the linker is represented by R- (PEG) m -P-PAB- (DMAE) k (Formula III) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m ⁇ 0, and k is 0 or 1, P is a cleavage site.
  • the linker is branched. In some embodiments, the linker is linear. In some embodiments, the linker has more than one (such as 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) attachment sites for the attachment of effector molecules. These effector molecules can be the same or different from each other.
  • the effector molecule is MC-VC-PAB-DMAE-phenol linked SN38, shown as compound of Formula (1) below, wherein the linker is connected to position 10 of SN38:
  • the effector molecule is MC-VC-PAB-DMAE- ⁇ -hydroxy lactone linked SN38, shown as compound of Formula (2) below, wherein the linker is connected to position 20 of SN38:
  • the effector molecule is MC-VC-PAB-MMAE, shown as compound of Formula (3) below, wherein the linker is connected to MMAE:
  • the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-DMAE-phenol linked SN38, shown as compound of Formula (4) below:
  • Compound of Formula 4 contains a linker that can be cleaved by uPA.
  • the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-DMAE- ⁇ -hydroxy lactone linked SN38, shown as compound of Formula (5) below:
  • Compound of Formula 5 contains a linker that can be cleaved by uPA.
  • the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-MMAE, shown as compound of Formula (6) below:
  • Compound of Formula 6 contains a linker that can be cleaved by uPA.
  • the targeting conjugate comprises about 1-80 effector molecules conjugated to the targeting moiety. In some embodiments, the targeting conjugate comprises about any one of 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, 2-4, 2-5, 2-6, 2-7, 2-8, 2-9, 2-10, 3-5, 3-6, 3-7, 3-8, 3-9, 3-10, 4-10, 5-10, 10-20, 1-20, 10-20, 20-40, or 40-80 effector molecules conjugated to the targeting moiety. In some embodiments, the targeting conjugate comprises at least about any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, or 80 effector molecules. In some embodiments, the targeting conjugate comprises no more than about any one of 80, 70, 60, 50, 40, 30, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 effector molecules.
  • the effector molecule is an oligonucleotides.
  • the oligonucleotide is at least about any one of 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 150, 200 or more nucleotides or base pairs long. In some embodiments, the oligonucleotide is no more than about any one of 200, 150, 120, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 5 or 2 nucleotides or base pairs long.
  • the oligonucleotide is about any one of 2-10, 5-10, 10-20, 10-40, 10-60, 10-80, 10-100, 100-150, 150-200, 20-40, 40-80, 80-100, 100-200, 10-150, 10-200, 2-20, 2-50, or 2-100 nucleotides or base pairs long.
  • the oligonucleotide is a DNA. In some embodiments, the oligonucleotide is a double-stranded DNA. In some embodiments, the oligonucleotide is a single-stranded DNA. In some embodiments, the oligonucleotide is a synthetic DNA.
  • the oligonucleotide is an RNA.
  • RNAs includes, but are not limited to single-stranded RNA (ssRNA) , double-stranded RNA (dsRNA) , small interfering RNA (siRNA) , small hairpin RNA (shRNA) , or micro RNA.
  • ssRNA single-stranded RNA
  • dsRNA double-stranded RNA
  • siRNA small interfering RNA
  • shRNA small hairpin RNA
  • micro RNA micro RNA.
  • the oligonucleotide is a synthetic RNA.
  • the oligonucleotide is an immunomodulating polynucleotide.
  • the oligonucleotide is a pathogen-associated molecular pattern (PAMP) or other motif that can activate immune cells.
  • PAMPs are molecules associated with various pathogens and are recognized by toll-like receptors (TLRs) and other pattern recognition receptors (PRRs) activating innate immune responses.
  • TLRs toll-like receptors
  • PRRs pattern recognition receptors
  • CpG oligodeoxynucleotides e.g., agatolimod
  • pDCs plasmacytoid dendritic cells
  • Exemplary PAMPs include, but are not limited to, CpG oligodeoxynucleotides (CpG-ODNs) , herpes simplex virus (HSY) DNA, dsRNA, ssRNA. Further, the oligonucleotide may include one or more nucleic acid sequences that silence gene expression or induce intracellular death signaling, including, but not limited to, dsRNA, siRNA, shRNA, or micro RNA.
  • the oligonucleotide is selected from the group consisting of: GpT, GpG, GpA, ApA, ApT, ApG, CpT, CpA, CpG, TpA, TpT, and TpG oligonucleotides.
  • the oligonucleotide is a CpG ODN.
  • CpG ODNs are short single-stranded synthetic DNA molecules that contain a cytosine triphosphate deoxynucleotide ( "C” ) followed by a guanine triphosphate deoxynucleotide ( "G” ) .
  • the "p” refers to the phosphodiester link between consecutive nucleotides.
  • the CpG ODN has a modified phosphorothioate (PS) backbone, e.g., all nucleotides or a portion of the nucleotides in the CpG ODN has a PS backbone.
  • PS modified phosphorothioate
  • CpG motifs When CpG motifs are unmethylated, they act as immunostimulants. CpG motifs are considered pathogen-associated molecular patterns (PAMPs) due to their abundance in microbial genomes but their rarity in vertebrate genomes. CpG-ODNs bind to and activate Toll-like receptor 9 (TLR9) , initiating an innate immune response that supports the subsequent development of adaptive immunity. CpG-ODNs have been used as vaccine adjuvants to obtain desired immune modulation and synergistic immune response. CpG ODNs are generally divided into three classes: class A, class B, and class C.
  • PAMPs pathogen-associated molecular patterns
  • TLR9 Toll-like receptor 9
  • Class A CpG-ODNs typically contain poly-G tails with phosphorothioate backbones at 3’-and 5’-termini and a central palindromic sequence including a phosphate backbone.
  • Class A CpG ODNs typically contain CpG within the central palindrome sequence.
  • Class B CpG-ODNs typically include fully phosphorothioate backbone, and the sequence at the 5’ end of class B CpG ODN is often critical for TLR9 activation.
  • Class C CpG-ODNs include fully phosphorothioate backbone with a 3’-end sequence enabling formation of a duplex.
  • the CpG-ODN is methylated.
  • the CpG-ODN is unmethylated.
  • the targeting moiety is conjugated to an oligonucleotide comprising a CpG motif. In some embodiments, the targeting moiety is conjugated to an oligonucleotide comprising a plurality of CpG motifs. In some embodiments, the targeting moiety is conjugated to an oligonucleotide comprising multiple repeats of a CpG motif having the same sequence. In some embodiments, the targeting moiety is conjugated to multiple CpG-ODNs having different sequences.
  • the CpG-ODN may exhibit stability (e.g., stability against nucleases) that is superior to that of CpG-ODNs containing mostly internucleoside phosphate (e.g., more than 50%of internucleoside phosphates) without substantially sacrificing their immunostimulating activity.
  • This effect can be achieved, e.g., by incorporating at least 50% (e.g., at least 70%) internucleoside phosphorothioates or phosphorodithioates or through the inclusion of internucleoside phosphotriesters and/or internucleoside abasic spacers.
  • Phosphotriesters and abasic spacers are also convenient for conjugation to a targeting moiety.
  • an oligonucleotide can include about 15 or fewer contiguous internucleoside phosphorothioates (e.g., about 14 or fewer, about 13 or fewer, about 12 or fewer, about 11 or fewer, or about 10 or fewer contiguous internucleoside phosphorothioates) .
  • a CpG-ODN containing a total of from about 12 to about 16 nucleosides may contain about 10 or fewer contiguous internucleoside phosphorothioates.
  • the CpG ODN comprises one or more phosphorothioates (e.g., from about 1 to about 6 or from about 1 to about 4) , e.g., at one or both termini (e.g., within the six 5’-terminal nucleosides or the six 3’-terminal nucleosides) .
  • the inclusion of one or more internucleoside phosphotriesters and/or phosphorothioates can enhance the stability of the polynucleotide by reducing the rate of exonuclease-mediated degradation.
  • the CpG ODN further comprises one or more (e.g., from 1 to 6, from 1 to 12, from 1 to 18, from 1 to 24) auxiliary moieties (e.g., polyethylene glycols (PEGs) ) .
  • the auxiliary moiety may be a part of a capping group, bioreversible group, or non-bioreversible group.
  • the auxiliary moieties may be bonded to the linkers (e.g., to the linkers bonded to phosphates, phosphorothioates, or phosphorodithioates in the immunomodulating (e.g., immunostimulating) polynucleotides) .
  • auxiliary moieties e.g., PEGs
  • the CpG oligonucleotide is linked to a cleavable linker.
  • the CpG oligonucleotide comprises a nucleic acid sequence selected from the group consisting of:
  • the oligonucleotide is conjugated to a conjugation site in the target moiety binding fragment (TBF) via a linker.
  • the oligonucleotide comprises a linker, such as a chemical linker or a peptide linker.
  • the linker is selected from the group consisting of SH 2 -Spacer, MAL-Spacer, NH 2 -Spacer, and Osu-Spacer.
  • the linker is a poly-PEG linker.
  • the oligonucleotide is conjugated covalently to the TBF or the targeting moiety without a linker.
  • the effector molecule is a detectable label.
  • a label is a moiety that facilitates detection of the targeting moiety and/or facilitates detection of a molecule to which the targeting moiety binds.
  • Nonlimiting exemplary labels include, but are not limited to, radioisotopes, fluorescent groups, enzymatic groups, chemiluminescent groups, biotin, epitope tags, metal-binding tags, etc.
  • radioisotopes include, but are not limited to, radioisotopes, fluorescent groups, enzymatic groups, chemiluminescent groups, biotin, epitope tags, metal-binding tags, etc.
  • One skilled in the art can select a suitable label according to the intended application.
  • the label may be a radionuclide, a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent label, a chemiluminescent label, an ultrasound contrast agent and a photoactive agent.
  • diagnostic labels are well known and any such known labels may be used.
  • the detectable label is a radionuclide.
  • Radionuclides are often referred to as “radioactive isotopes” or “radioisotopes. ”
  • Exemplary radionuclides or stable isotopes that may be attached to the targeting moieties described herein include, but are not limited to, 110 In, 111 In, 177 Lu, 18 F, 52 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 86 Y, 90 Y, 89 Zr, 94m Tc, 94 Tc, 99m Tc, 120 I, 123 I, 124 I, 125 I, 131 I, 154-158 Gd, 32 P, 11 C, 13 N, 15 O, 186 Re, 188 Re, 51 Mn, 52m Mn, 55 Co, 72 As, 75 Br, 76 Br, 82m Rb, 83 Sr, or other gamma-, beta-, or positron-emitters.
  • Paramagnetic ions of use may include chromium (III) , manganese (II) , iron (III) , iron (II) , cobalt (II) , nickel (II) , copper (II) , neodymium (III) , samarium (III) , ytterbium (III) , gadolinium (III) , vanadium (II) , terbium (III) , dysprosium (III) , holmium (III) or erbium (III) .
  • Metal contrast agents may include lanthanum (III) , gold (III) , lead (II) or bismuth (III) .
  • Radiopaque diagnostic agents may be selected from compounds, barium compounds, gallium compounds, and thallium compounds.
  • fluorescent labels are known in the art, including but not limited to fluorescein isothiocyanate, rhodamine, phycoe1ytherin, phycocyanin, allophycocyanin, ophthaldehyde and fluorescamine.
  • Chemiluminescent labels of use may include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt or an oxalate ester.
  • the effector molecule comprises a chelating compound that chelates the radionuclide.
  • the chelating compound chelates a radioactive metal.
  • the chelating compound chelates a metal 18 F.
  • the chelating compound is a hydrophilic chelating compound, which can bind metal ions and help to ensure rapid in vivo clearance.
  • Particularly useful metal-chelating compound combinations include 2-benzyl-DTPA (diethylenetriamine pentaacetic acid) and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes in the general energy range of 60 to 4,000 keV, such as 125 I, 131 I, 123 I, 124 I , 62 Cu, 64 Cu, 18 F, 111 In, 67 Ga, 68 Ga, 99 Tc, 94 Tc, 11 C, 13 N, 15 O, 76 Br, for radio-imaging.
  • the same chelating compounds, when complexed with nonradioactive metals, such as manganese, iron and gadolinium are useful for MRI.
  • Macrocyclic chelating compounds such as NOTA (1, 4, 7-triazacyclononane-1, 4, 7-triacetic acid) , DOTA (1, 4, 7, 10-Tetraazacyclododecane-N, N', N”, N”'-tetraacetic acid) , TETA (bromoacetamido-benzyl-tetraethylaminetetraacetic acid) and NETA ( ⁇ 4- [2- (bis-carboxymethyl-amino) -ethyl] -7-carboxymethyl- [1, 4, 7] triazonan-1-yl ⁇ -acetic acid) are of use with a variety of diagnostic radiometals, such as gallium, yttrium and copper. Such metal-chelating complexes can be made very stable by tailoring the ring size to the metal of interest.
  • the chelating compound comprises a functional group that can be conjugated to the targeting moiety.
  • the chelating compound comprises a functional group that is reactive with a primary amine (-NH 2 ) group in the targeting moiety.
  • exemplary functional groups that can be conjugated to a primary amine, e.g., a lysine side chain, of the targeting moiety include, but are not limited to, isothiocyanates, isocyanates, acyl azides, N-hydroxysuccinimide (NHS) esters, sulfonyl chlorides, aldehydes, glyoxals, epoxides, oxiranes, carbonates, aryl halides, imidoesters, carbodiimides, anhydrides, and fluorophenyl esters. Most of these functional groups conjugate to amines by either acylation or alkylation.
  • the chelating compound comprises a functional group that is reactive with a cysteine side chain (i.e., sulfhydryl group) in the targeting moiety.
  • sulfhydryl reactive groups include, but are not limited to, haloacetyls, maleimides, aziridines, acryloyls, arylating agents, vinylsulfones, pyridyl disulfides, TNB-thiols and disulfide reducing agents. Most of these groups conjugate to sulfhydryls by either alkylation (usually the formation of a thioether bond) or disulfide exchange (formation of a disulfide bond)
  • TFF Target moiety binding fragment
  • the TBF comprises a targeting moiety binding peptide (TBP) that specifically binds to the targeting moiety.
  • TBP targeting moiety binding peptide
  • the targeting moiety binding peptide (TBP) may be obtained by screening a peptide library for specific binding to a targeting moiety of interest.
  • the TBF consists of or consists essentially of the TBP.
  • the TBF is a TBP.
  • the TBP allows non-covalent conjugation of the TBF to the targeting moiety.
  • the TBF in addition to the TBP, the TBF comprises one or more additional chemical moieties.
  • the TBF comprises a chemical reactive moiety that can be conjugated to the targeting moiety.
  • the TBF comprises a small molecule linker comprising the chemical reactive moiety.
  • the chemical reactive moiety allows covalent conjugation of the TBF to the targeting moiety.
  • Non-covalent binding of the TBP in the TBF to the targeting moiety may facilitate covalent conjugation of the TBF to the targeting moiety.
  • the TBF comprises one or more TBPs.
  • the targeting moiety binding fragment is an antibody binding fragment (ABF) .
  • the targeting conjugate comprises one or more ABFs that bind to a heavy chain of an antibody.
  • the ABF further comprises a chemically reactive moiety that can be covalently conjugated to the antibody or antigen binding fragment thereof.
  • the ABF does not comprise a chemically reactive moiety that can be conjugated to the antibody or antigen binding fragment thereof.
  • the ABF consists of or consists essentially of an ABP.
  • the ABF is an ABP.
  • the targeting conjugate comprises one or more ABPs that bind to the Fc region of an antibody ( “an FcBP” ) .
  • FcBPs are a subset of immunoglobulin binding proteins that interact with the Fc region via non-immune binding. Some of the best studies examples of FcBPs include SpA and Protein G (See, Goward et al., 1993; Bjorck et al., 1984, Reis et al., 1984) .
  • Fc binding proteins include, but are not limited to, Protein G from group C and group G streptococci (Derrick, 1992; Bjorck, 1984; Reis et al., 1984) ; ⁇ protein and M or M like family FcBPs such as Protein H, Arp4, Arp 60, Mrp4, Sir22, Enn4, FgBP (Kazeeval & Shevelev, 2009; Pleass et al., 2001; O'Toole et al., 1992; Heden et al., 1991; Jerlstro et al., 1991; Lewis et al., 2008; Meehan et al., 2001) ; SibA from GAS (Fagan et al., 1991) ; SpA from S.
  • Protein G from group C and group G streptococci
  • ⁇ protein and M or M like family FcBPs such as Protein H, Arp4, Arp 60, Mrp4, Sir22, Enn4, FgBP (Kazeeval
  • Fc-binding polypeptide may non-covalently interact with an antibody, which results in a complex that leaves the Fab (fragment, antigen-binding) moieties free from any potentially deleterious drug conjugation/interaction effects that could reduce the antibody’s affinity towards its antigen.
  • Fc-binding peptides also allow the number of drug molecules or oligonucleotides conjugated to the antibody to be strictly controlled.
  • an Fc-binding peptide is covalently conjugated to a targeting moiety comprising an Fc region.
  • the TBP is selected from the group consisting of FcBP-1, Fc-BP-2, and Fc-III.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHLGELVWCT (SEQ ID NO: 75) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 75.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHKGELVWCT (SEQ ID NO: 76) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 76.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in NCAWHKGQLVWCT (SEQ ID NO: 77) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 77.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSKGSDCAWHLGELVWCT (SEQ ID NO: 78) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 78.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSKGSNCAWHLGQLVWCT (SEQ ID NO: 79) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 79.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHLGQLVWCT (SEQ ID NO: 152) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 152.
  • the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSCGSDCAWHLGELVWCT (SEQ ID NO: 156) .
  • the TBF comprises the amino acid sequence of SEQ ID NO: 156.
  • the TBF described herein is conjugated to the target binding moiety (e.g., an Fc region in an antibody or antigen-binding fragment thereof) .
  • the TBF is conjugated to the targeting moiety covalently via a chemical reactive moiety.
  • the chemical reactive moiety may be present at the N-terminus, the C-terminus or at an internal position (e.g., a side chain of an amino acid residue) in the TBF.
  • the C-terminus of the TBF is chemically modified to comprise a reactive group.
  • the N-terminus of the TBF is chemically modified to comprise a reactive group.
  • the TBF is conjugated to the target binding moiety covalently via a bifunctional linker.
  • the targeting moiety binding fragment is covalently conjugated to an amine group in the targeting moiety.
  • the amine group is in the Fc region of an antibody or an antigen-binding fragment thereof.
  • Antibody-targeting polypeptide chemical conjugation has been described, for example, in Kishimoto et al, Bioconjugate Chem. 2019, 30, 3, 698–702; Dias et al., JACS 2006, 126, 2726-2732; and U.S. Patent 10227383.
  • the TBP described herein is conjugated to the Fc-region of the antibody non-covalently.
  • the TBF is conjugated to the antibody via charge-charge interaction.
  • the TBF is cationic under physiological pH.
  • the TBF is neutral under physiological pH.
  • the targeting conjugate comprises one or more targeting moiety binding fragments (TBF) , which are conjugated to the effector molecule (s) .
  • TBF targeting moiety binding fragments
  • an effector molecule may be conjugated to the targeting moiety via a conjugation site in or linked to the targeting moiety binding fragment (TBF) .
  • the effector molecule is conjugated covalently to an endogenous conjugation site in the TBF.
  • the effector molecule is conjugated to a conjugation site introduced to the TBF, e.g., fused to the TBF.
  • the conjugation may be covalent or non-covalent.
  • the TBF is linked to an oligonucleotide binding peptide via a cleavable linker. In some embodiments, the TBF is linked to an oligonucleotide binding peptide directly or via a non-cleavable linker.
  • the oligonucleotide binding peptide serves as a conjugation site for the oligonucleotide.
  • the TBF is linked to a therapeutic agent via a cleavable linker. In some embodiments, the TBF is linked to a therapeutic agent via a non-cleavable linker.
  • the targeting conjugate comprises a moiety of formula: TBF-R- (PEG) m -VC-PAB- (DMAE) k -Drug (Formula V) , wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the targeting conjugate comprises a moiety of formula: TBF-R- (PEG) m -P-PAB- (DMAE) k -Drug (Formula VI) , wherein R is an amine-reactive or sulfhydryl-reactive group, P is a cleavage site, Drug is a therapeutic agent, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the targeting conjugate comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in DCAWHLGELVWCT- (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 74) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 74.
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in DCAWHLGQLVWCT- (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 80) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 80.
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSKGSDCAWHLGELVWCT- (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 81) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 81
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSCGSDCAWHLGELVWCT- (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 82) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 82. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSDGSNCAWHLGQLVWCT- (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 83) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 83. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSKGSDCAWHLGELVWCT- (PEG) 12 -LGGSGRNAQVRLEGSGRSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 148) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 148. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSCGSDCAWHLGELVWCT- (PEG) 12 -LGGSGRNAQVRLEGSGRSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 149) .
  • the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 149. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSDGSNCAWHLGQLVWCT- (PEG) 12 -LGGSGRNAQVRLERSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 150) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 150.
  • targeting conjugates comprising a targeting moiety conjugated to an effector molecule via a targeting moiety binding fragment, wherein the targeting moiety binding fragment comprises a sequence selected from at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  • a targeting conjugate comprising a targeting moiety, an oligonucleotide, and a TBF, wherein the oligonucleotide is conjugated to the targeting moiety via the TBF, and wherein the targeting moiety comprises an sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  • the TBF comprises a crosslinker.
  • the crosslinker is selected from the group consisting of disuccinimidyl glutarate (DSG) , disuccinimidyl suberate (DSS) , Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate (SMCC) , Maleimide-amido-PEG n -TFP (TFP: tetrafluorophenyl) , and Maleimide-PEG n -DBCO (DBCO: dibenzocyclooctyne) , wherein n is an integer of 1-12, such as 2 and 4.
  • the targeting conjugate comprises a structure represented by a formula selected from the group consisting of Formulae (13) - (26) . See, Example 5.
  • the targeting moiety is an antibody moiety.
  • the TBF further comprises a crosslinker conjugation site.
  • the crosslinker conjugation site is an amine conjugation site.
  • the targeting moiety may comprise binding sites for a plurality of TBFs, thereby allowing conjugation of multiple effector molecules.
  • the plurality of TBFs are the same. In some embodiments, the plurality of TBFs are different.
  • the targeting conjugate comprises one or more conjugation sites.
  • the conjugation site allows covalent or non-covalent attachment of the effector molecule to the targeting moiety binding fragment (TBF) .
  • TBF targeting moiety binding fragment
  • the conjugation site may be part of the TBP or present in a chemical moiety introduced to the TBF.
  • the targeting moiety comprises one or more conjugation sites that are conjugated to effector molecules.
  • the conjugation sites may comprise one or more reactive groups for covalent conjugation.
  • Common reactive groups in proteins include primary amines (–NH 2 ) , carboxyls (–COOH) , sulfhydryls (–SH) and carbonyls (–CHO, which can be created by oxidizing carbohydrate groups in glycoproteins) .
  • the conjugation site is within a polypeptide chain of the targeting moiety. In some embodiments, the conjugation site is at the side chain of an amino acid residue of the targeting moiety. In some embodiments, the conjugation site is at the N-terminus of a polypeptide chain of the targeting moiety. In some embodiments, the conjugation site is at the C-terminus of a polypeptide chain of the targeting moiety.
  • the conjugation site is an endogenous conjugation site on the targeting moiety.
  • the conjugation site is an engineered conjugation site introduced into the targeting moiety.
  • the conjugation site may be present in a peptide, such as a tag, fused to the targeting moiety.
  • the conjugation site comprises a reactive thiol group, e.g., a cysteine residue of the targeting moiety.
  • the conjugation site comprises a reactive amine group ( “amine conjugation site” ) , e.g., a lysine or arginine residue of the targeting moiety.
  • amine conjugation site e.g., a lysine or arginine residue of the targeting moiety.
  • Primary amines exist at the N-terminus of each polypeptide chain and in the side chain of lysine and arginine (Lys, K) residues. These primary amines are positively charged at physiologic pH; therefore, they occur predominantly on the outside surfaces of native protein tertiary structures where they are readily accessible to conjugation reagents introduced into the aqueous medium.
  • primary amines are especially nucleophilic; this makes them easy to target for conjugation with several reactive groups.
  • a sulfhydryl group can be introduced at the site of primary amines –especially those of lysine residues-by modification with reagents such as Traut's reagent (2-iminothiolane) , MBS, SPDP, SATA, and their derivatives.
  • the effector molecule is conjugated to an amine conjugation site in the targeting moiety. In some embodiments, the effector molecule is conjugated to the targeting moiety binding fragment (TBF) via an amine conjugation site in the TBF.
  • TBF targeting moiety binding fragment
  • a single effector molecule is conjugated to a conjugation site.
  • two or more effector molecules are conjugated to a conjugation site.
  • the targeting conjugate comprises a plurality of conjugation sites, e.g., 2, 3, 4, 5, 6, or more conjugation sites, in tandem arrangement for conjugation of a plurality of effector molecules.
  • the TBF is conjugated to the targeting moiety via an amine conjugation site in the TBF and a crosslinker.
  • the crosslinker reacts with a free amine in the TBF.
  • the crosslinker reacts with a free amine in the targeting moiety.
  • the crosslinker reacts with an amine group in a lysine residue.
  • the crosslinker is a homobifunctional crosslinker.
  • homobifunctional crosslinkers include, but are not limited to, DSG (disuccinimidyl glutarate) , DSS (disuccinimidyl suberate) .
  • the crosslinker is a heterobifunctional crosslinker.
  • heterobifunctional crosslinkers include, but are not limited to, SMCC (succinimidyl 4- [N-Maleimidomethyl] cyclohexane-1-carboxylate) , maleimide-amido-PEG n -TFP, maleimide-PEG n -DBCO, where n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) .
  • an oligonucleotide is conjugated non-covalently to the targeting moiety via an oligonucleotide binding polypeptide (OBP) introduced to the targeting moiety.
  • OBP oligonucleotide binding polypeptide
  • an oligonucleotide is conjugated non-covalently to the targeting moiety binding fragment (TBF) via an oligonucleotide binding polypeptide introduced to the TBF.
  • TBF targeting moiety binding fragment
  • CBP CpG binding polypeptide
  • the oligonucleotide is conjugated to the oligonucleotide binding polypeptide through charge-charge interactions.
  • the oligonucleotide binding polypeptide is a cationic peptide.
  • the oligonucleotide binding polypeptide is a neutrally charged peptide.
  • nucleic acid binding proteins use short peptide sequences to provide specificity in recognizing their targets, which may either have a specific sequence or a specific conformation.
  • Peptides containing alternating lysine have been shown to bind to poly (dG–d5meC) in the Z conformation, and stabilize the higher energy form. See, for example, H. Takeuchi et al., (1991) FEBS Lett., 279, 253–255 and H. Takeuchi et al., (1994) J. Mol. Biol., 236, 610–617.
  • the CpG binding polypeptide is positively charged. In some embodiments, the CpG binding polypeptide comprises one or more positively charged amino acid residues. In some embodiments, the CpG binding polypeptide comprises polar amino acid residues. In some embodiments, the CpG binding polypeptide comprises short motifs comprising multiple positively charged amino acid residues. In some embodiments, the short motif comprises tandem positively charged amino acid residues. In some embodiments, the CpG binding peptide further comprises modifications at the N terminus. In some embodiments, the CpG binding peptide comprises an aminobenzoic acid at the N terminus.
  • the CpG binding polypeptide is selected from the group consisting of RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 56) ; RRRLHRIHRRQHRSCRRRKRR (SEQ ID NO: 57) ; MPRRRRSSSRPVRRRRRPRVSRRRRRRGGRRRR (SEQ ID NO: 58) ; KKSAKKTPKKAKKPKKSAKKTPKKAKKP (SEQ ID NO: 59) ; AKKAKSPKKAKAAKPKKAPKSPAKAK (SEQ ID NO: 60) ; MRRAHHRRRRASHRRMRGG (SEQ ID NO: 61) ; KHKHKHKHKKKHKHKHKHKHKHKHKHKK (SEQ ID NO: 62) ; KGKGKGKKKGKGKGKGKGKGKGKGKGKK (SEQ ID NO: 63) ; KKALLALALHHLAHLALHLALALKKA (SEQ ID NO: 64) ; and YSPTSPSYS
  • CpG binding polypeptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65.
  • a targeting conjugate comprising a targeting moiety, a CpG oligonucleotide, and a CpG binding polypeptide, wherein the CpG oligonucleotide is conjugated to the targeting moiety via the CpG binding polypeptides, and wherein the CpG binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65.
  • the CpG binding polypeptide is fused to the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to the N terminus of one or more of the polypeptide chains of the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to the C terminus of one or more of the polypeptide chains of the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to an internal position of one or more of the polypeptide chains of the targeting moiety.
  • the CpG binding polypeptide is fused to the C terminus of a heavy chain of the antibody or antigen-binding fragment, e.g., via a single peptide bond or a linker. In some embodiments, wherein the targeting moiety is an antibody or antigen-binding fragment, the CpG binding polypeptide is fused to the C terminus of a light chain of the antibody or antigen-binding fragment, e.g., via a single peptide bond or a peptide linker.
  • the targeting conjugate comprises one or more cleavage sites. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the targeting moiety. In some embodiments, the targeting moiety does not comprise one or more cleavage sites. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the effector molecule. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the oligonucleotide binding polypeptide. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the targeting moiety binding fragment (TBF) . In some embodiments, the targeting conjugate comprises one or more cleavage sites disposed between the TBF and the conjugation site for conjugation of the effector molecule.
  • TBF targeting moiety binding fragment
  • the one or more cleavage sites in the targeting conjugate are cleaved at a target site, e.g., a diseased site.
  • the cleavage is triggered by a condition at the target site, such as a protease, a change in pH, redox level, hypoxia, oxidative stress, hyperthermia, and/or extracellular ATP concentration.
  • the one or more cleavage sites in the targeting conjugate are not cleaved at a non-target site, such as in normal or healthy tissues.
  • the condition that triggers cleavage of the cleavage site at the target site is not found at non-target sites.
  • the condition that triggers cleavage of the cleavage site is present at the target site at a level that is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the condition at non-target sites.
  • a protease e.g., uPA
  • cleaves the cleavage site is present at a target site at a concentration that is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the concentration of the protease at non-target sites.
  • the extracellular ATP concentration at a target site is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the extracellular ATP concentration at non-target sites.
  • the pH at a target site is at least about any one of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, or 3 lower than the pH at non-target sites.
  • the pH at a target site is at least about any one of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, or 3 higher than the pH at non-target sites.
  • the one or more cleavage sites are cleaved under the same condition. In some embodiments, the one or more cleavage sites are cleaved under different conditions.
  • the cleavage site is a protease cleavage site.
  • the cleavage site is cleavable by a disease-specific protease, such as a tumor-specific protease.
  • the tumor-specific protease express at elevated levels in diseased tissues, such as tumor tissues, compared to normal tissues. For example, studies have shown that tumor tissues exhibit increased activity of specific proteases and decreased activity of the opposing endogenous inhibitors (Sevenich L and Joyce JA. Genes & Dev. 2014. 28: 2331-2347. 2014) .
  • tumor-specific protease is selected from the group consisting of matriptase (MTSP1) , urinary-type plasminogen activator (uPA) , legumain, PSA (also called KLK3, kallikrein-related peptidase-3) , matrix metalloproteinase-2 (MMP-2) , matrix metalloproteinase-9 (MMP9) , human neutrophil elastase (HNE) , proteinase 3 (Pr3) , cathepsin B and cathepsin K.
  • MTSP1 matriptase
  • uPA urinary-type plasminogen activator
  • PSA also called KLK3, kallikrein-related peptidase-3
  • MMP-2 matrix metalloproteinase-2
  • MMP9 matrix metalloproteinase-9
  • HNE human neutrophil elastase
  • Pr3 proteinase 3
  • the cleavage site is a substrate for an enzyme selected from the group consisting of legumain, plasmin, TMPRSS-3/4, MMP-9, MTl-MMP, cathepsin, caspase, human neutrophil elastase, beta-betasecretase, uPA, and PSA.
  • the cleavage site is a uPA substrate peptide.
  • Urokinase plasminogen activator uPA is a serine protease that is part of the urokinase plasminogen activating system (uPAS) .
  • the uPA converts the proenzyme plasminogen in the serine protease plasmin, involved in a number of physiopathological processes requiring basement membrane (BM) and/or extracellular matrix (ECM) remodeling, including tumor progression and metastasis.
  • BM basement membrane
  • ECM extracellular matrix
  • the uPA cleavage site comprises an amino acid sequence selected from the group consisting of LSGRSDNH (SEQ ID NO: 50) , SGRSA (SEQ ID NO: 51) , LGGSGRSANAILE (SEQ ID NO: 52) , LGGSGRNAQVRLE (SEQ ID NO: 53) , GSGRNAQV (SEQ ID NO: 54) , and SGR (SEQ ID NO: 55) .
  • uPA cleavage peptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50-55.
  • the targeting conjugate comprises a single peptide substrate cleavable by a disease-specific protease, such as uPA, e.g., any one of SEQ ID NOs: 50-55.
  • the targeting conjugate comprises two or more copies (such as any one of 2, 3, 4, 5, or more) of a peptide substrate cleavable by a disease-specific protease.
  • the targeting conjugate comprises a peptide substrate that can be cleaved by more than one (e.g., any of 2, 3, 4, or more) disease-specific proteases.
  • the targeting conjugate comprises two or more (e.g., any of 2, 3, 4, or more) peptide substrates cleavable by one or more (e.g., any of 2, 3, 4, or more) disease-specific proteases.
  • Any one of the protease peptide substrate sequences disclosed herein e.g., SEQ ID NOs: 50-55
  • SEQ ID NOs: 50-55 can be mixed and matched to provide a disease-sensing releasable moiety with optimal mechanism and dynamics for release of the effector molecule (s) and oligonucleotide (s) at a target (e.g., disease) site.
  • the different protease substrate sequences or copies thereof can be fused to each other via peptide linkers to provide suitable cleavage sites.
  • a targeting conjugate comprising: a targeting moiety, one or more effector molecules conjugated to the targeting moiety via a targeting moiety binding fragment (TBF) .
  • TBF targeting moiety binding fragment
  • each effector molecule is conjugated to the TBF via a conjugation site.
  • each effector molecule is linked to the conjugation site via one or more linkers.
  • the effector molecule is conjugated to the TBF via one or more protease cleavage sites.
  • the targeting moiety comprises two or more polypeptide chains.
  • the targeting moiety comprises a protease cleavage site.
  • the targeting conjugate has the structure of Formula I.
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first effector molecule (e.g., a small molecule drug) comprising a first linker; (F) a second effector molecule (e.g., a small molecule drug) comprising a second linker; (G) a first antibody binding fragment comprising a first protease cleavage site (e.g., a uPA cleavage site) ; (H) a second antibody binding fragment comprising a second protease cleavage site (e.g., a uPA cleavage site) ; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen
  • an exemplary targeting conjugate is shown in FIG. 1A.
  • An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVSV
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first effector molecule (e.g., a small molecule drug) comprising a first linker; (F) a second effector molecule (e.g., a small molecule drug) comprising a second linker; (G) a first antibody binding fragment; (H) a second antibody binding fragment; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first effector molecule (e.g., a small molecule drug) is conjugated to the first antibody binding fragment via the first linker; wherein the second effector molecule (e.g.
  • two or more effector molecules are conjugated to the first antibody binding fragment. In some embodiments, two or more effector molecules are conjugated to the second antibody binding fragment.
  • An exemplary targeting conjugate is shown in FIG. 1B.
  • An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment selected from the group consisting of SEQ ID NOs: 76-79 and 156, and a therapeutic agent selected from the group consisting of compounds of Formulae (1) - (3) .
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first oligonucleotide and a first linker; (F) a second oligonucleotide and a second linker; (G) a first antibody binding fragment comprising a first protease cleavage site (e.g., a uPA cleavage site) ; (H) a second antibody binding fragment comprising a second protease cleavage site (e.g., a uPA cleavage site) ; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first antibody heavy chain and the first antibody light
  • two or more oligonucleotide are conjugated to the first antibody binding fragment. In some embodiments, two or more oligonucleotide are conjugated to the second antibody binding fragment.
  • An exemplary targeting conjugate is shown in FIG. 2A.
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first oligonucleotide and a first linker; (F) a second oligonucleotide and a second linker; (G) a first antibody binding fragment; (H) a second antibody binding fragment; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first oligonucleotide is conjugated to the first antibody binding fragment via the first linker; wherein the second oligonucleotide is conjugated to the second antibody binding fragment via the second linker; wherein the first antibody binding fragment is covalently conjugated to the
  • two or more oligonucleotides are conjugated to the first antibody binding fragment. In some embodiments, two or more oligonucleotides are conjugated to the second antibody binding fragment.
  • An exemplary targeting conjugate is shown in FIG. 2B.
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first oligonucleotide; (F) a second oligonucleotide; (G) a first moiety comprising a first antibody binding fragment, a first protease cleavage site (e.g., a uPA cleavage site) , and a first oligonucleotide binding peptide; (H) a second moiety comprising a second antibody binding fragment, a second protease cleavage site (e.g., a uPA cleavage site) , and a second oligonucleotide binding peptide; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody
  • two or more oligonucleotides are conjugated to the first oligonucleotide binding peptide. In some embodiments, two or more oligonucleotides are conjugated to the second oligonucleotide binding peptide.
  • An exemplary targeting conjugate is shown in FIG. 3A.
  • An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 148-150; a crosslinker selected from the group consisting of: SMCC, maleimide-amido-PEG 2 -TFP, and maleimide-PEG 2 -DBCO; and a CpG ODN comprising a nucleic acid sequence of SEQ ID NO: 67.
  • a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first oligonucleotide; (F) a second oligonucleotide; (G) a first moiety comprising a first antibody binding fragment and a first oligonucleotide binding peptide; (H) a second moiety comprising a second antibody binding fragment and a second oligonucleotide binding peptide; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first oligonucleotide is conjugated non-covalently to the first oligonucleotide binding peptide
  • An exemplary targeting conjugate is shown in FIG. 3B.
  • An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment comprising a sequence selected from the group consisting of SEQ ID NOs: 74 and 80-83; a crosslinker selected from the group consisting of: SMCC, maleimide-amido-PEG 2 -TFP, and maleimide-PEG 2 -DBCO; and a CpG ODN comprising a nucleic acid sequence of SEQ ID NO: 67.
  • the first and the second effector molecules are the same. In some embodiments, the first and the second effector molecules are different. In some embodiments, the first and the second oligonucleotides are the same. In some embodiments, the first and the second oligonucleotides are different. In some embodiments, the targeting moiety is monospecific. In some embodiments, the targeting moiety is multispecific, such as bispecific, or trispecific.
  • a targeting conjugate comprising: (a) an antibody heavy chain comprising an amino acid sequence having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to SEQ ID NO: 102; (b) an antibody light chain comprising an amino acid sequence having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to SEQ ID NO: 103; (c) an antibody binding fragment that is covalently conjugated to the antibody heavy chain; and (d) an effector molecule, wherein the effector molecule is conjugated to the antibody heavy chain via the antibody binding fragment.
  • an antibody heavy chain comprising an amino acid sequence having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 9
  • the antibody binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  • the effector molecule is a therapeutic agent, such as selected from compounds of Formulae (1) - (6)
  • the effector molecule is an oligonucleotide, such as a CpG oligonucleotide, e.g., an oligonucleotide comprising a nucleic acid selected from the group consisting of SEQ ID NOs: 66-67.
  • the targeting conjugates described herein and compositions thereof can be used to treat or diagnose various diseases, such as cancer, including solid tumor or hematological cancer, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • a method of treating a disease in an individual comprising administering to the individual an effective amount of any one of the targeting conjugates described herein, wherein the targeting conjugate comprises an effector molecule selected from the group consisting of a therapeutic agent and an oligonucleotide.
  • the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • the disease is cancer.
  • the cancer is selected from the group consisting of bladder cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, esophageal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, non-Hodgkin’s lymphoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, thyroid cancer and uterine cancer.
  • a method of treating a disease (such as cancer) associated with a target molecule in an individual comprising administering to the individual an effective amount of a targeting conjugate comprising the structure of Formula I:
  • A is a targeting moiety that specifically binds to the target molecule
  • B is a TBF comprising a targeting moiety binding peptide
  • P is a cleavage site
  • L is a linker
  • C is a conjugation site
  • D is a therapeutic agent or an oligonucleotide
  • x 0 or 1
  • y 0 or 1
  • z 0 or 1
  • z 0.
  • z 1.
  • y 0.
  • y 1.
  • x 0.
  • x 1.
  • a is 1 or more.
  • b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • a method of diagnosing a disease in an individual comprising administering to the individual an effective amount of any one of the targeting conjugates described herein, wherein the targeting conjugate comprises a detectable label, and wherein detection of the detectable label is indicative of the presence of the disease.
  • the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • the disease is cancer.
  • the cancer is selected from the group consisting of bladder cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, esophageal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, non-Hodgkin’s lymphoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, thyroid cancer and uterine cancer.
  • a method of diagnosing a disease comprising administering to the individual an effective amount of a targeting conjugate comprising the structure of Formula I:
  • A is a targeting moiety that specifically binds to the target molecule
  • B is a TBF comprising a targeting moiety binding peptide
  • P is a cleavage site
  • L is a linker
  • C is a conjugation site
  • D is a detectable label
  • x 0 or 1
  • y 0 or 1
  • z 0 or 1
  • z 0.
  • y 0.
  • y 1.
  • x 0.
  • x 1.
  • a is 1 or more. In some embodiments, b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • an effector molecule e.g., a therapeutic agent, an oligonucleotide and/or a detectable label
  • a targeting conjugate comprising the structure of Formula I:
  • A is a targeting moiety that specifically binds to the target molecule
  • B is a TBF comprising a targeting moiety binding peptide
  • P is a cleavage site
  • L is a linker
  • C is a conjugation site
  • D is a therapeutic agent or an oligonucleotide
  • x 0 or 1
  • y 0 or 1
  • z 0 or 1
  • z 0.
  • z 1.
  • y 0.
  • y 1.
  • x 0.
  • x 1.
  • a is 1 or more.
  • b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
  • the method increases the effective concentration of the effector molecule at a diseased site in an individual in need of treatment with the effector molecule.
  • the effective concentration of the effector molecule is increased by about any of 10%, 20%, 50%, 1x, 2x, 5x, 10x or more at the diseased site compared to administration of the effector molecule alone to the individual at the same effective amount.
  • the method reduces binding of the effector molecule to a target molecule in normal tissues in an individual having a disease in need of treatment with the effector molecule.
  • administration of the targeting conjugate reduces binding of the effector molecule to its target molecule on normal cells by about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%or more compared to administration of the effector molecule alone to the individual.
  • the method reduces toxicity (such as on-target off-tissue toxicity) of the effector molecule to an individual having a disease in need of treatment with the effector molecule.
  • administration of the targeting conjugate reduces the toxicity of the effector molecule by about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%or more compared to administration of the effector molecule alone at the same effective amount to the individual.
  • the targeting conjugates described herein can be administered to an individual via various routes, for example, with the same route of administration as the targeting moiety in the targeting conjugate.
  • exemplary routes of administration include, but are not limited to parenteral, intravenous, intramuscular, and subcutaneous administration.
  • the effective amount, suitable dose, and dosing schedule of the targeting conjugate administered to an individual can vary depending on the particular composition, the route of administration, and the particular type of disease being treated.
  • the effective amount of the targeting conjugate is based on the effective amount of the targeting moiety and/or the effector molecule (e.g., therapeutic agent, oligonucleotide, and/or detectable label) .
  • the individual is a mammal, such as human, rodents, or primates. In some embodiments, the individual is human.
  • the targeting conjugate is used alone or in combination with other anticancer treatments such as chemotherapeutic agents, ionizing radiation, hormonal therapy, cytokines, immunotherapy, cellular therapy, vaccines, monoclonal antibodies, antiangiogenic agents, targeted therapeutics (small molecule drugs) , or biological therapies.
  • chemotherapeutic agents include, but are not limited to, antitumor alkylating agents such as Mustards (mechlorethamine HCl, melphalan, chlorambucil, cyclophosphamide, ifosfamide, busulfan) , Nitrosoureas (BCNU/cannustine, CCNU/lomustine, MeCCNU/semustine, fotemustine, treptozotocin) , Tetrazines (dacarbazine, mitozolomide, temozolomide) , Aziridines (thiotepa, mitomycin C, AZQ/diaziquone) , procarbazine HCl, hexamethylmelamine, adozelesin; cisplatin and its analogues, cisplatin, carboplatin, oxaliplatin; antimetabolites, methotrexate, other antifolates, 5-fluoro
  • compositions e.g., pharmaceutical compositions, or diagnostic compositions
  • kits, and articles of manufacture comprising any one of the targeting conjugates disclosed herein.
  • a pharmaceutical composition comprising any one of the targeting conjugates described herein, wherein the effector molecule is a therapeutic agent or an oligonucleotide, and a pharmaceutically-acceptable carrier.
  • the composition (such as pharmaceutical composition or diagnostic compositions) comprises a carrier, diluent, or excipient, which may facilitate administration of the composition to an individual in need thereof.
  • carriers examples include, but are not limited to, calcium carbonate, calcium phosphate, various sugars such as lactose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols and physiologically compatible solvents.
  • the composition (e.g., pharmaceutical composition or diagnostic composition) comprises a plurality of targeting conjugates.
  • the targeting conjugate molecules in the composition do not have the same number of effector molecules.
  • at least two of the targeting conjugates in the composition comprise different numbers of effector molecules. The ratio between the effector molecule and the targeting moiety in the pharmaceutical compositions is within a certain range in order for the composition (e.g., pharmaceutical composition or diagnostic composition) to receive regulatory approval.
  • the average drug loading of the composition is at least about any one of 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 60: 1, 70: 1, 80: 1, 90: 1, 100: 1 or more.
  • the average drug loading of the composition is no more than about any one of 100: 1, 90: 1, 80: 1, 70: 1, 60: 1, 50: 1, 40: 1, 30: 1, 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, or 2: 1.
  • the average drug loading of the composition is about any one of 2: 1-4: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 20: 1-40: 1, 40: 1-100: 1, 2: 1-20: 1, 2: 1-40: 1, or 10: 1-40: 1.
  • the composition e.g., pharmaceutical composition or diagnostic composition
  • the composition has an average ratio of the effector molecule to the targeting moiety of at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, or 20: 1.
  • the composition e.g., pharmaceutical composition or diagnostic composition
  • the composition has an average ratio of the effector molecule to the targeting moiety of no more than about any one of 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1.
  • the composition e.g., pharmaceutical composition or diagnostic composition
  • composition e.g., pharmaceutical composition or diagnostic composition
  • the composition can be prepared by mixing the ingredients following generally accepted procedures.
  • the selected components may be simply mixed in a blender or other standard device to produce a concentrated mixture which may then be adjusted to the final concentration and viscosity by the addition of water or thickening agent and possibly a buffer to control pH or an additional solute to control tonicity.
  • the composition (e.g., pharmaceutical composition or diagnostic composition) is a liquid suspension. In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) is a sterile composition.
  • kits comprising any one of the targeting conjugates described herein.
  • the kits of the invention are in suitable packaging.
  • suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags) , and the like. Kits may optionally provide additional components such as buffers and interpretative information.
  • the present application thus also provides articles of manufacture, which include vials (such as sealed vials) , bottles, jars, flexible packaging, and the like.
  • the article of manufacture can comprise a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is effective for treating or diagnosing a disease as described herein, and may have a sterile access port.
  • the label or package insert indicates that the composition is used for treating or diagnosing a disease in an individual.
  • the label or package insert will further comprise instructions for administering the composition to the individual.
  • Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage, administration, contraindications and/or warnings concerning the use of such therapeutic products.
  • the package insert indicates that the composition is used for treating a disease (such as cancer) .
  • the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI) , phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • a pharmaceutically-acceptable buffer such as bacteriostatic water for injection (BWFI) , phosphate-buffered saline, Ringer's solution and dextrose solution.
  • Targeting moiety binding peptides with or without oligonucleotide binding peptides (OBPs) (in the sequence table of SEQ ID NOs: 74-83, 148-150, 152, and 156) were designed and synthesized by solid phase synthesis, and verified by LC-MS.
  • SEQ ID NO: 151 (NH 2 - (PEG) 12 -RSQSRSRYYRQRQRSRRRRRRS) lacking an antibody binding peptide was designed and synthesized as a control.
  • the affinities between TBPs and antibody Ab2B were measured with Biacore.
  • Anti-human Fab was ligated to Biacore chips at pH 4.5.
  • Ab2B was captured as ligand for 110s at 10 ⁇ L/min flow speed.
  • TBPs were flowed through the chip as analytes at 30 ⁇ L/min.
  • 10 mM glycine at pH 1.5 was used for regeneration of the chip. Conditions were optimized as needed.
  • the experimental design is shown in Table 2.
  • TBF-drug conjugates of compounds of Formulae (7) - (12) were designed and synthesized by solid phase synthesis of peptides and then by chemical conjugation.
  • the general formula of TBF-drug conjugate is TBF-R- (PEG) m -VC-PAB- (DMAE) k -Drug (Formula V) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • the linker is represented by TBF-R- (PEG) m -P-PAB- (DMAE) k -Drug (Formula VI) , wherein R is an amine-reactive or sulfhydryl-reactive group, P is a cleavage site, m and k are integers, m ⁇ 0, and k is 0 or 1.
  • Urokinase-type Plasminogen Activator (uPA) substrate peptides (SEQ ID NOs: 50-54) were screened for the efficiency of substrates cleavage by uPA but resistance to Tissue-type Plasminogen Activator (tPA) digestion.
  • Substrate peptides and PBS were added to 384 plates and mixed with uPA or tPA. Efficiency of digestion was measure by Fluorescence Resonance Energy Transfer (FRET) method. Experimental designs were shown in Table 4. Results are shown in Tables 5-7.
  • uPA effectively cleaved peptides of SEQ ID NOs: 50-54, as shown in Table 5 below:
  • the rankings of uPA digestion rates for the peptides were: SEQ ID NOs: 52, 54 > SEQ ID NO: 53 > SEQ ID NO: 50 > SEQ ID NO: 51.
  • the rankings of reaction efficiency were: SEQ ID NO: 51> SEQ ID NO: 50> SEQ ID NO: 54 > SEQ ID NO: 52 > SEQ ID NO: 53.
  • SEQ ID NOs: 51, 52 and 54 were digested, as shown in Table 7:
  • Plasma was mixed with antibiotics (penicillin-streptomycin) and then peptides of SEQ ID NOs: 50-54 were added to the plasma mixture.
  • the reaction mixture was incubated at room temperature. Samples were taken at 0 hour, 8 hours, 24 hours, 32 hours, 48 hours, 72 hours, 96 hours, 120 hours and 144 hours for FRET measurements.
  • the experimental design is shown in Table 8.
  • the rankings of peptides stability in the plasma are approximately: SEQ ID NO: 53 >SEQ ID NOs: 51, 52 > SEQ ID NO: 50> SEQ ID NO: 54.
  • Plasma-peptide mixtures were incubated at room temperature for 12 hours and fluorescence intensities were measured continuously. Results are shown in Table 11.
  • PS penicillin-streptomycin.
  • the rankings of peptide stability in the plasma were approximately SEQ ID NOs: 52, 53 > SEQ ID NO: 50 > SEQ ID Nos: 51, 54.
  • SEQ ID NOs 52 and 53 the fluorescence intensities increased with time to 2.0-fold and 1.7-fold respectively, but did not reach a plateau within 12 hours.
  • SEQ ID NO: 50 reached plateau in 4.8 hours, and the maximum fold of increase in fluorescence intensity was 2.8-fold.
  • the fluorescence intensities of SEQ ID NOs: 51 and 54 increased to 2.3-fold and 2.7-fold within 3.6 hours, respectively.
  • Antibodies Ab3C (heavy chain sequence SEQ ID NO: 108, light chain sequence SEQ ID NO: 109) , Ab3E (heavy chain sequence SEQ ID NO: 110, light chain sequence SEQ ID NO: 111) and Ab5D (heavy chain sequence SEQ ID NO: 124, light chain sequence SEQ ID NO: 125) containing a uPA substrate sequence in the heavy chain were used to test uPA digestion efficiency in antibodies.
  • Antibody Ab5C (heavy chain sequence SEQ ID NO: 122, light chain sequence SEQ ID NO: 123) that does not contain a uPA substrate sequence was used as a control. Experimental design is shown in Table 12 below. The reaction mixtures were incubated at 37°C for 24 hours.
  • the antibody sequences are as shown below:
  • SEQ ID NO: 108 (Ab3C, heavy chain sequence)
  • SEQ ID NO: 109 (Ab3C light chain sequence)
  • SEQ ID NO: 110 (Ab3E heavy chain sequence)
  • SEQ ID NO: 111 (Ab3E light chain sequence)
  • SEQ ID NO: 122 (Ab5C heavy chain sequence)
  • SEQ ID NO: 124 (Ab5D heavy chain sequence)
  • uPA digestion products were analyzed with LC-MS.
  • the heavy chains of Ab3C, Ab3E and Ab5D were cleaved by uPA to yield fragments of expected molecular weight.
  • Ab5C was not cleaved by uPA.
  • TBF1 (SEQ ID NO: 81 + DSG, Formula (13) )
  • TBF2 (SEQ ID NO: 81 + DSS, Formula (14) )
  • TBF3 (SEQ ID NO: 82 + SMCC, Formula (15) )
  • TBF4 (SEQ ID NO: 82 + maleimide-amido-PEG 2 -TFP, Formula (16) )
  • TBF5 (SEQ ID NO: 82 + maleimide-amido-PEG 4 -TFP, Formula (17) )
  • TBF6 (SEQ ID NO: 82 + maleimide-amido-PEG 2 -DBCO, Formula (18) )
  • TBF7 (SEQ ID NO: 82 + maleimide-amido-PEG 4 -DBCO, Formula (19) )
  • TBF8 (SEQ ID NO: 148 + DSG, Formula (20) )
  • TBF9 (SEQ ID NO: 148 + DSS, Formula (21) )
  • TBF10 (SEQ ID NO: 149 + SMCC, Formula (22) )
  • TBF11 (SEQ ID NO: 149 + maleimide-amido-PEG 2 -TFP, Formula (23) )
  • TBF12 (SEQ ID NO: 149 + maleimide-amido-PEG 4 -TFP, Formula (24) )
  • TBF13 (SEQ ID NO: 149 + maleimide-amido-PEG 2 -DBCO, Formula (25) )
  • TBF14 (SEQ ID NO: 149 + maleimide-amido-PEG 4 -DBCO, Formula (26) )
  • crosslinking products with DSS or DSG underwent hydrolysis.
  • crosslinking with SMCC maleimide-amido-PEG 2 -TFP or maleimide-amido-PEG 4 -TFP had over 90%yield, and crosslinking with maleimide-amido-PEG 2 -DBCO or maleimide-amido-PEG 4 -DBCO had over 90%yield.
  • Monospecific PD-L1 antibodies Ab2B (heavy chain SEQ ID NO: 100, light chain SEQ ID NO: 101) , Ab3A (heavy chain SEQ ID NO: 104, light chain SEQ ID NO: 105) , Ab3B (heavy chain SEQ ID NO: 106, light chain SEQ ID NO: 107) , Ab3C (heavy chain SEQ ID NO: 108, light chain SEQ ID NO: 109) , Ab3E (heavy chain SEQ ID NO: 110, light chain SEQ ID NO: 111) , Ab3F (heavy chain SEQ ID NO: 112, light chain SEQ ID NO: 113) .
  • the results of affinity to PD-L1 are shown in Table 15. The results show that the monospecific antibodies maintained high affinities to the antigen.
  • the antibody sequences are as shown below:
  • SEQ ID NO: 104 (Ab3A, heavy chain sequence)
  • SEQ ID NO: 105 (Ab3A, light chain sequence)
  • SEQ ID NO: 106 (Ab3B heavy chain sequence)
  • SEQ ID NO: 112 (Ab3F heavy chain sequence)
  • TBF-drug conjugates selected from the group consisting of Compound of Formula (7) - (12) are mixed with the antibodies at 5: 1-50: 1 molar ratios, and the reaction mixtures are incubated under room temperature for 2-24 hours.
  • Final products (TD-ADCs) are obtained by dialysis.
  • TBF selected from the group consisting of Compound of Formula (13) - (26) are mixed with the antibodies at 5: 1-50: 1 molar ratios, and the reaction mixtures are incubated under room temperature for 2-24 hours.
  • Ligation products are obtained by dialysis, and subjected to further ligation with CpG ODN at molar ratios between 1: 5-1: 50.
  • Final products are obtained by dialysis.

Abstract

Provided are targeting conjugates comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF), wherein the effector molecule can be released from the targeting conjugate via cleavage. Also provided are compositions and methods of treatment or diagnosis using the targeting conjugates.

Description

TARGETING CONJUGATES COMPRISING TARGETING MOIETY BINDING FRAGMENTS AND USES THEREOF FIELD
The present application relates to targeting conjugates comprising targeting moiety binding fragments and uses thereof.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 199872000340SEQLIST. TXT, date recorded: February 24, 2021, size: 163 KB) .
BACKGROUND
Antibodies have been successfully used as therapeutic and diagnostic agents for a variety of diseases. A native antibody acts by binding to a specific target. However, antibody targets can be expressed in both diseased (e.g. tumor) tissues and normal tissues. When antibodies bind to targets expressed in normal tissues of a patient, the patient can experience undesirable, toxic side-effects, which can range from mild to severe or even life-threatening degree of intensity. Such side effects can lead to a decreased effective dosage of the antibody, which can lower its therapeutic efficacy. The antibody treatment may even be discontinued due to the side effects, which, in some cases, render the antibody therapeutic unavailable to human patients. Thus, there exists an unmet need to engineer antibodies that preferentially bind to targets on diseased cells and tissues.
Antibody drug conjugates (ADCs) are targeted therapeutics designed to preferentially direct drugs ( “payloads” ) to diseased tissues expressing a surface antigen recognized by the antibody. ADCs are often composed of an antibody linked to therapeutically active agents (e.g. a cytotoxic drug) , via chemical linkers that enable release of therapeutically active agents in the diseased environment. Currently, five ADCs have been approved by the FDA for therapeutic use, and over 100 are in clinical investigation. Trastuzumab emtansine
Figure PCTCN2021077866-appb-000001
and brentuzimab vedotin
Figure PCTCN2021077866-appb-000002
are among the most widely used ADCs in cancer treatment (see, for example, Jackson et al., Pharm Res (2015) 32: 3458-3469) . The majority of the ADCs currently approved or undergoing clinical evaluation are small molecule drug-antibody conjugates. Current ADCs incorporate standard chemotherapeutics such as antimitotics and antimetabolites, including auristatins monomethyl auristatin E (MMAE) , calicheamicin, and derivative of maytansin 1 (DM1) . See, for example, Polakis, Pharma Rev, 2016, 68 (1) 3-19.
Although ADCs have conceptual advantages and promising clinical results, the development of an effective ADC therapeutic remains remarkably challenging. The overall design of the ADC, the choice of target tissues, the antibody, the chemical linker, the site of drug attachment, and the nature of the cargo all influence the efficacy and the risks of the ADC (see, for example, Chau et al., Lancet 2019; 394: 793-804) . For instance, early ADCs in clinical trials suffer from immunogenicity of the mouse antibodies used, and recent advances in the development of ADCs rely on humanized antibodies. Other outstanding challenges in ADCs include a) drug cargo impotency; b) premature release of drug leading to loss of efficacy and toxicity; c) level of target expression; d) suboptimal target selectivity; e) side effects such as thrombocytopenia and neuropathy as seen in
Figure PCTCN2021077866-appb-000003
and
Figure PCTCN2021077866-appb-000004
These limitations underscore the need for further improvement of ADCs in search of high potency payloads, stable chemical linkers, efficient and highly specific cargo release, and increased antibody-target selectivity.
The ADC platform as a highly specific cargo delivery system in vivo also lends itself to applications beyond small molecule drug delivery. For example, siRNAs can be fused to an antibody and developed into an efficient method for in vivo mRNA knockdown (see, 
Figure PCTCN2021077866-appb-000005
et al., Nature Protocols, 2016, 11: 22-36) . Such antibody-mediated siRNA delivery has shown promising results in colon cancer treatment (see, 
Figure PCTCN2021077866-appb-000006
et al., Clin Cancer Res 2015 15; 21 (6) : 1383-94. ) . There remains a need for a broader scope in the design, types of antibodies, and breadth of effector molecules in ADC platforms.
BRIEF SUMMARY
The present application provides targeting conjugates comprising a targeting moiety and one or more effector molecules, compositions, methods of preparation and methods of use thereof.
In some embodiments, there is provided a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein a conjugation site with the effector molecule can be released from the targeting conjugate via cleavage.
In some embodiments, the targeting conjugate comprises structure of Formula I:
Figure PCTCN2021077866-appb-000007
wherein: A is a targeting moiety that specifically binds to the target molecule; B is a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide; P is a cleavage site; L is a linker; C is a conjugation site; D is the effector molecule; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; and d=1-20. In some embodiments, z=0. In some embodiments, z=1. In some embodiments, y=0. In some embodiments, y=1. In some embodiments, x=0. In some embodiments, x=1. In some embodiments, a is 1 or more. In some embodiments, b is 1 or more. In some embodiments, d is 1 or more. In some embodiments, a is 2-10 (e.g., 2-6) . In some embodiments, b is 2-10 (e.g., 2-6) . In some embodiments, d is 2-10 (e.g., 2-6) .
In some embodiments according to any one of the targeting conjugates described above, the targeting conjugate comprises a targeting peptide. In some embodiments, the targeting conjugate comprises an antibody or antigen-binding fragment thereof. In some embodiments, the antibody or antigen-binding fragment thereof is selected from the group consisting of: a human antibody, a humanized antibody, a chimeric antibody, a monospecific antibody, a multispecific antibody, a diabody, a nanobody, an scFv, an scFab, a Fab fragment, a Fab’fragment, a F (ab’)  2 fragment, and a dsFv. In some embodiments, the targeting moiety comprises an antibody-peptide fusion protein. In some embodiments, the antibody-peptide fusion protein comprises an Fc region. In some embodiments, the peptide is fused to the C-terminus of the Fc region.
In some embodiments according to any one of the targeting conjugates described above, the targeting conjugate comprises a targeting moiety that specifically binds to a target molecule (e.g., cell surface molecule) at a target site. In some embodiments, the target site is a site of a disease. In some embodiments, the disease is tumor. In some embodiments, the target molecule is selected from the group consisting of: PD1, PD-L1, Trop2, CTLA-4, LAG-3, TIM-3, 4-1BB, CD40, OX40, CD47, SIRPα, HER2, HER3, EGFR, VEGF, VEGR2, CD19, CD20, CD22, CD30, CD33, CD38, CD79, integrin αvβ3, αvβ6, MUC1, PMSA, uPAR, and angiopep-2.
In some embodiments according to any one of the targeting conjugates described above, the cleavage is triggered by a condition at a target site for the targeting moiety. In some embodiments, the condition at a target site is selected from the group consisting of:  protease, pH change, redox change, hypoxia, oxidative stress, hyperthermia, and extracellular ATP concentration.
In some embodiments according to any one of the targeting conjugates described above, the cleavage is by a protease. In some embodiments, the protease is selected from the group consisting of: urokinase plasminogen activator (uPA) , legumain, plasmin, TMPRSS3, TMPRSS4, TMPRSS6, MMPl, MMP2, MMP-3, MMP-9, MMP-8, MMP-14, MT1-MMP, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM 10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, TACE, human neutrophil elastase, beta-secretase, fibroblast associated protein, matriptase, PSMA and PSA. In some embodiments, the protease is uPA. In some embodiments, the cleavage site comprises an amino acid sequence selected from the amino acid sequences of SEQ ID NOs: 50-55.
In some embodiments according to any one of the targeting conjugates described above, the effector molecule is selected from the group consisting of a therapeutic agent, an oligonucleotide, and a detectable label. In some embodiments, the effector molecule is a therapeutic agent. In some embodiments, the effector molecule is selected from the group consisting of a protein-based drug, a small molecule drug, a cytotoxic agent, a toxin, an immunomodulatory agent, an anti-inflammatory agent, an anti-infective agent, and an epigenetic modulating agent. In some embodiments, the effector molecule is an oligonucleotide. In some embodiments, the oligonucleotide is about 2 to about 100 nucleotides long. In some embodiments, the oligonucleotide is selected from the group consisting of: a double stranded DNA, a single stranded DNA, a double stranded RNA, a single stranded RNA, an antisense RNA, a small interference RNA, a microRNA, a short hairpin RNA (shRNA) , and a CpG (Cytosine-phosphodiester-Guanine) oligonucleotide. In some embodiments, the oligonucleotide is a CpG oligonucleotide. In some embodiments, the oligonucleotide comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 66-67. In some embodiments, the targeting conjugate comprises two or more oligonucleotides.
In some embodiments according to any one of the targeting conjugates described above, the effector molecule is a cytotoxic agent selected from the group consisting of consisting of an anthracycline, an auristatin, a camptothecin, a combretastatin, a dolastatin, a duocarmycin, an enediyne, a geldanamycin, an indolino-benzodiazepine dimer, a maytansine, a puromycin, a pyrrolobenzodiazepine dimer, a taxane, a vinca alkaloid, a tubulysin, a  hemiasterlin, a spliceostatin, a pladienolide, and stereoisomers, isosteres, analogs, or derivatives thereof. In some embodiments, the effector molecule is SN38 or a derivative thereof. In some embodiments, the effector molecule is MMAE or a derivative thereof. In some embodiments, the effector molecule is selected from compounds of Formulae (1) - (6) .
In some embodiments according to any one of the targeting conjugates described above, the targeting conjugate comprises two or more effector molecules.
In some embodiments according to any one of the targeting conjugates described above, wherein the targeting conjugate comprises the structure of Formula I, x=0 and C is an endogenous conjugation site on B. In some embodiments, x=0 and C is an engineered conjugation site on B. In some embodiments, C is present in a cationic peptide linked to B. In some embodiments, C is present in a neutral charge peptide linked to B. In some embodiments, C is a covalent conjugation site. In some embodiments, C is a non-covalent conjugation site. In some embodiments, the conjugation site comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-12.
In some embodiments according to any one of the targeting conjugates described above, the targeting moiety binding fragment (TBF) is linked to the targeting moiety non-covalently. In some embodiments, the TBF is linked to the targeting moiety covalently. In some embodiments, the TBF is linked to the targeting moiety covalently via a chemically reactive moiety. In some embodiments, the TBF comprises a TBP selected from the group consisting of Fc-BP1, FcBP-2, and Fc-III and fragments thereof. In some embodiments, the TBF comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 75-79, 152, and 156. In some embodiments, the TBF comprises a sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
In some embodiments, the TBF comprises a crosslinker selected from the group consisting of disuccinimidyl glutarate (DSG) , disuccinimidyl suberate (DSS) , Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate (SMCC) , Maleimide-amido-PEG n-TFP (TFP: tetrafluorophenyl) , and Maleimide-PEG n-DBCO (DBCO: dibenzocyclooctyne) , wherein n is an integer of 1-12.
In some embodiments, the targeting conjugate comprises a structure represented by the formula: TBF- (PEG)  n-P i-OBP j, wherein P is a cleavage site and OBP is an oligonucleotide binding peptide, and wherein n ≥ 0, i = 0 or 1, j = 0 or 1. In some embodiments, the targeting conjugate comprises a structure represented by the formula: TBF-R- (PEG)  m-VC-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m≥0, and k is 0 or 1. In some  embodiments, the targeting conjugate comprises a structure represented by the formula TBF-R- (PEG)  m-P-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, P is a cleavage site, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the targeting conjugate comprises a sequence that is selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156. In some embodiments, the targeting conjugate comprises a structure of a formula selected from the group consisting of Formulae (13) - (26) (i.e., TBP1-TBP14) . In some embodiments, the targeting conjugate comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) .
In some embodiments according to any one of the targeting conjugates described above, wherein the targeting conjugate comprises the structure of Formula I, L is represented by the formula: SH 2-Spacer, MAL-Spacer, NH 2-Spacer, or Osu-Spacer (Osu: oxysuccinimide) . In some embodiments, L is represented by the formula: R- (PEG)  m-VC-PAB- (DMAE)  k (Formula II) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the linker is represented by R- (PEG)  m-P-PAB- (DMAE)  k (Formula III) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1, P is a cleavage site.
In some embodiments, there is provided a targeting conjugate comprising a targeting moiety conjugated to a therapeutic agent having a structure of a formula selected from the group consisting of compounds of Formulae (1) - (6) .
In some embodiments, there is provided a targeting conjugate comprising a targeting moiety conjugated to an effector molecule via a targeting moiety binding fragment, wherein the targeting moiety binding fragment comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 76-79, 152, and 156. In some embodiments, the targeting conjugate comprises a structure of a formula selected from the group consisting of Formulae (13) - (26) .
Also described herein is a composition comprising a plurality of any one of the targeting conjugates described above. In some embodiments, the average ratio of the effector molecule and the targeting moiety in the composition is at least about 1: 1. In some embodiments, at least two of the targeting conjugates in the composition comprise different numbers of effector molecules. In some embodiments, wherein the effector molecule is a therapeutic agent or an oligonucleotide, the composition is a pharmaceutical composition. In some embodiments wherein the effector molecule is a detectable label, the composition is a diagnostic composition.
In some embodiments, there is provided a method of treating a disease in an individual, comprising administering to the individual an effective amount of any one of the pharmaceutical compositions described above.
In some embodiments, there is provided a method of diagnosing a disease in an individual, comprising administering to the individual an effective amount of the diagnostic compositions described above, wherein the detection of the detectable label is indicative of the presence of the disease.
Also provided herein is a method of making any one of the targeting conjugates describe above, wherein the method comprises conjugating the effector molecule to the targeting moiety. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
BRIEF DESCRIPTION OF THE DRAWINGS
FIGs. 1A-3B depicts a schematic structure of an exemplary targeting conjugate, comprising A: a targeting moiety, such as an antibody or antigen-binding fragment or a targeting peptide (including a multispecific antibody and a fusion protein) with or without protease cleavage sites; B: target moiety binding fragment; D: effector molecule, such as a small molecule drug or an oligonucleotide; P: a cleavage site (e.g., protease cleavage site) ; C: a conjugation site, such as a covalent conjugation site, or a non-covalent conjugation site (e.g., a cationic peptide or neutral charge peptide) ; L: linker; x = 0 or 1; y = 0 or 1; z = 0 or 1; a = 1-20; b = 1-20; d = 1-20.
FIG. 1A shows an exemplary targeting conjugate, in which x=1, y=1, z=0, a=1-20, b=1-20, d=1-20.
FIG. 1B shows an exemplary targeting conjugate, in which x=0, y=1, z=0, a=1-20, b=1-20, d=1-20.
FIG. 2A shows an exemplary targeting conjugate, in which x=1, y=1, z=0, a=1-20, b=1-20, d=1-20.
FIG. 2B shows an exemplary targeting conjugate, in which x=0, y=1, z=0, a=1-20, b=1-20, d=1-20.
FIG. 3A shows an exemplary targeting conjugate, in which x=1, y=0, z=1, a=1-20, b=1-20, d=1-20.
FIG. 3B shows an exemplary targeting conjugate, in which x=0, y=0, z=1, a=1-20, b=1-20, d=1-20.
DETAILED DESCRIPTION
The present application provides compositions and methods of treatment or diagnosis using targeting conjugates comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) , wherein the effector molecule can be released from the targeting conjugate via cleavage. The targeting moiety specifically binds to a target molecule, such as a cell surface molecule that is expressed on a diseased tissue or diseased cells (e.g., tumor cells) . Upon binding of the targeting moiety to the target molecule, cleavage of one or more cleavage sites in the targeting conjugate may be triggered, which leads to release of the effector molecule at the target site. In some embodiments, the targeting conjugate is multispecific. The targeting conjugates described herein may have more than one type of cargoes (e.g., oligonucleotides and small molecule drugs) conjugated to the conjugation site, and the targeting moiety can be a targeting peptide, an antibody or antigen binding fragment thereof (including a multispecific antibody) , or a combination thereof. Thus, the targeting conjugates described herein can have enhanced selective target recognition capability and efficacy compared to traditional ADCs. Incorporating multiple conjugation sites and different types of cargos onto one targeting conjugate opens up potentials for more potent therapeutic effects. The possibilities of combining oligonucleotides and other effector molecules (e.g., small molecule drugs) expand the scope of diseases that can be targeted by the targeting conjugates described herein.
Accordingly, one aspect of the present application provides a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein the effector molecule can be released from the targeting conjugate via cleavage. In some embodiments, the targeting conjugate comprises the structure of Formula (I) , wherein x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; and d=1-20.
Also provided are compositions, methods, kits and articles of manufacture for any one of the targeting conjugates described above.
I. Definitions
Terms are used herein as generally used in the art, unless otherwise defined as follows.
The term “targeting moiety” as used herein refers to a polypeptide-based binding molecule that specifically binds to a target molecule, or a portion thereof that contributes to the specific binding. Both antibody-based and non-antibody based binding molecules or portions thereof are contemplated herein.
The term “effector molecule” as used herein refers to a molecule having a therapeutic or diagnostic effect. The effector molecule may be of any suitable molecular entity, such as a small molecule drug or an oligonucleotide.
The term “conjugation” refers to chemically joining two chemical groups or moieties together via one or more covalent or non-covalent bonds. Conjugation may be direct between the two chemical groups or moieties, or indirect through a third chemical group or moiety (e.g., a linker) that bridges the two chemical groups or moieties.
The term “conjugation site” refers to a site that directly joins two chemical moieties.
The term “antibody” is used in its broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) , full-length antibodies and antigen-binding fragments thereof, so long as they exhibit the desired antigen-binding activity. The term “antibody moiety” refers to a full-length antibody or an antigen-binding fragment thereof. Antibodies and/or antigen binding fragments may be derived from murine antibodies, rabbit antibodies, human antibodies, fully humanized antibodies, camelid antibody variable domains and humanized versions, shark antibody variable domains and humanized versions, and camelized antibody variable domains.
A full-length antibody comprises two heavy chains and two light chains. The variable regions of the light and heavy chains are responsible for antigen binding. The variable domains of the heavy chain and light chain may be referred to as “VH” and “VL” , respectively. The variable regions in both chains generally contain three highly variable loops called the complementarity determining regions (CDRs) (light chain (LC) CDRs including LC-CDR1, LC-CDR2, and LC-CDR3, heavy chain (HC) CDRs including HC-CDR1, HC-CDR2, and HC-CDR3) . CDR boundaries for the antibodies and antigen-binding fragments disclosed herein may be defined or identified by the conventions of Kabat, Chothia, or Al-Lazikani (Al-Lazikani 1997; Chothia 1985; Chothia 1987; Chothia 1989; Kabat 1987; Kabat 1991) . The three CDRs of the heavy or light chains are interposed between flanking stretches known as framework regions (FRs) , which are more highly conserved than the CDRs and form a scaffold to support the hypervariable loops. The constant regions of the heavy and light chains are not involved in antigen binding, but exhibit various effector functions. Antibodies are assigned to classes based  on the amino acid sequence of the constant region of their heavy chain. The five major classes or isotypes of antibodies are IgA, IgD, IgE, IgG, and IgM, which are characterized by the presence of α, δ, ε, γ, and μ heavy chains, respectively. Several of the major antibody classes are divided into subclasses such as lgG1 (γ1 heavy chain) , lgG2 (γ2 heavy chain) , lgG3 (γ3 heavy chain) , lgG4 (γ4 heavy chain) , lgA1 (α1 heavy chain) , or lgA2 (α2 heavy chain) .
The term “antigen-binding fragment” as used herein refers to an antibody fragment including, for example, a diabody, a Fab, a Fab’, a F (ab’) 2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv) , a (dsFv) 2, a bispecific dsFv (dsFv-dsFv’) , a disulfide stabilized diabody (ds diabody) , a single-chain Fv (scFv) , an scFv dimer (bivalent diabody) , a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure. An antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment (e.g., a parent scFv) binds. In some embodiments, an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
As is used herein, the term “targeting moiety binding fragment” or “TBF” refers to a fragment comprising a targeting moiety binding peptide ( “TBP” ) that specifically binds to a targeting moiety. The TBF may further comprise a chemical reactive moiety that can be covalently linked to the targeting moiety. In some embodiments, the TBF comprises a small molecule linker comprising the chemically reactive moiety. In some embodiments, the TBF does not comprise a chemical reactive moiety that can be covalently linked to the targeting moiety, i.e., the TBF non-covalently binds to the targeting moiety. In some embodiments, the targeting moiety binding peptide is an antibody binding peptide ( “ABP” ) , which is a polypeptide that specifically binds to an antibody. Exemplary ABPs include, but are not limited to, an FcBP-1, an FcBP-2, an Fc-III and fragments thereof. As used herein, a TBF comprising an ABP is referred herein as an “antibody binding fragment” or “ABF” .
As used herein, “link, ” “conjugate, ” “ligate” , and “fuse” are used interchangeably to refer to connection of two chemical moieties either covalently or non-covalently. The connection may be direct or indirect, e.g., through a linker.
“Fv” is the minimum antibody fragment, which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy-and one light-chain variable region domain in tight, non-covalent association. From the folding of these two  domains emanate six hypervariable loops (3 loops each from the heavy and light chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
“Single-chain Fv, ” also abbreviated as “sFv” or “scFv, ” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. In some embodiments, the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Plückthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994) .
As used herein, the term “CDR” or “complementarity determining region” is intended to mean the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252: 6609-6616 (1977) ; Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991) ; Chothia et al., J. Mol. Biol. 196: 901-917 (1987) ; Al-Lazikani B. et al., J. Mol. Biol., 273: 927-948 (1997) ; MacCallum et al., J. Mol. Biol. 262: 732-745 (1996) ; Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008) ; Lefranc M.P. et al., Dev. Comp. Immunol., 27: 55-77 (2003) ; and Honegger and Plückthun, J. Mol. Biol., 309: 657-670 (2001) , where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or grafted antibodies or variants thereof is intended to be within the scope of the term as defined and used herein. CDR prediction algorithms and interfaces are known in the art, including, for example, Abhinandan and Martin, Mol. Immunol., 45: 3832-3839 (2008) ; Ehrenmann F. et al., Nucleic Acids Res., 38: D301-D307 (2010) ; and Adolf-Bryfogle J. et al., Nucleic Acids Res., 43: D432-D438 (2015) . The contents of the references cited in this paragraph are incorporated herein by reference in their entireties for use in the present application and for possible inclusion in one or more claims herein. In some embodiments, the CDR sequences provided herein are based on IMGT definition. For example, the CDR sequences may be determined by the VBASE2 tool (www. vbase2. org/vbase2. php, see also Retter I, Althaus HH, Münch R, Müller W: VBASE2, an integrative V gene database. Nucleic Acids Res. 2005 Jan 1; 33 (Database issue) : D671-4, which is incorporated herein by reference in its entirety) .
As used herein, “treatment” or “treating” is an approach for obtaining beneficial or desired results including clinical results. For purposes of this application, beneficial or desired clinical results include, but are not limited to, one or more of the following: decreasing one more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease) , preventing or delaying the spread of the disease, preventing or delaying the occurrence or recurrence of the disease, delay or slowing the progression of the disease, ameliorating the disease state, providing a remission (whether partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing the quality of life, and/or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of the disease. The methods of the present application contemplate any one or more of these aspects of treatment.
The terms “individual, ” “subject” and “patient” are used interchangeably herein to describe a mammal, including humans. In some embodiments, the individual is human. In some embodiments, an individual suffers from a disease or condition (e.g., cancer) . In some embodiments, the individual is in need of treatment.
As is understood in the art, an “effective amount” refers to an amount of an agent (e.g., a targeting conjugate) sufficient to produce a desired therapeutic outcome (e.g., reducing the severity or duration of, stabilizing the severity of, or eliminating one or more symptoms of cancer) . For therapeutic use, beneficial or desired results include, e.g., decreasing one or more symptoms resulting from the disease (biochemical, histologic and/or behavioral) , including its complications and intermediate pathological phenotypes presented during development of the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication, delaying the progression of the disease, and/or prolonging survival of patients. In some embodiments, an effective amount of the agent may extend survival (including overall survival and progression free survival) ; result in an objective response (including a complete response or a partial response) ; relieve to some extent one or more signs or symptoms of the disease or condition; and/or improve the quality of life of the subject.
“Percent (%) amino acid sequence identity” with respect to the polypeptide and antibody sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the polypeptide being compared, after aligning the sequences considering any conservative substitutions as part of  the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, Megalign (DNASTAR) , or MUSCLE software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, %amino acid sequence identity values are generated using the sequence comparison computer program MUSCLE (Edgar, R.C., Nucleic Acids Research 32 (5) : 1792-1797, 2004; Edgar, R.C., BMC Bioinformatics 5 (1) : 113, 2004, each of which are incorporated herein by reference in their entirety for all purposes) .
An amino acid substitution may include but are not limited to the replacement of one amino acid in a polypeptide with another amino acid. Exemplary substitutions are shown in Table 1. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE 1. Exemplary Amino Acid Substitutions.
Original Residue Exemplary Substitutions
Ala (A) Val; Leu; Ile
Arg (R) Lys; Gln; Asn
Asn (N) Gln; His; Asp, Lys; Arg
Asp (D) Glu; Asn
Cys (C) Ser; Ala
Gln (Q) Asn; Glu
Glu (E) Asp; Gln
Gly (G) Ala
His (H) Asn; Gln; Lys; Arg
Ile (I) Leu; Val; Met; Ala; Phe; Norleucine
Leu (L) Norleucine; Ile; Val; Met; Ala; Phe
Lys (K) Arg; Gln; Asn
Met (M) Leu; Phe; Ile
Phe (F) Trp; Leu; Val; Ile; Ala; Tyr
Pro (P) Ala
Ser (S) Thr
Thr (T) Val; Ser
Trp (W) Tyr; Phe
Tyr (Y) Trp; Phe; Thr; Ser
Val (V) Ile; Leu; Met; Phe; Ala; Norleucine
Amino acids may be grouped according to common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
The terms “polypeptide” or “peptide” are used herein to encompass all kinds of naturally occurring and synthetic proteins, including protein fragments of all lengths, fusion proteins and modified proteins, including without limitation, glycoproteins, as well as all other types of modified proteins (e.g., proteins resulting from phosphorylation, acetylation, myristoylation, palmitoylation, glycosylation, oxidation, formylation, amidation, polyglutamylation, ADP-ribosylation, pegylation, biotinylation, etc. ) .
The term “fusion” refers to genetically joining two polypeptide fragments to provide a single continuous polypeptide ( “fusion polypeptide” ) . The two polypeptide fragments may be directly joined to each other, or joined via another polypeptide disposed therebetween. Routine recombinant DNA techniques or chemical gene synthesis can be used to provide nucleic acids that genetically encode a fusion polypeptide.
The term “epitope” as used herein refers to the specific group of atoms or amino acids on an antigen to which an antibody binds. Two antibodies or antigen binding fragments may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
As use herein, the terms “specifically binds, ” “specifically recognizing, ” and “is specific for” refer to measurable and reproducible interactions, such as binding between a target and a targeting moiety (e.g., a targeting peptide or an antibody or antigen-binding fragment thereof) . In certain embodiments, specific binding is determinative of the presence of the target in the presence of a heterogeneous population of molecules, including biological molecules (e.g., cell surface receptors) . For example, a targeting moiety that specifically recognizes a target (which can be an epitope) is a targeting moiety (e.g., antibody) that binds this target with greater affinity, avidity, more readily, and/or with greater duration than its bindings to other molecules. In some embodiments, the extent of binding of a targeting moiety to an unrelated molecule is less than about 10%of the binding of the targeting moiety to the target as measured, e.g., by a radioimmunoassay (RIA) . In some embodiments, a targeting moiety that specifically binds a target has a dissociation constant (KD) of ≤10 -5 M, ≤10 -6 M, ≤10 -7 M, ≤10 -8 M, ≤10 -9 M, ≤10 -10 M, ≤10 -11 M, or ≤10 -12 M. In some embodiments,  a targeting moiety specifically binds an epitope on a protein that is conserved among the protein from different species. In some embodiments, specific binding can include, but does not require exclusive binding. Binding specificity of the targeting moiety can be determined experimentally by methods known in the art. Such methods comprise, but are not limited to Western blots, ELISA, RIA, ECL, IRMA, EIA, BIACORETM and peptide scans.
The term “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
A “pharmaceutically acceptable carrier” refers to one or more ingredients in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, cryoprotectant, toxicity agent, preservative, and combinations thereof. Pharmaceutically acceptable carriers or excipients have preferably met the required standards of toxicological and manufacturing testing and/or are included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug administration or other state/federal government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
The term “package insert” is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
An “article of manufacture” is any manufacture (e.g., a package or container) or kit comprising at least one reagent, e.g., a medicament for treatment of a disease or condition (e.g., cancer) , or a probe for specifically detecting a biomarker described herein. In certain embodiments, the manufacture or kit is promoted, distributed, or sold as a unit for performing the methods described herein.
It is understood that embodiments of the invention described herein include “consisting” and/or “consisting essentially of” embodiments.
Reference to “about” a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X” .
As used herein, reference to “not” a value or parameter generally means and describes "other than" a value or parameter. For example, the method is not used to treat disease of type X means the method is used to treat disease of types other than X.
The term “about X-Y” used herein has the same meaning as “about X to about Y. ”
As used herein and in the appended claims, the singular forms “a, ” “an, ” or “the” include plural referents unless the context clearly dictates otherwise.
The term “and/or” as used herein a phrase such as “A and/or B” is intended to include both A and B; A or B; A (alone) ; and B (alone) . Likewise, the term “and/or” as used herein a phrase such as “A, B, and/or C” is intended to encompass each of the following embodiments: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone) ; B (alone) ; and C (alone) .
II. Targeting conjugates
One aspect of the present application provides a targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein the effector molecule can be released from the targeting conjugate via cleavage.
In some embodiments, there is provided a targeting conjugate comprising the structure of Formula I:
Figure PCTCN2021077866-appb-000008
wherein: wherein: A is a targeting moiety that specifically binds to the target molecule; B is a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide; P is a cleavage site; L is a linker; C is a conjugation site; D is an effector molecule; L is a linker; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; d=1-20.
Exemplary targeting conjugates are shown in FIGs. 1A-3B, and described in section F, “Exemplary targeting conjugates” below.
The targeting moiety (A) of the present application is conjugated to one or more effector molecules (D) , which may be therapeutic agents, oligonucleotides, detectable labels and combinations thereof. In some embodiments, the effector molecule is conjugated to the targeting moiety via a targeting moiety binding fragment (B) . In some embodiments, the effector molecule is conjugated to the targeting moiety binding fragment at a conjugation site (C) . In some embodiments, a cleavage site (P, e.g., a protease cleavage site) is disposed  between the conjugation site (C) and the targeting moiety binding fragment (B) . In some embodiments, no cleavage site (P, e.g., a protease cleavage site) is disposed between the conjugation site (C) and the targeting moiety binding fragment (B) . In some embodiments, the effector molecule is conjugated to the targeting moiety binding fragment (B) at a conjugation site endogenous to the TBF. In some embodiments, the effector molecule is conjugated at the conjugation site (C) via a linker (L) . In some embodiments, the effector molecule is conjugated to the targeting moiety at a conjugation site (C) directly without a linker (L) . In some embodiments, a cleavage site (P, e.g., a protease cleavage site) is disposed between the conjugation site (C) and the effector molecule (D) . In some embodiments, there is no cleavage site (P, e.g., a protease cleavage site) .
In some embodiments, there is provided a targeting conjugate comprising the structure of Formula I:
Figure PCTCN2021077866-appb-000009
wherein: A is an antibody or antigen binding fragment thereof; B is an antibody binding fragment (ABF) (e.g., an Fc binding peptide) comprising an antibody binding peptide; P is a cleavage site (e.g., a protease cleavage site such as a uPA cleavage site) ; C is a conjugation site (e.g., a transglutaminase conjugation site) ; L is a linker; D is an effector molecule (e.g., a therapeutic agent, an oligonucleotide or a detectable label) ; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; d=1-20. In some embodiments, A is a multispecific (e.g., bispecific antibody) . In some embodiments, A is an antibody or antigen binding fragment that specifically binds to an immune checkpoint molecule, such as PD-L1. In some embodiments, B is covalently conjugated to A. In some embodiments, B is non-covalently conjugated to A.
In some embodiments, there is provided a targeting conjugate comprising: (a) a first polypeptide chain comprising a first heavy chain of an anti-PD-L1 antibody; (b) a second polypeptide chain comprising a second heavy chain of the anti-PD-L1 antibody; (c) a third polypeptide chain comprising a first light chain of the anti-PD-L1 antibody; (d) a fourth polypeptide chain comprising a second light chain of the anti-PD-L1 antibody; (e) a first moiety comprising a first antibody binding fragment (ABF) conjugated to a first effector molecule via a first conjugation site, wherein the first ABF comprises a first ABP that specifically binds to the first heavy chain of the anti-PD-L1 antibody; and (f) a second moiety comprising a second ABF conjugated to a second effector molecule via a second conjugation site, wherein the second ABF comprises a second ABP that that specifically binds to the  second heavy chain of the anti-PD-L1 antibody. In some embodiments, the first moiety is covalently linked to the first heavy chain of the anti-PD-L1 antibody, and/or the second moiety is covalently linked to the second heavy chain of the anti-PD-L1 antibody. In some embodiments, the first moiety is non-covalently linked to the first heavy chain of the anti-PD-L1 antibody, and/or the second moiety is non-covalently linked to the second heavy chain of the anti-PD-L1 antibody. In some embodiments, the first moiety and/or the second moiety comprises a structure represented by ABF- (PEG)  n-P i-OBP j, wherein P is a cleavage site and OBP is an oligonucleotide binding peptide, and wherein n ≥ 0, i = 0 or 1, j = 0 or 1. In some embodiments, the first moiety and/or the second moiety comprises a structure represented by the formula: ABF-R- (PEG)  m-VC-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the first moiety and/or the second moiety comprises a structure represented by the formula ABF-R- (PEG)  m-P-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, P is a cleavage site, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the first ABF and/or the second ABF comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 75-79, 152, and 156. In some embodiments, the first moiety and/or the second moiety comprises a structure represented by a formula selected from the group consisting of Formulae (13) - (26) (e.g., TBP1-TBP14) . In some embodiments, the first moiety and/or the second moiety comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) . In some embodiments, the first effector molecule and the second effector molecule are identical. In some embodiments, the first effector molecule and the second effector molecule are different. In some embodiments, the first effector molecule (including the first linker) , and/or the second effector molecule (including the second linker) is a therapeutic agent selected from SN38, MMAE and derivatives thereof, e.g., compounds of Formulae (1) - (6) . In some embodiments, the first effector molecule and/or the second effector molecule is an oligonucleotide, such as a CpG oligonucleotide. In some embodiments, the CpG oligonucleotide comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs: 66-67. In some embodiments, the oligonucleotide is conjugated to the TBF via an oligonucleotide binding polypeptide. In some embodiments, the oligonucleotide binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65. In some embodiments, the first effector molecule and/or the second effector molecule is a detectable label. In some embodiments, two or more effector molecules are conjugated to the first conjugation site and/or the second conjugation site. In some  embodiments, the cleavage site comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 50-55. In some embodiments, the first polypeptide and/or the second polypeptide comprises an amino acid sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%, or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 100, 102, 104, 106, 108, 110, and 112. In some embodiments, the third polypeptide and/or the fourth polypeptide comprises an amino acid sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%, or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 101, 103, 105, 107, 109, 111, and 113.
In some embodiments, the targeting conjugate may comprise any suitable number of the cleavage sites (P) , the conjugation sites (C) , the linkers (L) , and the effector molecules (D) . In some embodiments, the number of cleavage site P can be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, the number of the conjugation site C can be any one of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, the number of linker L can be any one of 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, the number of the effector molecules D can be any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
The target conjugate may comprise any one of the targeting moiety, targeting moiety binding fragments, conjugation sites, cleavage sites (e.g., protease cleavage sites) , linkers, and effector molecules described in sections A-E described below.
In some embodiments, the targeting conjugate comprises a single effector molecule. In some embodiments, the targeting conjugate comprises a plurality of effector molecules. In some embodiments, the targeting conjugate comprises a single molecule of the effector molecule. In some embodiments, the targeting conjugate comprises two or more of the same effector molecule. In some embodiments, the targeting conjugate comprises two or more different effector molecules. In some embodiments, the targeting conjugate comprises a single copy of each effector molecule. In some embodiments, the targeting conjugate comprises two or more copies of each effector molecule.
In some embodiments, the targeting conjugate has a high drug loading. The term “drug loading” refers to the ratio between the number of effector molecules to the targeting moiety (e.g., an antibody or antigen-binding fragment thereof) in the targeting conjugate. For example, an antibody conjugated to a total of 8 effector molecules has a drug loading of 8.  Each molecule of a targeting conjugate has an integer value of drug loading. However, in a composition, different molecules of a targeting conjugate may have different values of drug loading. Thus, a composition may have an average drug loading of an integer value or a non-integer value.
In some embodiments, the drug loading of the targeting conjugate is at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 60: 1, 70: 1, 80: 1, 90: 1, 100: 1 or more. In some embodiments, the drug loading of the targeting conjugate is no more than about any one of 100: 1, 90: 1, 80: 1, 70: 1, 60: 1, 50: 1, 40: 1, 30: 1, 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1. In some embodiments, the drug loading of the targeting conjugate is about any one of 2: 1-4: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-9: 1, 2: 1-8: 1, 2: 1-7: 1, 2: 1-6: 1, 2: 1-5: 1, 2: 1-4: 1, 2: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 20: 1-40: 1, 40: 1-100: 1, 2: 1-20: 1, 2: 1-40: 1, or 10: 1-40: 1.
In some embodiments, the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, or 20: 1. In some embodiments, the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of no more than about any one of 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1. In some embodiments the targeting conjugate has a ratio of the effector molecule (e.g., therapeutic agent, oligonucleotide and/or detectable label) to the targeting moiety of about any one of 1: 1-2: 1, 2: 1-4: 1, 4: 1-8: 1, 1: 1-10: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-9: 1, 2: 1-8: 1, 2: 1-7: 1, 2: 1-6: 1, 2: 1-5: 1, 2: 1-4: 1, 1: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 1: 1-20: 1, or 2: 1-20: 1.
Also provided are methods of preparing the targeting conjugate, comprising conjugating an effector molecule to a targeting moiety.
A. Targeting moiety
The targeting conjugates of the present applications comprise one or more targeting moieties.
Antibody or antigen-binding fragment thereof
In some embodiments, the targeting moiety comprises an antibody, or an antigen binding fragment thereof. In some embodiments, the target moiety is a fusion protein  comprising an antibody or antigen binding fragment thereof. In some embodiments, the targeting moiety is a monoclonal antibody. In some embodiments, the targeting moiety is a full-length antibody. In some embodiments, the targeting moiety is an antigen-binding fragment. Exemplary antigen-binding fragments include, but are not limited to, a single-chain Fv (scFv) , a Fab, a Fab’, a F (ab’)  2, an Fv, a disulfide stabilized Fv fragment (dsFv) , a (dsFv)  2, a single-domain antibody (e.g., VHH) , an Fv-Fc fusion, an scFv-Fc fusion, an scFv-Fv fusion, a diabody, a tribody, and a tetrabody.
In some embodiments, the targeting moiety comprises an scFv. In some embodiments, the scFv comprises from the N-terminus to the C-terminus: VL-VH, wherein the dash is a bond or a peptide linker. In some embodiments, the scFv comprises from the N-terminus to the C-terminus: VH-VL, wherein the dash is a bond or a peptide linker. In some embodiments, the targeting moiety is a fusion protein comprising an scFv. In some embodiments, the fusion protein is an scFv-Fc fusion protein. In some embodiments, the fusion protein is an scFv-Fv fusion protein. In some embodiments, the fusion protein is an scFv-full length antibody fusion protein. In some embodiments, the N terminus of the scFv is covalently fused to the C-terminus of a heavy chain or a light chain of a full length antibody.
In some embodiments, the targeting moiety is a Fab or Fab’. In some embodiments, the targeting moiety is a Fab-containing polypeptide, which may comprise part or all of a wild-type hinge sequence (generally at the carboxyl terminus of the Fab portion of the polypeptide) . A Fab-containing polypeptide may be obtained or derived from any suitable immunoglobulin. In some embodiments, a Fab-containing polypeptide may be a Fab-fusion protein that combines a Fab fragment with a fusion partner, such as the target-binding region of a receptor, an adhesion molecule, a ligand, an enzyme, a cytokine, a chemokine, or some other protein or protein domain. In some embodiments, the targeting peptide is a domain or a portion of a target protein.
In some embodiments, the targeting moiety comprises a nanobody, also known as a single domain antibody (sdAb) . Exemplary sdAbs include, but are not limited to, heavy chain variable domains from heavy-chain only antibodies (e.g., VHH or V NAR) , binding molecules naturally devoid of light chains, single domains (such as VH or VL) derived from conventional 4-chain antibodies, humanized heavy-chain only antibodies, human sdAbs produced by transgenic mice or rats expressing human heavy chain segments, and engineered domains and single domain scaffolds other than those derived from antibodies. In some embodiments, the targeting moiety comprises a VHH.
In some embodiments, the targeting moiety comprises a multispecific antibody. In some embodiments, the targeting moiety is a multispecific antibody. In some embodiments, the multispecific antibody is a bispecific antibody. Exemplary bispecific antibodies include full-length and Fab2 constructs, as well as diabodies. In some embodiments, the diabody is a noncovalent dimer of single-chain Fv (scFv) fragments connected by a peptide linker. In some embodiments, another form of diabody is single-chain (Fv) , in which two scFv fragments are covalently linked to each other. In some embodiments, the multispecific antibody is a trispecific antibody. Exemplary trispecific antibodies include Fab3 and triabodies, with the latter being the three-scFv-version of diabodies. In some embodiments, scFv-Fc are made of two linked single chain variable fragments fused to an intact Fc region. In some embodiments, minibodies are similar to scFv-Fc, but only contain a CH1 domain rather than a full Fc region. Other multivalent constructs include IgNAR and hcIgG.
In some embodiments, the targeting conjugate comprises a first targeting moiety that specifically binds to a first target molecule a second targeting moiety that specifically binds to a second target molecule. In some embodiments, the first targeting moiety and the second targeting moiety are identical. In some embodiments, the first targeting moiety and the second targeting moiety are different. In some embodiments, the first targeting moiety and the second targeting moiety specifically bind to the same targeting molecule. In some embodiments, the first targeting moiety and the second targeting moiety specifically bind to different targeting molecule. In some embodiments, a cleavage site (e.g., a protease cleavage site) is disposed between the first targeting moiety and the second targeting moiety.
In some embodiments, the targeting moiety is a chimeric, human, partially humanized, fully humanized, or semi-synthetic antibody. Antibodies and/or antibody fragments may be derived from murine antibodies, rabbit antibodies, human antibodies, fully humanized antibodies, camelid antibody variable domains and humanized versions, shark antibody variable domains and humanized versions, and camelized antibody variable domains. In some embodiments, the targeting moiety is an antagonist antibody or antigen-binding fragment thereof. In some embodiments, the targeting moiety is an agonist antibody or antigen-binding fragment thereof.
In some embodiments, the antibody or antigen-binding fragment thereof comprises one or more antibody constant regions, such as human antibody constant regions. In some embodiments, the heavy chain constant region is of an isotype selected from IgA, IgG, IgD, IgE, and IgM. In some embodiments, the human light chain constant region is of an isotype selected from κ and λ. In some embodiments, the antibody or antigen-binding fragment  thereof comprises an IgG constant region, such as a human IgG1, IgG2, IgG3, or IgG4 constant region. In some embodiments, when effector function is desirable, an antibody comprising a human IgG1 heavy chain constant region or a human IgG3 heavy chain constant region may be selected. In some embodiments, when effector function is not desirable, an antibody comprising a human IgG4 or IgG2 heavy chain constant region may be selected. In some embodiments, the antibody comprises a human IgG4 heavy chain constant region.
In some embodiments, the antibody or antigen binding fragment thereof comprises a stabilizing domain. In some embodiments, the stabilizing domain comprises an Fc domain. The term “Fc region, ” “Fc domain” or “Fc” refers to a C-terminal non-antigen binding region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native Fc regions and variant Fc regions. In some embodiments, the Fc domain is selected from the group consisting of Fc fragments of IgG, IgA, IgD, IgE, IgM, and combinations and hybrids thereof. In some embodiments, the Fc domain is derived from a human IgG. In some embodiments, the Fc domain comprises the Fc domain of human IgG1, IgG2, IgG3, IgG4, or a combination or hybrid IgG. In some embodiments, the Fc domain has a reduced effector function as compared to corresponding wild type Fc domain (such as at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, or 95%reduced effector function as measured by the level of antibody-dependent cellular cytotoxicity (ADCC) ) . In some embodiments, a human IgG heavy chain Fc region extends from Cys226 to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present, without affecting the structure or stability of the Fc region. In some embodiments, the targeting moiety comprises a variant Fc region has at least one amino acid substitution compared to the Fc region of a wild type IgG or a wild-type antibody.
An antibody may consist of two identical light protein chains (light chains) and two identical heavy protein chains (heavy chains) , all held together covalently by interchain disulfide linkages. The N-terminal regions of the light and heavy chains together can form the antigen recognition site of the antibody. Structurally, various functions of an antibody can be confined to discrete protein domains or regions. In some embodiments, the antibody comprises an antigen binding portion comprises a heavy chain comprising the VH and a light chain comprising the VL. Antigen-binding antigen binding fragments, including single-chain antibodies, may comprise the variable region (s) alone or in combination with the entirety or a portion of the following: hinge region, CH1, CH2, and CH3 domains.
In some embodiments, the antibody is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody  may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed. In some embodiments, the antibody is altered to increase or decrease the reactivity of the reactive functional groups on the antibody. In some embodiments, the antibody is altered to increase or decrease the number of reactive functional groups. In some embodiments, the antibody is altered to increase or decrease the extent to which reactive functional groups are exposed. The reactive functional groups can be at the N terminus, the C terminus, or in the sidechains of the amino acids of the antibody. The reactive functional group can be naturally occurring in the antibody or incorporated. The reactive functional group can be an amine or a derivative thereof, a carboxyl group or a derivative thereof, a nitro, or other functional groups. In some embodiments, the reactive functional group is an amine. In some embodiments, the amine is in the Fc region of the antibody.
Antibodies that specifically bind to a target molecule can be obtained using methods known in the art, such as by immunizing a non-human mammal and obtaining hybridomas therefrom, or by cloning a library of antibodies using molecular biology techniques known in the art and subsequence selection or by using phage display. Nucleic acid constructs encoding any one of the antibodies or antigen-binding fragments described herein, vectors, and host cells for preparation are also provided.
Targeting peptide
In some embodiments, the targeting moiety comprises a targeting peptide. The term “targeting peptide” refers to a non-antibody based polypeptide that specifically binds to a target molecule, e.g., a cell surface molecule at a target site. In some embodiments, the targeting moiety is a fusion protein comprising an antibody or antigen-binding fragment thereof fused to a targeting peptide.
In some embodiments, the targeting polypeptide comprises a non-antibody scaffold. Non-antibody scaffolds are engineered protein scaffolds that yield specificities towards different kinds of targets. Compared with antibodies, engineered protein scaffolds offer a much smaller size and simpler architecture that facilitates recombinant gene expression, the construction of bifunctional fusion proteins, and tissue penetration. See, for example, Skerra, Curr. Opin. Biotech. 2007, 18: 298-304. Over 50 different non-antibody scaffolds have been reported. See, for example, Vazquez-Lombardi, Rodrigo, et al. Drug discovery today 20.10 (2015) : 1271-1283. Exemplary non-antibody scaffolds include, but are not limited to, a lipocalin, an anticalin (artificial antibody mimetic proteins that are derived from human  lipocalins) , 'T-body' , a peptide (e.g., a BICYCLE TM peptide) , an affibody (antibody mimetics composed of alpha helices, e.g. an three-helix bundle) , a peptibody (peptide-Fc fusion) , a DARPin (designed ankyrin repeat proteins, engineered antibody mimetic proteins consisting repeat motifs) , an affimer, an avimer, a knottin (aprotein structural motif containing 3 disulfide bridges) , a monobody, an affinity clamp, an ectodomain, a receptor ectodomain, a receptor, a cytokine, a ligand, an immunocytokine, and a centryin. See, for example, WO2019084060, which is incorporated herein by reference.
In some embodiments, the targeting moiety comprises an anticalin. Anticalins are among the more actively developed non-antibody scaffolds, with a high number of lead compounds under preclinical development directed against CTLA-4, hepcidin, hepatocyte growth factor receptor (HGFR; MET) , IL-4Ra and IL-23/IL-17. PRS-050 (
Figure PCTCN2021077866-appb-000010
Pieris) , is an antiangiogenic Anticalin targeting VEGF-A currently undergoing Phase I clinical investigation. A VEGF-A targeting DARPin, MP0112 (Molecular Partners/Allergan) targeting retinal angiogenic disorders, is also currently being assessed in clinical studies. FDA-approved single non-antibody scaffolds include the Kunitz domain 
Figure PCTCN2021077866-appb-000011
(ecallantide; Dyax) , a plasma kallikrein inhibitor used for the treatment of hereditary angioedema; 
Figure PCTCN2021077866-appb-000012
 (CSL-Behring) , and 
Figure PCTCN2021077866-appb-000013
 (ViroPharma/Shire) , as well as the bradykinin receptor antagonist 
Figure PCTCN2021077866-appb-000014
 (Shire) . See, for example, Vazquez-Lombardi, Rodrigo, et al. Drug discovery today 20.10 (2015) : 1271-1283.
In some embodiments, the targeting peptide comprises a polypeptide derived from a receptor or a ligand of the target molecule. In some embodiments, the targeting polypeptide is an inhibitory polypeptide that blocks the binding of the target molecule and its ligand or receptor completely or partially such as by at least about any one of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 95%. In some embodiments, the targeting peptide is at least about any one of 2, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500 or more amino acids in length.
In some embodiments, the targeting peptide comprises a stabilizing domain. The stabilizing domain can be any suitable domain that stabilizes the targeting peptide. In some embodiments, the stabilizing domain extends the half-life of the targeting peptide in vivo. In some embodiments, the stabilizing domain is an Fc domain, such as any one of the Fc domains described in the “Antibodies or antigen-binding fragment thereof” section. In some embodiments, the stabilizing domain is an albumin domain. In some embodiments, the targeting peptide and the stabilization domain are fused to each other via a linker, such as a peptide linker.
A peptide linker may have a naturally occurring sequence, or a non-naturally occurring sequence. For example, a sequence derived from the hinge region of heavy chain only antibodies may be used as the linker. The peptide linker can be of any suitable length. In some embodiments, the peptide linker tends not to adopt a rigid three-dimensional structure, but rather provide flexibility to a polypeptide. In some embodiments, the peptide linker is a flexible linker. Exemplary flexible linkers include glycine polymers, glycine-serine polymers, glycine-alanine polymers, alanine-serine polymers, and other flexible linkers known in the art. In some embodiments, the peptide linker comprises substrate sequences for enzymatic reactions. In some embodiments, the peptide linker comprises substrate sequences for enzymes that ligates the targeting peptide and a stabilizing domain.
The targeting peptide may be obtained using known methods in the art, such as by screening a library of polypeptides. The polypeptides can be prepared using chemical synthesis or produced using recombinant DNA techniques. Nucleic acid constructs encoding any one of the targeting peptides described herein, vectors, and host cells for preparation are also provided.
Target molecule and exemplary targeting moieties
The targeting moiety specifically binds to one or more target molecules. In some embodiments, the targeting moiety is monospecific, i.e., specifically binds to a single target molecule. In some embodiments, the targeting moiety is multispecific, i.e., specifically binds to two or more different target sites in a single target molecule, or two or more different target molecules. In some embodiments, the targeting moiety has a single target binding site. In some embodiments, the targeting moiety has two or more target binding sites.
In some embodiments, the targeting moiety specifically binds to a cell surface molecule. In some embodiments, the cell surface molecule is a cell surface molecule at a target site. In some embodiments, the target site is site of a disease. In some embodiments, the disease is a tumor. In some embodiments, the disease is an inflammatory disease. In some embodiments, the disease is a fibrotic disease. In some embodiments, the disease is an infection. In some embodiments, the disease is an autoimmune disease. In some embodiments, the disease is an immunodeficiency disease.
Exemplary target molecules include but are not limited to proteins, glycans, lipids, other small molecules, or a combination thereof. In some embodiments, the cell surface molecule is a tumor-specific marker/tumor antigen. As described herein, a “tumor-specific marker” or a "tumor antigen" refers to a molecular marker that can be expressed on a  neoplastic tumor cell and/or within a tumor microenvironment. A tumor antigen can be a tumor specific antigen and/or a tumor associated antigen. For example, a tumor antigen can be an antigen expressed on a cell associated with a tumor, such as a neoplastic cell, stromal cell, endothelial cell, fibroblast, or tumor-infiltrating immune cell. For example, the tumor antigen Her2/Neu can be overexpressed by certain types of breast and ovarian cancer. A tumor antigen can also be ectopically expressed by a tumor and contribute to deregulation of the cell cycle, reduced apoptosis, metastasis, and/or escape from immune surveillance. Tumor antigens are generally proteins or polypeptides derived therefrom, but can be glycans, lipids, or other small organic molecules. Additionally, a tumor antigen can arise through increases or decreases in post-translational processing exhibited by a cancer cell compared to a normal cell, for example, protein glycosylation, protein lipidation, protein phosphorylation, or protein acetylation.
In some embodiments, the tumor antigen is a cell-surface carbohydrate. In some embodiments, the cell-surface carbohydrate is a monosaccharide. In some embodiments, the cell-surface glycan is an oligosaccharide. In some embodiments, the cell-surface carbohydrate is a polysaccharide. In some embodiments, the cell-surface carbohydrate is a glycan. In some embodiments, the cell-surface carbohydrate is a glycoconjugate, such as a glycoprotein, glycolipid, or a proteoglycan. In some embodiments, the cell-surface glycan is selected from the group consisting of GD2, GD3, GM2, Le y, sLe, polysialic acid, fucosyl GMl, Tn, STn, BM3, or GloboH.
In some embodiments, the tumor antigen is a cell-surface protein. In some embodiments, the cell-surface protein is selected from the group consisting of CD5, CD19, CD20, CD25, CD37, CD30, CD33, CD45, CAMPATH-1, BCMA, CS-1, PD-1, PD-Ll, B7-H3, B7-DC (PD-L2) , HLA-DR, carcinoembryonic antigen (CEA) , TAG-72, MUC1, MUC15, MUC16, folate-binding protein, A33, G250, prostate specific membrane antigen (PSMA) , CA-125, CA19-9, epidermal growth factor, HER2, IL-2 receptor, EGFRvIII (de2-7 EGFR) , EGFR, fibroblast activation protein (FAP) , tenascin, a metalloproteinase, endosialin, vascular endothelial growth factor, avβ3, WTl, LMP2, HPV E6, HPV p53 nonmutant, NY-ESO-1, GLP-3, MelanA/MARTl, Ras mutant, gpl00, p53 mutant, PRI, bcr-abl, tyrosinase, survivin, PSA, hTERT, STNI, TNC, a Sarcoma translocation breakpoint fusion protein, EphA2, PAP, ML-IAP, AFP, ERG, NAI 7, PAX3, ALK, androgen receptor, cyclin Bl, MYCN, RhoC, TRP-2, mesothelin (MSLN) , PSCA, MAGE Al, MAGE-A3, CYPIBI, PLAVI, BORIS, Tn, ETV6-AN1L, NY-BR-1, RGS5, SART3, Carbonic anhydrase IX, PAX5, OY-TESI, Sperm protein 17, LCK, MAGE C2, MAGE A4, GAGE, TRAILI, HMWMAA, AKAP-4, SSX2,  XAGE 1, B7H3, Legumain, Tie 3, PAGE4, VEGFR2, MAD-CTI, PDGFR-B, MAD-CT-2, ROR2, CMET, HER3, EPCAM, CA6, NAPI2B, TROP2, Claudin-6 (CLDN6) , Claudin-16 (CLDN16) , CLDN18.2, RON, LY6E, FRA, DLL3, PTK7, Uroplakin-IB (UPKIB) , LIVI, RORI, STRA6, TMPRSS3, TIV1PRSS4, TIV1EM238, Clorf186, Fos-related antigen 1, VEGFRI, endoglin, VTCNI (B7-H4) , VISTA, and fragments thereof.
In some embodiments, the tumor antigen is selected from the group consisting of PD1, PD-L1, Trop2, CTLA-4, LAG-3, TIM-3, 4-1BB, CD40, OX40, CD47, SIRPα, HER2, HER3, EGFR, VEGF, VEGR2, CD19, CD20, CD22, CD30, CD33, CD38, CD79, integrin αvβ3, αvβ6, MUC1, PMSA, uPAR, and Angiopep-2. In some embodiments, the tumor antigen is Trop2. Trop-2, also known as epithelial glycoprotein-1, gastrointestinal antigen 733-1, membrane component surface marker-1, and tumor-associated calcium signal transducer-2, is the protein product of the TACSTD2 gene. Trop-2 is a transmembrane glycoprotein that is upregulated in all cancer types independent of baseline levels of Trop-2 expression. Trop-2 is an ideal candidate for targeted therapeutics due to it being a transmembrane protein with an extracellular domain overexpressed on a wide variety of tumors as well as its upregulated expression relative to normal cells. See, for example, Onco Targets Ther. 2019; 12: 1781–1790.
In some embodiments, the target molecule is associated with fibrotic or inflammatory disease. In some embodiments, the target molecule is selected from the group consisting of Cadherin 11, PDPN, LRRC15, Integrin a, 4f37, Integrin a2f31, MADCAM, Nephrin, Podocin, IFNARI, BDCA2, CD30, c-KIT, FAP, CD73, CD38, PDGFRf3, Integrin avf31, Integrin avf33, Integrin avf38, GARP, Endosialin, CTGF, Integrin avf36, CD40, PD-1, TIM-3, TNFR2, DEC205, DCIR, CD86, CD45RB, CD45RO, MHC Class II, CD25, LRRC15, MMP14, GPX8, and F2RL2.
In some embodiments, the target molecule is associated with an infection or an immunodeficiency disease. In some embodiments, the target molecule is a protein of an infectious agent, such as a pathogenic bacterium or a virus.
In some embodiments, the targeting moiety specifically binds to an immune checkpoint protein. Immune checkpoint proteins regulate immune activation. However, some cancers can protect themselves from attack by stimulating immune checkpoint targets. See, for example, Nature Reviews. Cancer. 12 (4) : 252–64. Inhibitory checkpoint molecules are targets for cancer immunotherapy due to their potential for use in multiple types of cancers. In some embodiments, the targeting moiety comprises an immune checkpoint inhibitor. Immune checkpoint inhibitors are compounds that inhibit the activity of control mechanisms  of the immune system. Immune system checkpoints, or immune checkpoints, are inhibitory pathways in the immune system that generally act to maintain self-tolerance or modulate the duration and amplitude of physiological immune responses to minimize collateral tissue damage. Immune checkpoint inhibitors can inhibit an immune system checkpoint by stimulating the activity of a stimulatory checkpoint molecule, or inhibiting the activity of an inhibitory checkpoint molecule in the pathway. Immune system checkpoint molecules include, but are not limited to, cytotoxic T-lymphocyte antigen 4 (CTLA-4) , programmed cell death 1 protein (PD-1) , programmed cell death 1 ligand 1 (PD-L1) , programmed cell death 1 ligand 2 (PD-L2) , lymphocyte activation gene 3 (LAG3) , B7-1, B7-H3, B7-H4, T cell membrane protein 3 (TIM3) , B-and T-lymphocyte attenuator (BTLA) , V-domain immunoglobulin (Ig) -containing suppressor of T-cell activation (VISTA) , Killer-cell immunoglobulin-like receptor (KIR) , and A2A adenosine receptor (A2aR) . As such, immune checkpoint inhibitors include antagonists of CTLA-4, PD-1, PD-L1, PD-L2, LAG3, B7-1, B7-H3, B7-H4, BTLA, VISTA, KIR, A2aR, and TIM3. For example, antibodies that bind to CTLA-4, PD-1, PD-L1, PD-L2, LAG3, B7-1, B7-H3, B7-H4, BTLA, VISTA, KIR, A2aR, or TIM3 and antagonize their function are immune checkpoint inhibitors.
In some embodiments, the targeting moiety comprises an antibody or antigen-binding fragment that specifically binds to an immune checkpoint molecule. In some embodiments, the targeting moiety comprises an anti-PD-L1 antibody or antigen binding fragment thereof. In some embodiments, the anti-PD-L1 antibody is derived from any anti-PD-L1 antibodies known in the art. Exemplary anti-PD-L1 antibodies include, but are not limited to, atezolizumab, avelumab, durvalumab (imfinzi) , BGB-A333, SHR-1316 (HTI-1088) , CK-301, BMS-936559, envafolimab (KN035, ASC22) , CS1001, MDX-1105 (BMS-936559) , LY3300054, STI-A1014, FAZ053, CX-072, INCB086550, GNS-1480, CA-170, CK-301, M-7824, HTI-1088 (HTI-131 , SHR-1316) , MSB-2311, AK-106, AVA-004, BBI-801, CA-327, CBA-0710, CBT-502, FPT-155, IKT-201, IKT-703, 10-103, JS-003, KD-033, KY-1003, MCLA-145, MT-5050, SNA-02, BCD-135, APL-502 (CBT-402 or TQB2450) , IMC-001, KD-045, INBRX-105, KN-046, IMC-2102, IMC-2101, KD-005, IMM-2502, 89Zr-CX-072, 89Zr-DFO-6E11, KY-1055, MEDI-1109, MT-5594, SL-279252, DSP-106, Gensci-047, REMD-290, N-809, PRS-344, FS-222, GEN-1046, BH-29xx, FS-118, biosimilars thereof, and derivatives thereof. In some embodiments, the antibodies that compete with any of these art-recognized antibodies for binding to PD-L1 also can be used. In some embodiments, the anti-PD-L1 antibody is a derivative of any one of the anti-PD-L1  antibodies described herein. In some embodiments, the anti-PD-L1 antibody is derived from an antibody selected from the group consisting of durvalumab, atezolizumab, and avelumab.
In some embodiments, the anti-PD-L1 antibody is derived from durvalumab. In some embodiments, the targeting moiety binds competitively to the same or substantially the same epitope as durvalumab. In some embodiments, the anti-PD-L1 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of RYWMS (SEQ ID NO: 86) , a CDR H2 comprising the amino acid sequence of NIKQDGSEKYYVDSVKG (SEQ ID NO: 87) , and a CDR H3 comprising the amino acid sequence of EGGWFGELAFDY (SEQ ID NO: 88) ; and wherein the VL comprises a CDR L1 comprising the amino acid sequence of RASQRVSSSYLA (SEQ ID NO: 89) , a CDR L2 comprising the amino acid sequence of DASSRAT (SEQ ID NO: 90) , and a CDR L3 comprising the amino acid sequence of QQYGSLPWT (SEQ ID NO: 91) . In some embodiments, the anti-PD-L1 antibody comprises a heavy chain comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQ ID NO: 84) and/or a light chain comprising the amino acid sequence of EIVLTQSPGTLSLSPGERATLSCRASQRVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 85) .
In some embodiments, the anti-PD-L1 antibody is derived from atezolizumab. In some embodiments, the targeting moiety binds competitively to the same or substantially the same epitope as atezolizumab. In some embodiments, the anti-PD-L1 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of DSWIH (SEQ ID NO: 94) , a CDR H2 comprising the amino acid sequence of WISPYGGSTYYADSVKG (SEQ ID NO: 95) , and a CDR H3 comprising the amino acid sequence of RHWPGGFDY (SEQ ID NO: 96) ; and wherein the VL comprises a CDR L1  comprising the amino acid sequence of RASQRVSSSYLA (SEQ ID NO: 97) , a CDR L2 comprising the amino acid sequence of DASSRAT (SEQ ID NO: 98) , and a CDR L3 comprising the amino acid sequence of QQYGSLPWT (SEQ ID NO: 99) . In some embodiments, the anti-PD-L1 antibody comprises a heavy chain comprising the amino acid sequence of EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO: 92) , and/or a light chain comprising the amino acid sequence of DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 93) .
In some embodiments, the targeting moiety comprises a variant of the targeting moieties described herein. For example, a variant of an antibody may comprise one or more modifications of the amino acid sequences of an illustrative antibody ( “parent antibody” ) while conserving the overall molecular structure of the parent antibody amino acid sequence. Amino acid sequences of any regions of the parent antibody chains may be modified, such as framework regions, CDR regions, or constant regions. Types of modifications include substitutions, insertions, deletions, or combinations thereof, of one or more amino acids of the parent antibody. In some embodiments, the antibody variant comprises a CDR (e.g., CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, or CDR L3) having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) sequence identity to the corresponding CDR of a parent antibody. In some embodiments, the antibody variant comprises a VH comprising an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the VH of a parent antibody. In some embodiments, the antibody variant comprises a VL comprising an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the VL of a parent  antibody. In some particular embodiments, the antibody variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 additions and/or deletions to an amino acid sequence as set forth in any of the VH, VL, heavy chain or light chain of a parent antibody.
In some embodiments, the targeting moiety specifically binds to a calcium signal transducer. Intracellular calcium signal transducer is involved in cell signaling, migration, proliferation, and differentiation. It has been shown that intracellular calcium signal transducers have oncogenic potential via its capacity to upregulate various proto-oncogenes and cell cycle-related pathways. In some embodiments, the intracellular calcium signal transducer is a tumor-associated calcium signal transducer. Tumor-associated calcium signal transducers are targets for cancer immunotherapy due to their differential expression in multiple types of cancers. In some embodiments, the targeting moiety specifically binds to tumor-associated calcium signal transducer 2 (Trop-2) .
Trop-2 is also known as trophoblast cell-surface antigen 2, M1S1, GA733-1, EGP-1, or TACSTD2. Trop-2 is a cell surface glycoprotein originally identified in human placental trophoblast and subsequently found to be highly expressed in most human carcinomas, but showed only restricted or limited expression in normal adult tissues. See, e.g., Varughese et al., Gynecologic Oncology, 122: 171-177, 2011. Without being bound by any theory or hypothesis, Trop-2 is involved in several cell signaling pathways, of which many are associated with tumorigenesis. For example, in thyroid cancer cell invasion, Trop-2 signal transduction has been seen as a downstream effect of the ERK and JNK pathways. Stoyanova et al. demonstrated that Trop-2 signaling enhances stem cell-like properties of cancer cells, as Trop-2 regulates proliferation and self-renewal through b-catenin signaling. It has been speculated that phosphatidylinositol 4, 5-bisphosphate (PIP2) may regulate Trop-2 phosphorylation and calcium signal transduction, as the cytoplasmic domain of Trop-2 contains a PIP2-binding sequence overlapping with a protein kinase C phosphorylation site. See, for example, Zaman et al, Onco Targets Ther. 2019; 12: 1781–1790. Trop-2 has been shown to play a role in tumor progression and metastasis. See, for example, Lin et al., EMBO Mol Med. 2012 Jun; 4 (6) : 472-85. An elevated expression level of Trop-2 has been shown to be prognostic for cancer recurrence including the prostate cancer. See, for example, Hsu et al., PNAS, 2020; 117 (4) : 2032-2042. Trop-2 has emerged as a promising therapeutic target due to its overexpression in multiple cancers. Sacituzumab govitecan (IMMU-132) , an anti-Trop2 antibody conjugated with SN-38, a cytotoxic agent that targets DNA replication, has  shown therapeutic activity in several malignances, including triple negative breast cancer, advanced non-small cell lung cancer, and metastatic platinum-resistant urothelial carcinoma.
In some embodiments, the targeting moiety comprises an anti-Trop-2 antibody or fragments thereof. In some embodiments, the targeting moiety comprises an anti-Trop-2 scFv. In some embodiments, the targeting moiety comprises an anti-Trop-2 scFab. In some embodiments, the targeting moiety comprises an anti-Trop-2 nanobody. The anti-Trop-2 scFv, scFab, or nanobody may be derived from any anti-Trop-2 antibodies known in the art. Exemplary anti-Trop-2 antibodies include, but are not limited to, hRS7, 162-46.2, MAB650, K5-70, K5-107, K5-116-2-1, T6-16, T5-86, BR110, 3E9, 6G11, 7E6, 15E2, 18B1, 77220, KM4097, KM4590, A1, A3, 162-25.3, and antibodies produced by hybridomas AR47A6.4.2, AR52A301.5, PTA-12871, PTA-12872, PD 08019, PD 08020, and PD 08021, biosimilars thereof, and derivatives thereof. In some embodiments, the antibodies that compete with any of these art-recognized antibodies for binding to Trop-2 can also be used. In some embodiments, the anti-Trop-2 scFv, scFab, or nanobody is a derivative of any one of the anti-Trop-2 antibodies described herein. In some embodiments, the anti-Trop-2 scFv, scFab, or nanobody is derived from a group consisting of hRS7, 162-46.2 and MAB650. In some embodiments, the anti-Trop-2 scFv, scFab, or nanobody is derived from hRS7.
In some embodiments, the anti-Trop-2 antibody is derived from hRS7. See, for example, U.S. Pat. No. 7,238,785. In some embodiments, the targeting moiety binds competitively to the same or substantially the same epitope as hRS7. In some embodiments, the anti-Trop-2 antibody comprises a VH and a VL, wherein the VH comprises a CDR H1 comprising the amino acid sequence of NYGMN (SEQ ID NO: 134) , a CDR H2 comprising the amino acid sequence of WINTYTGEPTYTDDFKG (SEQ ID NO: 135) , and a CDR H3 comprising the amino acid sequence of GGFGSSYWYFDV (SEQ ID NO: 136) ; and wherein the VL comprises a CDR L1 comprising the amino acid sequence of KASQDVSIAVA (SEQ ID NO: 137) , a CDR L2 comprising the amino acid sequence of SASYRYT (SEQ ID NO: 138) , and a CDR L3 comprising the amino acid sequence of QQHYITPLT (SEQ ID NO: 139) . In some embodiments, the anti-Trop-2 antibody comprises a VH comprising the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS (SEQ ID NO: 140) , and/or a VL comprising the amino acid sequence of DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAA (SEQ  ID NO: 141) , DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKR (SEQ ID NO: 142) , or DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGGGTKLTVL (SEQ ID NO: 143) . In some embodiment, the anti-Trop-2 scFab comprises the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 130) . In some embodiments, the anti-Trop-2 scFv comprises the amino acid sequence of QVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRTVAA (SEQ ID NO: 131) , DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGAGTKVEIKRGGGGSGGGGSGGGGSQVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS (SEQ ID NO: 132) , or DIQLTQSPSSLSASVGDRVSITCKASQDVSIAVAWYQQKPGKAPKLLIYSASYRYTGVPDRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGGGTKLTVLGGGGGSGGGGSGGGGSQVQLQQSGSELKKPGASVKVSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYTDDFKGRFAFSLDTSVSTAYLQISSLKADDTAVYFCARGGFGSSYWYFDVWGQGSLVTVSS (SEQ ID NO: 133) .
B. Effector molecule
The targeting conjugate comprises one or more effector molecules. Exemplary effector molecules include, but are not limited to, therapeutic agents, oligonucleotides, and detectable labels. The targeting conjugate may comprise a single type of effector molecule, or different types of effector molecules. In some embodiments, the targeting conjugate comprises one or more therapeutic agents. In some embodiments, the targeting conjugate comprises one or more oligonucleotides. In some embodiments, the targeting conjugate comprises one or more detectable labels. In some embodiments, the targeting conjugate comprises a therapeutic agent and an oligonucleotide. In some embodiments, the targeting conjugate comprises a detectable label and a therapeutic agent. In some embodiments, the targeting conjugate comprises a detectable label and an oligonucleotide.
In some embodiments, the targeting conjugate comprises a first effector molecule and a second effector molecule. In some embodiments, the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is at least about any one of 1: 10, 1: 9, 1: 8, 1: 7, 1: 6, 1: 5, 1: 4, 1: 3, 1: 2, 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, or 10: 1. In some embodiments, the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is no more than about any one of 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, 1: 1, 1: 2, 1: 3, 1: 4, 1: 5, 1: 6, 1: 7, 1: 8, 1: 9, or 1: 10. In some embodiments, the ratio between the first effector molecule (e.g., therapeutic agent) and the second effector molecule (e.g., oligonucleotide) is about any one of 1: 10 to 10: 1, 1: 9 to about 9: 1, 1: 8 to 8: 1, 1: 7 to 7: 1, 1: 6 to 6: 1, 1: 5 to 5: 1, 1: 4 to 4: 1, 1: 3 to 3: 1, 1: 2 to 2: 1, 1: 10 to 1: 5, 1: 5 to 1: 1, 1: 1 to 5: 1, 5: 1 to or 5: 10.
Therapeutic agent
In some embodiments, the effector molecule is a therapeutic agent. Exemplary therapeutic agents include, but are not limited to, drugs, toxins, immunomodulators, hormones, hormone antagonists, enzymes, enzyme inhibitors, radionuclides, angiogenesis inhibitors, chemotherapeutic agent, etc. In some embodiments, the therapeutic agent is a small molecule drug. In some embodiments, the therapeutic agent is a chemotherapeutic agent.
A wide variety of chemotherapeutic agents may be used in accordance with the present embodiments. A “chemotherapeutic agent” refers a compound or composition that is administered in the treatment of cancer. These agents or drugs are categorized by their mode of activity within a cell, for example, whether and at what stage they affect the cell cycle.  Alternatively, an agent may be characterized based on its ability to directly cross-link DNA, to intercalate into DNA, or to induce chromosomal and mitotic aberrations by affecting nucleic acid synthesis.
Exemplary chemotherapeutic agents include, but are not limited to, alkylating agents, such as thiotepa and cyclosphosphamide; alkyl sulfonates, such as busulfan, improsulfan, and piposulfan; aziridines, such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines, including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide, and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone) ; a camptothecin (including the synthetic analogue topotecan) ; bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues) ; cryptophycins (particularly cryptophycin 1 and cryptophycin 8) ; dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1) ; eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards, such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, and uracil mustard; nitrosureas, such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics, such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall) ; dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores, aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin) , epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, and zorubicin; anti-metabolites, such as methotrexate and 5-fluorouracil (5-FU) ; folic acid analogues, such as denopterin, pteropterin, and trimetrexate; purine analogs, such as fludarabine, 6-mercaptopurine, thiamiprine, and thioguanine; pyrimidine analogs, such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, and floxuridine; androgens, such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, and testolactone; anti-adrenals, such as mitotane and trilostane; folic acid replenishes such as frolinic acid; aceglatone;  aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids, such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK polysaccharide complex; razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2, 2', 2” -trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine) ; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ( “Ara-C” ) ; cyclophosphamide; taxoids, e.g., paclitaxel and docetaxel gemcitabine; 6-thioguanine; mercaptopurine; platinum coordination complexes, such as cisplatin, oxaliplatin, and carboplatin; vinblastine; platinum; etoposide (VP-16) ; ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (e.g., CPT-l l) ; topoisomerase inhibitor RFS 2000; difluorometlhylomithine (DMFO) ; retinoids, such as retinoic acid; capecitabine; carboplatin, procarbazine, plicomycin, gemcitabien, navelbine, famesyl-protein tansferase inhibitors, transplatinum, and pharmaceutically acceptable salts, acids, or derivatives of any of the above.
In some embodiments, the effector molecule is a kinase inhibitor. The group of targeted kinases comprises receptor tyrosine kinases e.g. BCR-ABL, B-Raf, EGFR, HER-2/ErbB2, IGF-IR, PDGFR-a, PDGFR-β, cKit, Flt-4, Flt3, FGFR1, FGFR3, FGFR4, CSF1R, c-Met, RON, c-Ret, ALK, cytoplasmic tyrosine kinases e.g. c-SRC, c-YES, Abl, JAK-2, serine/threonine kinases e.g. ATM, Aurora A & B, CDKs, mTOR, PKCi, PLKs, b-Raf, S6K, STK1 1/LKB1 and lipid kinases e.g. PI3K, SKI. Exemplary small molecule kinase inhibitors include, e.g., PHA-739358, Nilotinib, Dasatinib, and PD166326, NSC 74341 1, Lapatinib (GW-572016) , Canertinib (CI-1033) , Semaxinib (SU5416) , Vatalanib (PTK787/ZK222584) , Sutent (SU1 1248) , Sorafenib (BAY 43-9006) and Leflunomide (SU101) . For more information see e.g. Zhang et al. 2009: Targeting cancer with small molecule kinase inhibitors. Nature Reviews Cancer 9, 28-39. ”
In some embodiments, the chemotherapeutic agent is an anti-DNA repair agent. In some embodiments, the DNA damage repair and response inhibitor is selected from the group comprising a topoisomerase inhibitor, a PARP inhibitor, a RAD51 inhibitor, and an inhibitor of a DNA damage response kinase selected from CHCK1, ATM, or ATR. In some embodiments, the chemotherapeutic agent comprises a topoisomerase inhibitor. In some  embodiments, the chemotherapeutic agent comprises a topoisomerase I inhibitor, such as camptothecins and related compounds. Topoisomerase I (TOP1) enzymes are essential in higher eukaryotes, as they are required to relax DNA supercoiling generated by transcription, replication and chromatin remodeling. Topoisomerases are particularly vulnerable to topoisomerase I inhibitors during their cleavage reaction, and can be trapped by anticancer drugs as it cleaves DNA. An alkaloid isolated from the Chinese tree Camptotheca acuminate, camptothecin is a natural product of which TOP1 is the only cellular target. Without being bound by any theory or hypothesis, camptothecin and its derivatives function by inhibition of TOP1 activity, resulting in DNA double-strand breaks and cell death. Derivatives of camptothecin have been developed for clinical use. Exemplary camptothecin derivatives include, but are not limited to, topotecan hydrochloride (Hycamtin) , irinotecan hydrochloride (Camptosar) , SN-38 (the active form of irinotecan) , 9-NC, 9-AC, DE-310, lurtotecan GI-147211 NX 211, gimatecan (ST-1481) , PEG–camptothecin, BNP-1350, DB-67, BN 80915. Two camptothecin derivatives have recently been approved by the FDA: topotecan for ovarian and lung cancers and irinotecan for colorectal cancer. See, for example, Pommier, Nature Reviews Cancer 6, 789–802 (2006) .
In some embodiments, the therapeutic agent is 7-ethyl-10-hydroxy-20 (S) -camptothecin (SN-38) . SN-38 is the active metabolite of irinotecan, but has 1000 times more activity than irinotecan itself. In vitro cytotoxicity assays show that the potency of SN-38 relative to irinotecan varies from 2-to 2000-fold. Due to its low solubility and ultratoxicity, SN-38 has been developed into drug conjugates for better therapeutic effects. See, for example, U.S. Pat. Nos. 7,999,083 and 8,080,250.
Figure PCTCN2021077866-appb-000015
In some embodiments, SN-38 is conjugated to the targeting moiety at its 10-hydroxyl position. Methods for selective regeneration of the 10-hydroxyl group in the presence of the C-20 carbonate in preparations of drug-linker precursor involving CPT analogs such as SN-38 are known in the art. See, for example, U.S. Pat. No. 10,266,605. In some embodiments, SN-38 is conjugated to the targeting conjugate at the 20-hydroxyl position. Other protecting groups for reactive hydroxyl groups in drugs such as the phenolic  hydroxyl in SN-38, for example t-butyldimethylsilyl or t-butyldiphenylsilyl, may also be used, and these are deprotected by tetrabutylammonium fluoride prior to linking of the derivatized drug to an antibody-coupling moiety. The 10-hydroxyl group of CPT analogs is alternatively protected as an ester or carbonate. In some embodiments, SN-38 is conjugated to the targeting moiety via a linker.
In some embodiments, the therapeutic agent comprises a mitotic inhibitor. In some embodiments, the chemotherapeutic agent comprises a tubulin disrupting agent. Microtubule/tubulin inhibitors can be classified into two major categories according to their mechanisms of action: agents promoting tubulin polymerization and stabilizing microtubule structures (e.g., paclitaxel) and agents inhibiting tubulin polymerization and destabilizing microtubule structures (such as maytansinoids, auristatins, vinblastine and vincristine) . See, for example, Chen et al., Molecules 22: 1281, 2017. Exemplary tubulin-disrupting agents include, but are not limited to, an auristatin, a tubulysin, a colchicine, a vinca alkaloid, a taxane, a cryptophycin, a maytansinoid, a hemiasterlin, and other tubulin disrupting agents. Auristatins are derivatives of the natural product dolastatin. Exemplary auristatins include dolastatin-10, MMAE (N-methylvaline-valine-dolaisoleuine-dolaproine-norephedrine) and MMAF (N-methylvaline-valine-dolaisoleuine-dolaproine-phenylalanine) , and derivatives thereof. WO 2015/057699 describes PEGylated auristatins including MMAE. Additional dolastatin derivatives contemplated for use are disclosed in U.S. Pat. No. 9,345,785, incorporated herein by reference. Tubulysins include, but are not limited to, tubulysin D, tubulysin M, tubuphenylalanine, tubutyrosine, and derivatives thereof. Colchicines include, but are not limited to, colchicine, CA-4, and derivatives thereof. Vinca alkaloids include, but are not limited to, Vinblastine (VBL) , vinorelbine (VRL) , vincristine (VCR) , vindesine (VDS) , and derivatives thereof. Taxanes include, but are not limited to, paclitaxel, docetaxel, and derivatives thereof. Cryptophycins include but are not limited to cryptophycin-1, cryptophycin-52, and derivatives thereof. Maytansinoids include, but are not limited to, maytansine, maytansinol, maytansine analogs, DM1, DM3, DM4, ansamatocin-2, and derivatives thereof. Exemplary maytansinoid drug moieties include those having a modified aromatic ring, such as: C-19-dechloro (prepared by lithium aluminum hydride reduction of ansamytocin P2) ; C-20-hydroxy (or C-20-demethyl) +/-C-19-dechloro (U.S. Pat. Nos. 4,361,650 and 4,307,016) (prepared by demethylation using Streptomyces or Actinomyces or dechlorination using LAH) ; and C-20-demethoxy, C-20-acyloxy (-OCOR) , +/-dechloro (prepared by acylation using acyl chlorides) , and the derivatives thereof.
Tubulin disrupting agents have been used in antibody drug conjugates for leukemia. For example, Brentuximab vedotin is an antibody-drug conjugate composed of an anti-CD30 monoclonal antibody conjugated by a protease-cleavable linker to the microtubule disrupting agent, monomethyl auristatin E. Brentuximab vedotin has been approved for the treatment of classical Hodgkin lymphoma patients after failure of autologous stem cell transplant (ASCT) or after failure of at least 2 prior multi-agent chemotherapy regimens in patients who are not ASCT candidates, and as consolidation post-ASCT for Hodgkin lymphoma patients at increased risk of relapse/progression. See, 
Figure PCTCN2021077866-appb-000016
 (brentuximab vedotin) US Prescribing Information and
Figure PCTCN2021077866-appb-000017
 (brentuximab vedotin) EU Summary of Product Characteristics. It has also been approved for systemic anaplastic large cell lymphoma after failure of at least one prior multi-agent chemotherapy regimen.
In some embodiments, the tubulin disrupting agent comprises an auristatin. In some embodiments, the therapeutic agent is monomethyl auristatin E (MMAE) . MMAE is a synthetic derivative of dolastatin 10 and functions as a very potent anti-mitotic agent by inhibiting tubulin polymerization. The synthesis and structure of MMAE is described in U.S. Pat. No. 6,884,869 incorporated by reference herein in its entirety.
Figure PCTCN2021077866-appb-000018
In some embodiments, the therapeutic agent further comprises a drug linker. In some embodiments, the drug linker is conjugated to the therapeutic agent via a cleavable linker. In some embodiments, the drug linker is conjugated to the therapeutic agent via a non-cleavable linker. In some embodiments, the linker is an amine donor group linker. In some embodiments, the linker is a non-cleavable linker. Suitable non-cleavable linkers include, but are not limited to, NH 2-R-X, NH 2NH-R-X, and NH 2-O-R-X, wherein R is alkyl or polyethylene glycol group (also referred to as PEG) , wherein X is the active moiety. A polyethylene glycol group or PEG group may have a formula of - (CH 2CH 2O)  n -, wherein n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) .
In some embodiments, the linker is a cleavable linker. Suitable cleavable linkers include, but are not limited to, Lys-Phe-X, Lys-Val-Cit-PAB-X, NH 2- (CH 2CH 2O)  n -Val-Cit-PAB-X, and NH 2- (CH 2CH 2O)  n- (Val-Cit-PAB-X)  2, wherein X is the active moiety, and n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) . PAB refers to p-aminobenzyloxycarbonyl. Cit refers to citrulline. Other exemplary amine donor group-linkers include, but are not limited to, Ac-Lys-Gly, aminocaproic acid, Ac-Lys-beta -Ala, amino-PEG 2 (Polyethylene Glycol) -C2, amino-PEG 3-C2, amino-PEG 6-C2, Ac-Lys-Val (valine) -Cit (citrulline) -PAB (p-aminobenzyloxycarbonyl) , aminocaproyl-Val-Cit-PAB, putrescine, and Ac-Lys-putrescine. In some embodiments, the linker is R- (PEG)  m-VC-PAB- (DMAE)  k (Formula II) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the linker is represented by R- (PEG)  m-P-PAB- (DMAE)  k (Formula III) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1, P is a cleavage site.
In some embodiments, the linker is branched. In some embodiments, the linker is linear. In some embodiments, the linker has more than one (such as 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more) attachment sites for the attachment of effector molecules. These effector molecules can be the same or different from each other.
In some embodiments, the effector molecule is MC-VC-PAB-DMAE-phenol linked SN38, shown as compound of Formula (1) below, wherein the linker is connected to position 10 of SN38:
Figure PCTCN2021077866-appb-000019
In some embodiments, the effector molecule is MC-VC-PAB-DMAE-α-hydroxy lactone linked SN38, shown as compound of Formula (2) below, wherein the linker is connected to position 20 of SN38:
Figure PCTCN2021077866-appb-000020
In some embodiments, the effector molecule is MC-VC-PAB-MMAE, shown as compound of Formula (3) below, wherein the linker is connected to MMAE:
Figure PCTCN2021077866-appb-000021
In some embodiments, the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-DMAE-phenol linked SN38, shown as compound of Formula (4) below:
Figure PCTCN2021077866-appb-000022
Compound of Formula 4 contains a linker that can be cleaved by uPA.
In some embodiments, the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-DMAE-α-hydroxy lactone linked SN38, shown as compound of Formula (5) below:
Figure PCTCN2021077866-appb-000023
Compound of Formula 5 contains a linker that can be cleaved by uPA.
In some embodiments, the therapeutic agent is MC-LGGSGRNAQVRLE-PAB-MMAE, shown as compound of Formula (6) below:
Figure PCTCN2021077866-appb-000024
Compound of Formula 6 contains a linker that can be cleaved by uPA.
Also provided are compounds having the structures of compounds of Formulae (1) -(6) , and targeting conjugates (e.g., antibody drug conjugates) comprising these compounds.
In some embodiments, the targeting conjugate comprises about 1-80 effector molecules conjugated to the targeting moiety. In some embodiments, the targeting conjugate comprises about any one of 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 1-10, 2-4, 2-5, 2-6, 2-7, 2-8, 2-9, 2-10, 3-5, 3-6, 3-7, 3-8, 3-9, 3-10, 4-10, 5-10, 10-20, 1-20, 10-20, 20-40, or 40-80 effector molecules conjugated to the targeting moiety. In some embodiments, the targeting conjugate comprises at least about any one of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 30, 40, 50, 60, 70, or 80 effector molecules. In some embodiments, the targeting conjugate comprises no more than about any one of 80, 70, 60, 50, 40, 30, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 effector molecules.
Oligonucleotide
In some embodiments, the effector molecule is an oligonucleotides. In some embodiments, the oligonucleotide is at least about any one of 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 150, 200 or more nucleotides or base pairs long. In some embodiments, the oligonucleotide is no more than about any one of 200, 150, 120, 100, 90, 80, 70, 60, 50, 40, 30, 20, 10, 5 or 2 nucleotides or base pairs long. In some embodiments, the oligonucleotide is about any one of 2-10, 5-10, 10-20, 10-40, 10-60, 10-80, 10-100, 100-150, 150-200, 20-40, 40-80, 80-100, 100-200, 10-150, 10-200, 2-20, 2-50, or 2-100 nucleotides or base pairs long.
In some embodiments, the oligonucleotide is a DNA. In some embodiments, the oligonucleotide is a double-stranded DNA. In some embodiments, the oligonucleotide is a single-stranded DNA. In some embodiments, the oligonucleotide is a synthetic DNA.
In some embodiments, the oligonucleotide is an RNA. Exemplary RNAs includes, but are not limited to single-stranded RNA (ssRNA) , double-stranded RNA (dsRNA) , small  interfering RNA (siRNA) , small hairpin RNA (shRNA) , or micro RNA. In some embodiments, the oligonucleotide is a synthetic RNA.
In some embodiments, the oligonucleotide is an immunomodulating polynucleotide. In some embodiments, the oligonucleotide is a pathogen-associated molecular pattern (PAMP) or other motif that can activate immune cells. PAMPs are molecules associated with various pathogens and are recognized by toll-like receptors (TLRs) and other pattern recognition receptors (PRRs) activating innate immune responses. The ability of PAMPs to recruit immune system in the absence of pathogens provides a strategy for treating a variety of diseases involving cell destruction (e.g., anticancer therapy) through the use of innate immune system response. One class of PAMPs that has been investigated for a variety of therapeutic applications is immunostimulating polynucleotides, such as CpG oligodeoxynucleotides (ODN) (e.g., agatolimod) . It is thought that CpG ODNs mediate TLR9 dimerization in immune cells (e.g., B cells, monocytes, and plasmacytoid dendritic cells (pDCs) ) to upregulate cytokines (e.g., type I interferon and interleukins) , thereby activating natural killer cells. Exemplary PAMPs include, but are not limited to, CpG oligodeoxynucleotides (CpG-ODNs) , herpes simplex virus (HSY) DNA, dsRNA, ssRNA. Further, the oligonucleotide may include one or more nucleic acid sequences that silence gene expression or induce intracellular death signaling, including, but not limited to, dsRNA, siRNA, shRNA, or micro RNA. In some embodiments, the oligonucleotide is selected from the group consisting of: GpT, GpG, GpA, ApA, ApT, ApG, CpT, CpA, CpG, TpA, TpT, and TpG oligonucleotides.
In some embodiments, the oligonucleotide is a CpG ODN. CpG ODNs are short single-stranded synthetic DNA molecules that contain a cytosine triphosphate deoxynucleotide ( "C" ) followed by a guanine triphosphate deoxynucleotide ( "G" ) . The "p" refers to the phosphodiester link between consecutive nucleotides. In some embodiments, the CpG ODN has a modified phosphorothioate (PS) backbone, e.g., all nucleotides or a portion of the nucleotides in the CpG ODN has a PS backbone. When CpG motifs are unmethylated, they act as immunostimulants. CpG motifs are considered pathogen-associated molecular patterns (PAMPs) due to their abundance in microbial genomes but their rarity in vertebrate genomes. CpG-ODNs bind to and activate Toll-like receptor 9 (TLR9) , initiating an innate immune response that supports the subsequent development of adaptive immunity. CpG-ODNs have been used as vaccine adjuvants to obtain desired immune modulation and synergistic immune response. CpG ODNs are generally divided into three classes: class A, class B, and class C. Class A CpG-ODNs typically contain poly-G tails with  phosphorothioate backbones at 3’-and 5’-termini and a central palindromic sequence including a phosphate backbone. Class A CpG ODNs typically contain CpG within the central palindrome sequence. Class B CpG-ODNs typically include fully phosphorothioate backbone, and the sequence at the 5’ end of class B CpG ODN is often critical for TLR9 activation. Class C CpG-ODNs include fully phosphorothioate backbone with a 3’-end sequence enabling formation of a duplex. In some embodiments, the CpG-ODN is methylated. In some embodiments, the CpG-ODN is unmethylated.
In some embodiments, the targeting moiety is conjugated to an oligonucleotide comprising a CpG motif. In some embodiments, the targeting moiety is conjugated to an oligonucleotide comprising a plurality of CpG motifs. In some embodiments, the targeting moiety is conjugated to an oligonucleotide comprising multiple repeats of a CpG motif having the same sequence. In some embodiments, the targeting moiety is conjugated to multiple CpG-ODNs having different sequences.
In some embodiments, the CpG-ODN may exhibit stability (e.g., stability against nucleases) that is superior to that of CpG-ODNs containing mostly internucleoside phosphate (e.g., more than 50%of internucleoside phosphates) without substantially sacrificing their immunostimulating activity. This effect can be achieved, e.g., by incorporating at least 50% (e.g., at least 70%) internucleoside phosphorothioates or phosphorodithioates or through the inclusion of internucleoside phosphotriesters and/or internucleoside abasic spacers. Phosphotriesters and abasic spacers are also convenient for conjugation to a targeting moiety. Phosphate-based phosphotriesters and abasic spacers may also be used for reduction of off-target activity, relative to polynucleotides with fully phosphorothioate backbones. Without wishing to be bound by theory, this effect may be achieved by reducing self-delivery without disrupting targeting moiety-mediated delivery to target cells. Accordingly, an oligonucleotide can include about 15 or fewer contiguous internucleoside phosphorothioates (e.g., about 14 or fewer, about 13 or fewer, about 12 or fewer, about 11 or fewer, or about 10 or fewer contiguous internucleoside phosphorothioates) . For example, a CpG-ODN containing a total of from about 12 to about 16 nucleosides may contain about 10 or fewer contiguous internucleoside phosphorothioates.
In some embodiments, the CpG ODN comprises one or more phosphorothioates (e.g., from about 1 to about 6 or from about 1 to about 4) , e.g., at one or both termini (e.g., within the six 5’-terminal nucleosides or the six 3’-terminal nucleosides) . The inclusion of one or more internucleoside phosphotriesters and/or phosphorothioates can enhance the stability of the polynucleotide by reducing the rate of exonuclease-mediated degradation.
In some embodiments, the CpG ODN further comprises one or more (e.g., from 1 to 6, from 1 to 12, from 1 to 18, from 1 to 24) auxiliary moieties (e.g., polyethylene glycols (PEGs) ) . The auxiliary moiety may be a part of a capping group, bioreversible group, or non-bioreversible group. The auxiliary moieties may be bonded to the linkers (e.g., to the linkers bonded to phosphates, phosphorothioates, or phosphorodithioates in the immunomodulating (e.g., immunostimulating) polynucleotides) . Inclusion of the auxiliary moieties (e.g., PEGs) in the CpG ODN may improve pharmacokinetic and/or biodistribution properties of the targeting conjugate relative to a reference conjugate lacking such auxiliary moieties. In some embodiments, the CpG oligonucleotide is linked to a cleavable linker. In some embodiments, the CpG oligonucleotide comprises a nucleic acid sequence selected from the group consisting of:
5’-TCGAACGTTCGAACGTTCGAACGTTCGAAT-3’ (SEQ ID NO: 66) ,
5’-T*C*G*A*A*C*G*T*T*C*G*A*A*C*G*T*T*C*G*A*A*C*G*T*T*C*G*A*A*T*-3’ (SEQ ID NO: 67) , wherein *represents a phosphorothioate linkage.
In some embodiments, the oligonucleotide is conjugated to a conjugation site in the target moiety binding fragment (TBF) via a linker. In some embodiments, the oligonucleotide comprises a linker, such as a chemical linker or a peptide linker. In some embodiments, the linker is selected from the group consisting of SH 2-Spacer, MAL-Spacer, NH 2-Spacer, and Osu-Spacer. A spacer, as used herein, when present, links a targeting moiety to an effector molecule directly or indirectly. See, for example, US20100040637A1.
In some embodiments, the linker is a poly-PEG linker. In some embodiments, the oligonucleotide is conjugated covalently to the TBF or the targeting moiety without a linker.
Detectable label
In some embodiments, the effector molecule is a detectable label. As used herein, a label is a moiety that facilitates detection of the targeting moiety and/or facilitates detection of a molecule to which the targeting moiety binds. Nonlimiting exemplary labels include, but are not limited to, radioisotopes, fluorescent groups, enzymatic groups, chemiluminescent groups, biotin, epitope tags, metal-binding tags, etc. One skilled in the art can select a suitable label according to the intended application.
For diagnostic purposes, the label may be a radionuclide, a radiological contrast agent, a paramagnetic ion, a metal, a fluorescent label, a chemiluminescent label, an ultrasound contrast agent and a photoactive agent. Such diagnostic labels are well known and any such known labels may be used.
In some embodiments, the detectable label is a radionuclide. “Radionuclides” are often referred to as “radioactive isotopes” or “radioisotopes. ” Exemplary radionuclides or stable isotopes that may be attached to the targeting moieties described herein include, but are not limited to,  110In,  111In,  177Lu,  18F,  52Fe,  62Cu,  64Cu,  67Cu,  67Ga,  68Ga,  86Y,  90Y,  89Zr,  94mTc,  94Tc,  99mTc,  120I,  123I,  124I,  125I,  131I,  154-158Gd,  32P,  11C,  13N,  15O,  186Re,  188Re,  51Mn,  52mMn,  55Co,  72As,  75Br,  76Br,  82mRb,  83Sr, or other gamma-, beta-, or positron-emitters.
Paramagnetic ions of use may include chromium (III) , manganese (II) , iron (III) , iron (II) , cobalt (II) , nickel (II) , copper (II) , neodymium (III) , samarium (III) , ytterbium (III) , gadolinium (III) , vanadium (II) , terbium (III) , dysprosium (III) , holmium (III) or erbium (III) . Metal contrast agents may include lanthanum (III) , gold (III) , lead (II) or bismuth (III) . Radiopaque diagnostic agents may be selected from compounds, barium compounds, gallium compounds, and thallium compounds. A wide variety of fluorescent labels are known in the art, including but not limited to fluorescein isothiocyanate, rhodamine, phycoe1ytherin, phycocyanin, allophycocyanin, ophthaldehyde and fluorescamine. Chemiluminescent labels of use may include luminol, isoluminol, an aromatic acridinium ester, an imidazole, an acridinium salt or an oxalate ester.
In some embodiments, the effector molecule comprises a chelating compound that chelates the radionuclide. In some embodiments, the chelating compound chelates a radioactive metal. In some embodiments, the chelating compound chelates a metal  18F. In some embodiments, the chelating compound is a hydrophilic chelating compound, which can bind metal ions and help to ensure rapid in vivo clearance. Particularly useful metal-chelating compound combinations include 2-benzyl-DTPA (diethylenetriamine pentaacetic acid) and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes in the general energy range of 60 to 4,000 keV, such as  125I,  131I,  123I,  124I ,  62Cu,  64Cu,  18F,  111In,  67Ga,  68Ga,  99Tc,  94Tc,  11C,  13N,  15O,  76Br, for radio-imaging. The same chelating compounds, when complexed with nonradioactive metals, such as manganese, iron and gadolinium are useful for MRI. Macrocyclic chelating compounds such as NOTA (1, 4, 7-triazacyclononane-1, 4, 7-triacetic acid) , DOTA (1, 4, 7, 10-Tetraazacyclododecane-N, N', N”, N”'-tetraacetic acid) , TETA (bromoacetamido-benzyl-tetraethylaminetetraacetic acid) and NETA ( {4- [2- (bis-carboxymethyl-amino) -ethyl] -7-carboxymethyl- [1, 4, 7] triazonan-1-yl} -acetic acid) are of use with a variety of diagnostic radiometals, such as gallium, yttrium and copper. Such metal-chelating complexes can be made very stable by tailoring the ring size to the metal of interest.
In some embodiments, the chelating compound comprises a functional group that can be conjugated to the targeting moiety. In some embodiments, the chelating compound  comprises a functional group that is reactive with a primary amine (-NH 2) group in the targeting moiety. Exemplary functional groups that can be conjugated to a primary amine, e.g., a lysine side chain, of the targeting moiety, include, but are not limited to, isothiocyanates, isocyanates, acyl azides, N-hydroxysuccinimide (NHS) esters, sulfonyl chlorides, aldehydes, glyoxals, epoxides, oxiranes, carbonates, aryl halides, imidoesters, carbodiimides, anhydrides, and fluorophenyl esters. Most of these functional groups conjugate to amines by either acylation or alkylation.
In some embodiments, the chelating compound comprises a functional group that is reactive with a cysteine side chain (i.e., sulfhydryl group) in the targeting moiety. Exemplary sulfhydryl reactive groups include, but are not limited to, haloacetyls, maleimides, aziridines, acryloyls, arylating agents, vinylsulfones, pyridyl disulfides, TNB-thiols and disulfide reducing agents. Most of these groups conjugate to sulfhydryls by either alkylation (usually the formation of a thioether bond) or disulfide exchange (formation of a disulfide bond)
C. Target moiety binding fragment (TBF)
The TBF comprises a targeting moiety binding peptide (TBP) that specifically binds to the targeting moiety. The targeting moiety binding peptide (TBP) may be obtained by screening a peptide library for specific binding to a targeting moiety of interest. In some embodiments, the TBF consists of or consists essentially of the TBP. In some embodiments, the TBF is a TBP. The TBP allows non-covalent conjugation of the TBF to the targeting moiety. In some embodiments, in addition to the TBP, the TBF comprises one or more additional chemical moieties. In some embodiments, the TBF comprises a chemical reactive moiety that can be conjugated to the targeting moiety. In some embodiments, the TBF comprises a small molecule linker comprising the chemical reactive moiety. The chemical reactive moiety allows covalent conjugation of the TBF to the targeting moiety. Non-covalent binding of the TBP in the TBF to the targeting moiety may facilitate covalent conjugation of the TBF to the targeting moiety. In some embodiments, the TBF comprises one or more TBPs.
In some embodiments, wherein the targeting moiety is an antibody or antigen binding fragment thereof, the targeting moiety binding fragment (TBF) is an antibody binding fragment (ABF) . In some embodiments, the targeting conjugate comprises one or more ABFs that bind to a heavy chain of an antibody. In some embodiments, the ABF further comprises a chemically reactive moiety that can be covalently conjugated to the antibody or antigen binding fragment thereof. In some embodiments, the ABF does not comprise a chemically reactive moiety that can be conjugated to the antibody or antigen binding fragment thereof. In some embodiments,  the ABF consists of or consists essentially of an ABP. In some embodiments, the ABF is an ABP. In some embodiments, the targeting conjugate comprises one or more ABPs that bind to the Fc region of an antibody ( “an FcBP” ) .
FcBPs are a subset of immunoglobulin binding proteins that interact with the Fc region via non-immune binding. Some of the best studies examples of FcBPs include SpA and Protein G (See, Goward et al., 1993; Bjorck et al., 1984, Reis et al., 1984) . Other examples of Fc binding proteins (reviewed in Sidorin and Soloveva, 2011) include, but are not limited to, Protein G from group C and group G streptococci (Derrick, 1992; Bjorck, 1984; Reis et al., 1984) ; β protein and M or M like family FcBPs such as Protein H, Arp4, Arp 60, Mrp4, Sir22, Enn4, FgBP (Kazeeval & Shevelev, 2009; Pleass et al., 2001; O'Toole et al., 1992; Heden et al., 1991; Jerlstro et al., 1991; Lewis et al., 2008; Meehan et al., 2001) ; SibA from GAS (Fagan et al., 1991) ; SpA from S. aureus (Boyle 1990 in Bacterial Immunoglobulin-Binding Proteins, ed. Boyle, M.P.D. (Academic, San Diego) , Vol. 1, pp. 17-28, Gouda et al., Biochemistry. 1992 31: 9665-7; Goward et al., 1993) ; SSL family members including SSL 7 and SSL10 from S. aureus (Ramsland et al., 2007; Kazeeval & Shevelev 2009; Ramsland et al., 2007) ; Sbi from S. aureus (Burman et al., 2008, Itoh et al., 2010) ; IsaB from S. aureus (Clark et al., 1999) ; PsaA from Y. Pestis; Eib-proteins from E. Coli (Sidorin. and Soloveva, 2011) .
The application of Fc-binding polypeptide to antibody-drug conjugates has been described, for example, in Eur J Pharm Biopharm. 2019 Sep; 142: 49-60. An Fc-binding peptide may non-covalently interact with an antibody, which results in a complex that leaves the Fab (fragment, antigen-binding) moieties free from any potentially deleterious drug conjugation/interaction effects that could reduce the antibody’s affinity towards its antigen. Fc-binding peptides also allow the number of drug molecules or oligonucleotides conjugated to the antibody to be strictly controlled. In some embodiments, an Fc-binding peptide is covalently conjugated to a targeting moiety comprising an Fc region.
In some embodiments, the TBP is selected from the group consisting of FcBP-1, Fc-BP-2, and Fc-III. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHLGELVWCT (SEQ ID NO: 75) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 75. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHKGELVWCT (SEQ ID NO: 76) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 76. In some  embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in NCAWHKGQLVWCT (SEQ ID NO: 77) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 77. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSKGSDCAWHLGELVWCT (SEQ ID NO: 78) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 78. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSKGSNCAWHLGQLVWCT (SEQ ID NO: 79) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 79. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in DCAWHLGQLVWCT (SEQ ID NO: 152) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 152. In some embodiments, the TBF comprises an amino acid sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the amino acid sequence as set forth in GSCGSDCAWHLGELVWCT (SEQ ID NO: 156) . In some embodiments, the TBF comprises the amino acid sequence of SEQ ID NO: 156.
In some embodiments, the TBF described herein is conjugated to the target binding moiety (e.g., an Fc region in an antibody or antigen-binding fragment thereof) . In some embodiments, the TBF is conjugated to the targeting moiety covalently via a chemical reactive moiety. The chemical reactive moiety may be present at the N-terminus, the C-terminus or at an internal position (e.g., a side chain of an amino acid residue) in the TBF. In some embodiments, the C-terminus of the TBF is chemically modified to comprise a reactive group. In some embodiments, the N-terminus of the TBF is chemically modified to comprise a reactive group. In some embodiments, the TBF is conjugated to the target binding moiety covalently via a bifunctional linker. In some embodiments, the targeting moiety binding fragment is covalently conjugated to an amine group in the targeting moiety. In some embodiments, the amine group is in the Fc region of an antibody or an antigen-binding fragment thereof. Antibody-targeting polypeptide chemical conjugation has been described, for example, in Kishimoto et al, Bioconjugate Chem. 2019, 30, 3, 698–702; Dias et al., JACS 2006, 126, 2726-2732; and U.S. Patent 10227383. In some embodiments, the TBP described herein is  conjugated to the Fc-region of the antibody non-covalently. In some embodiments, the TBF is conjugated to the antibody via charge-charge interaction. In some embodiments, the TBF is cationic under physiological pH. In some embodiments, the TBF is neutral under physiological pH.
In some embodiments, the targeting conjugate comprises one or more targeting moiety binding fragments (TBF) , which are conjugated to the effector molecule (s) . For example, an effector molecule may be conjugated to the targeting moiety via a conjugation site in or linked to the targeting moiety binding fragment (TBF) . In some embodiments, the effector molecule is conjugated covalently to an endogenous conjugation site in the TBF. In some embodiments, the effector molecule is conjugated to a conjugation site introduced to the TBF, e.g., fused to the TBF. The conjugation may be covalent or non-covalent.
In some embodiments, the TBF is linked to an oligonucleotide binding peptide via a cleavable linker. In some embodiments, the TBF is linked to an oligonucleotide binding peptide directly or via a non-cleavable linker. The oligonucleotide binding peptide serves as a conjugation site for the oligonucleotide. In some embodiments, the targeting conjugate comprises a moiety of the formula TBF- (PEG)  n-P i-OBP j (Formula IV) , wherein TBF is an targeting moiety binding fragment (e.g., an antibody binding fragment, ABF) , P is a cleavage site; OBP is an oligonucleotide binding peptide; n ≥ 0, i = 0 or 1, j = 0 or 1.
In some embodiments, the TBF is linked to a therapeutic agent via a cleavable linker. In some embodiments, the TBF is linked to a therapeutic agent via a non-cleavable linker. In some embodiments, the targeting conjugate comprises a moiety of formula: TBF-R- (PEG)  m-VC-PAB- (DMAE)  k-Drug (Formula V) , wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the targeting conjugate comprises a moiety of formula: TBF-R- (PEG)  m-P-PAB- (DMAE)  k-Drug (Formula VI) , wherein R is an amine-reactive or sulfhydryl-reactive group, P is a cleavage site, Drug is a therapeutic agent, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the targeting conjugate comprises a structure having a formula selected from the group consisting of Formulae (7) - (12) .
In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in DCAWHLGELVWCT- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 74) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety  comprising a sequence of SEQ ID NO: 74. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in DCAWHLGQLVWCT- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 80) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 80. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSKGSDCAWHLGELVWCT- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 81) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 81 In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSCGSDCAWHLGELVWCT- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 82) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 82. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSDGSNCAWHLGQLVWCT- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 83) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 83. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSKGSDCAWHLGELVWCT- (PEG)  12-LGGSGRNAQVRLEGSGRSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 148) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 148. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a  moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSCGSDCAWHLGELVWCT- (PEG)  12-LGGSGRNAQVRLEGSGRSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 149) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 149. In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence that is at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%) identical to the sequence as set forth in GSDGSNCAWHLGQLVWCT- (PEG)  12-LGGSGRNAQVRLERSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 150) . In some embodiments, the targeting conjugate comprises a targeting moiety conjugated to an effector molecule via a moiety comprising a sequence of SEQ ID NO: 150.
Also provided are targeting conjugates comprising a targeting moiety conjugated to an effector molecule via a targeting moiety binding fragment, wherein the targeting moiety binding fragment comprises a sequence selected from at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156. In some embodiments, there is provided a targeting conjugate comprising a targeting moiety, an oligonucleotide, and a TBF, wherein the oligonucleotide is conjugated to the targeting moiety via the TBF, and wherein the targeting moiety comprises an sequence having at least about 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
In some embodiments, the TBF comprises a crosslinker. In some embodiments, the crosslinker is selected from the group consisting of disuccinimidyl glutarate (DSG) , disuccinimidyl suberate (DSS) , Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate (SMCC) , Maleimide-amido-PEG n-TFP (TFP: tetrafluorophenyl) , and Maleimide-PEG n-DBCO (DBCO: dibenzocyclooctyne) , wherein n is an integer of 1-12, such as 2 and 4. In some embodiments, the targeting conjugate comprises a structure represented by a formula selected from the group consisting of Formulae (13) - (26) . See, Example 5. In some embodiments, the targeting moiety is an antibody moiety.
In some embodiments, the TBF further comprises a crosslinker conjugation site. In some embodiments, the crosslinker conjugation site is an amine conjugation site.
In some embodiments, the targeting moiety may comprise binding sites for a plurality of TBFs, thereby allowing conjugation of multiple effector molecules. In some embodiments, the plurality of TBFs are the same. In some embodiments, the plurality of TBFs are different.
D. Conjugation site
In some embodiments, the targeting conjugate comprises one or more conjugation sites. The conjugation site allows covalent or non-covalent attachment of the effector molecule to the targeting moiety binding fragment (TBF) . The conjugation site may be part of the TBP or present in a chemical moiety introduced to the TBF.
In some embodiments, the targeting moiety comprises one or more conjugation sites that are conjugated to effector molecules.
The conjugation sites may comprise one or more reactive groups for covalent conjugation. Common reactive groups in proteins include primary amines (–NH 2) , carboxyls (–COOH) , sulfhydryls (–SH) and carbonyls (–CHO, which can be created by oxidizing carbohydrate groups in glycoproteins) .
In some embodiment, the conjugation site is within a polypeptide chain of the targeting moiety. In some embodiments, the conjugation site is at the side chain of an amino acid residue of the targeting moiety. In some embodiments, the conjugation site is at the N-terminus of a polypeptide chain of the targeting moiety. In some embodiments, the conjugation site is at the C-terminus of a polypeptide chain of the targeting moiety.
In some embodiments, the conjugation site is an endogenous conjugation site on the targeting moiety. In some embodiments, the conjugation site is an engineered conjugation site introduced into the targeting moiety. For example, the conjugation site may be present in a peptide, such as a tag, fused to the targeting moiety.
In some embodiments, the conjugation site comprises a reactive thiol group, e.g., a cysteine residue of the targeting moiety.
In some embodiment, the conjugation site comprises a reactive amine group ( “amine conjugation site” ) , e.g., a lysine or arginine residue of the targeting moiety. Primary amines exist at the N-terminus of each polypeptide chain and in the side chain of lysine and arginine (Lys, K) residues. These primary amines are positively charged at physiologic pH; therefore, they occur predominantly on the outside surfaces of native protein tertiary structures where they are readily accessible to conjugation reagents introduced into the aqueous medium. Furthermore, among the available functional groups in typical biological or protein samples, primary amines are especially nucleophilic; this makes them easy to target  for conjugation with several reactive groups. One of the most specific and efficient reagents are those that use the N-hydroxysuccinimidyl ester (NHS ester) reactive group. In some embodiments, a sulfhydryl group can be introduced at the site of primary amines –especially those of lysine residues-by modification with reagents such as Traut's reagent (2-iminothiolane) , MBS, SPDP, SATA, and their derivatives.
In some embodiment, the effector molecule is conjugated to an amine conjugation site in the targeting moiety. In some embodiments, the effector molecule is conjugated to the targeting moiety binding fragment (TBF) via an amine conjugation site in the TBF.
In some embodiments, a single effector molecule is conjugated to a conjugation site. In some embodiments, two or more effector molecules are conjugated to a conjugation site. In some embodiments, the targeting conjugate comprises a plurality of conjugation sites, e.g., 2, 3, 4, 5, 6, or more conjugation sites, in tandem arrangement for conjugation of a plurality of effector molecules.
Amine conjugation site
In some embodiments, the TBF is conjugated to the targeting moiety via an amine conjugation site in the TBF and a crosslinker. In some embodiments, the crosslinker reacts with a free amine in the TBF. In some embodiments, the crosslinker reacts with a free amine in the targeting moiety. In some embodiments, the crosslinker reacts with an amine group in a lysine residue.
In some embodiments, the crosslinker is a homobifunctional crosslinker. Examples of homobifunctional crosslinkers include, but are not limited to, DSG (disuccinimidyl glutarate) , DSS (disuccinimidyl suberate) . In some embodiments, the crosslinker is a heterobifunctional crosslinker. Examples of heterobifunctional crosslinkers include, but are not limited to, SMCC (succinimidyl 4- [N-Maleimidomethyl] cyclohexane-1-carboxylate) , maleimide-amido-PEG n-TFP, maleimide-PEG n-DBCO, where n is an integer of at least 1 (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) .
Oligonucleotide binding polypeptide (OBP)
In some embodiments, an oligonucleotide is conjugated non-covalently to the targeting moiety via an oligonucleotide binding polypeptide (OBP) introduced to the targeting moiety. In some embodiments, an oligonucleotide is conjugated non-covalently to the targeting moiety binding fragment (TBF) via an oligonucleotide binding polypeptide introduced to the TBF. For example, a CpG oligonucleotide may be conjugated non- covalently to the targeting moiety or the TBF via a CpG binding polypeptide (CBP) . In some embodiments, the oligonucleotide is conjugated to the oligonucleotide binding polypeptide through charge-charge interactions. In some embodiments, the oligonucleotide binding polypeptide is a cationic peptide. In some embodiments, the oligonucleotide binding polypeptide is a neutrally charged peptide.
Many nucleic acid binding proteins use short peptide sequences to provide specificity in recognizing their targets, which may either have a specific sequence or a specific conformation. Peptides containing alternating lysine have been shown to bind to poly (dG–d5meC) in the Z conformation, and stabilize the higher energy form. See, for example, H. Takeuchi et al., (1991) FEBS Lett., 279, 253–255 and H. Takeuchi et al., (1994) J. Mol. Biol., 236, 610–617.
In some embodiments, the CpG binding polypeptide is positively charged. In some embodiments, the CpG binding polypeptide comprises one or more positively charged amino acid residues. In some embodiments, the CpG binding polypeptide comprises polar amino acid residues. In some embodiments, the CpG binding polypeptide comprises short motifs comprising multiple positively charged amino acid residues. In some embodiments, the short motif comprises tandem positively charged amino acid residues. In some embodiments, the CpG binding peptide further comprises modifications at the N terminus. In some embodiments, the CpG binding peptide comprises an aminobenzoic acid at the N terminus.
In some embodiments, the CpG binding polypeptide is selected from the group consisting of RSQSRSRYYRQRQRSRRRRRRS (SEQ ID NO: 56) ; RRRLHRIHRRQHRSCRRRKRR (SEQ ID NO: 57) ; MPRRRRSSSRPVRRRRRPRVSRRRRRRGGRRRR (SEQ ID NO: 58) ; KKSAKKTPKKAKKPKKSAKKTPKKAKKP (SEQ ID NO: 59) ; AKKAKSPKKAKAAKPKKAPKSPAKAK (SEQ ID NO: 60) ; MRRAHHRRRRASHRRMRGG (SEQ ID NO: 61) ; KHKHKHKHKKKHKHKHKHKKKHKHKHKHKK (SEQ ID NO: 62) ; KGKGKGKGKKKGKGKGKGKKKGKGKGKGKK (SEQ ID NO: 63) ; KKALLALALHHLAHLALHLALALKKA (SEQ ID NO: 64) ; and YSPTSPSYSPTSPSYSPTSPSY (SEQ ID NO: 65) . Also provided are CpG binding polypeptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65. In some embodiments, there is provided a targeting conjugate comprising a targeting moiety, a CpG oligonucleotide, and a CpG binding polypeptide, wherein the CpG  oligonucleotide is conjugated to the targeting moiety via the CpG binding polypeptides, and wherein the CpG binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 56-65.
In some embodiments, the CpG binding polypeptide is fused to the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to the N terminus of one or more of the polypeptide chains of the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to the C terminus of one or more of the polypeptide chains of the targeting moiety. In some embodiments, the CpG binding polypeptide is fused to an internal position of one or more of the polypeptide chains of the targeting moiety. In some embodiments, wherein the targeting moiety is an antibody or antigen-binding fragment, the CpG binding polypeptide is fused to the C terminus of a heavy chain of the antibody or antigen-binding fragment, e.g., via a single peptide bond or a linker. In some embodiments, wherein the targeting moiety is an antibody or antigen-binding fragment, the CpG binding polypeptide is fused to the C terminus of a light chain of the antibody or antigen-binding fragment, e.g., via a single peptide bond or a peptide linker.
E. Cleavage site
In some embodiments, the targeting conjugate comprises one or more cleavage sites. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the targeting moiety. In some embodiments, the targeting moiety does not comprise one or more cleavage sites. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the effector molecule. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the oligonucleotide binding polypeptide. In some embodiments, the targeting conjugate comprises one or more cleavage sites in or linked to the targeting moiety binding fragment (TBF) . In some embodiments, the targeting conjugate comprises one or more cleavage sites disposed between the TBF and the conjugation site for conjugation of the effector molecule.
In some embodiments, the one or more cleavage sites in the targeting conjugate are cleaved at a target site, e.g., a diseased site. In some embodiments, the cleavage is triggered by a condition at the target site, such as a protease, a change in pH, redox level, hypoxia, oxidative stress, hyperthermia, and/or extracellular ATP concentration. In some embodiments, the one or more cleavage sites in the targeting conjugate are not cleaved at a non-target site, such as in normal or healthy tissues. In some embodiments, the condition that triggers cleavage of the cleavage site at the target site is not found at non-target sites. In some embodiments, the  condition that triggers cleavage of the cleavage site is present at the target site at a level that is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the condition at non-target sites. For example, a protease (e.g., uPA) that cleaves the cleavage site is present at a target site at a concentration that is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the concentration of the protease at non-target sites. In some embodiments, the extracellular ATP concentration at a target site is at least about any one of 1.5, 2, 5, 10, 20, 50, 100, 200, 500, 1000 times or higher than the extracellular ATP concentration at non-target sites. In some embodiments, the pH at a target site is at least about any one of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, or 3 lower than the pH at non-target sites. In some embodiments, the pH at a target site is at least about any one of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, or 3 higher than the pH at non-target sites. In some embodiments, the one or more cleavage sites are cleaved under the same condition. In some embodiments, the one or more cleavage sites are cleaved under different conditions.
In some embodiments, the cleavage site is a protease cleavage site. In some embodiments, the cleavage site is cleavable by a disease-specific protease, such as a tumor-specific protease. In some embodiments, the tumor-specific protease express at elevated levels in diseased tissues, such as tumor tissues, compared to normal tissues. For example, studies have shown that tumor tissues exhibit increased activity of specific proteases and decreased activity of the opposing endogenous inhibitors (Sevenich L and Joyce JA. Genes & Dev. 2014. 28: 2331-2347. 2014) . In some embodiments, tumor-specific protease is selected from the group consisting of matriptase (MTSP1) , urinary-type plasminogen activator (uPA) , legumain, PSA (also called KLK3, kallikrein-related peptidase-3) , matrix metalloproteinase-2 (MMP-2) , matrix metalloproteinase-9 (MMP9) , human neutrophil elastase (HNE) , proteinase 3 (Pr3) , cathepsin B and cathepsin K.
In some embodiments, the cleavage site is a substrate for an enzyme selected from the group consisting of legumain, plasmin, TMPRSS-3/4, MMP-9, MTl-MMP, cathepsin, caspase, human neutrophil elastase, beta-betasecretase, uPA, and PSA.
In some embodiments, the cleavage site is a uPA substrate peptide. Urokinase plasminogen activator (uPA) is a serine protease that is part of the urokinase plasminogen activating system (uPAS) . The uPA converts the proenzyme plasminogen in the serine protease plasmin, involved in a number of physiopathological processes requiring basement membrane (BM) and/or extracellular matrix (ECM) remodeling, including tumor progression and metastasis. In some embodiments, the uPA cleavage site comprises an amino acid sequence selected from the group consisting of LSGRSDNH (SEQ ID NO: 50) , SGRSA (SEQ ID NO:  51) , LGGSGRSANAILE (SEQ ID NO: 52) , LGGSGRNAQVRLE (SEQ ID NO: 53) , GSGRNAQV (SEQ ID NO: 54) , and SGR (SEQ ID NO: 55) . Also provided are uPA cleavage peptides comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 50-55.
In some embodiments, the targeting conjugate comprises a single peptide substrate cleavable by a disease-specific protease, such as uPA, e.g., any one of SEQ ID NOs: 50-55. In some embodiments, the targeting conjugate comprises two or more copies (such as any one of 2, 3, 4, 5, or more) of a peptide substrate cleavable by a disease-specific protease. In some embodiments, the targeting conjugate comprises a peptide substrate that can be cleaved by more than one (e.g., any of 2, 3, 4, or more) disease-specific proteases. In some embodiments, the targeting conjugate comprises two or more (e.g., any of 2, 3, 4, or more) peptide substrates cleavable by one or more (e.g., any of 2, 3, 4, or more) disease-specific proteases. Any one of the protease peptide substrate sequences disclosed herein (e.g., SEQ ID NOs: 50-55) can be mixed and matched to provide a disease-sensing releasable moiety with optimal mechanism and dynamics for release of the effector molecule (s) and oligonucleotide (s) at a target (e.g., disease) site. The different protease substrate sequences or copies thereof can be fused to each other via peptide linkers to provide suitable cleavage sites.
F. Exemplary targeting conjugates
In some embodiments, there is provided a targeting conjugate comprising: a targeting moiety, one or more effector molecules conjugated to the targeting moiety via a targeting moiety binding fragment (TBF) . In some embodiments, each effector molecule is conjugated to the TBF via a conjugation site. In some embodiments, each effector molecule is linked to the conjugation site via one or more linkers. In some embodiments, the effector molecule is conjugated to the TBF via one or more protease cleavage sites. In some embodiments, the targeting moiety comprises two or more polypeptide chains. In some embodiments, the targeting moiety comprises a protease cleavage site. In some embodiments, the targeting conjugate has the structure of Formula I.
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first effector molecule (e.g., a small molecule drug) comprising a first linker; (F) a second effector molecule (e.g., a small molecule drug) comprising a second linker; (G) a first antibody binding fragment comprising a first protease cleavage site (e.g., a uPA cleavage site) ; (H) a second antibody binding fragment comprising  a second protease cleavage site (e.g., a uPA cleavage site) ; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first effector molecule (e.g., a small molecule drug) is conjugated to the first antibody binding fragment via the first linker; wherein the second effector molecule (e.g., a small molecule drug) is conjugated to the second antibody binding fragment via the second linker; wherein the first antibody binding fragment is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain; wherein upon cleavage of the first cleavage site, the first effector molecule is released from the first antibody binding fragment; and wherein upon cleavage of the second protease cleavage site, the second effector molecule is released from the second antibody binding fragment. In some embodiments, two or more effector molecules are conjugated to the first antibody binding fragment. In some embodiments, two or more effector molecules are conjugated to the second antibody binding fragment. An exemplary targeting conjugate is shown in FIG. 1A. An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWMSWVRQAPGKGLEWVANIKQDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGWFGELAFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK(SEQ ID NO: 102) and an antibody light chain of EIVLTQSPGTLSLSPGERATLSCRASQRVSSSYLAWYQQKPGQAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSLPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO: 103) ; an antibody binding fragment comprising a sequence selected from the group consisting of SEQ ID NOs: 76-79, 156 and a therapeutic agent selected from the group consisting of compounds of Formulae (4) - (6) .
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first effector molecule (e.g., a small molecule drug) comprising a first linker; (F) a second effector molecule (e.g., a small molecule drug) comprising a second linker; (G) a first antibody binding fragment; (H) a second antibody binding fragment; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first effector molecule (e.g., a small molecule drug) is conjugated to the first antibody binding fragment via the first linker; wherein the second effector molecule (e.g., a small molecule drug) is conjugated to the second antibody binding fragment via the second linker; wherein the first antibody binding fragment is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain. In some embodiments, two or more effector molecules are conjugated to the first antibody binding fragment. In some embodiments, two or more effector molecules are conjugated to the second antibody binding fragment. An exemplary targeting conjugate is shown in FIG. 1B. An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment selected from the group consisting of SEQ ID NOs: 76-79 and 156, and a therapeutic agent selected from the group consisting of compounds of Formulae (1) - (3) .
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first oligonucleotide and a first linker; (F) a second oligonucleotide and a second linker; (G) a first antibody binding fragment comprising a first protease cleavage site (e.g., a uPA cleavage site) ; (H) a second antibody binding fragment comprising a second protease cleavage site (e.g., a uPA cleavage site) ; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first oligonucleotide is conjugated to the first antibody binding fragment via the first linker; wherein the second oligonucleotide is conjugated to the second antibody binding fragment via the second linker; wherein the first antibody binding fragment  is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain; wherein upon cleavage of the first cleavage site, the first oligonucleotide is released from the first antibody binding fragment; and wherein upon cleavage of the second protease cleavage site, the second oligonucleotide is released from the second antibody binding fragment. In some embodiments, two or more oligonucleotide are conjugated to the first antibody binding fragment. In some embodiments, two or more oligonucleotide are conjugated to the second antibody binding fragment. An exemplary targeting conjugate is shown in FIG. 2A.
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first oligonucleotide and a first linker; (F) a second oligonucleotide and a second linker; (G) a first antibody binding fragment; (H) a second antibody binding fragment; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first oligonucleotide is conjugated to the first antibody binding fragment via the first linker; wherein the second oligonucleotide is conjugated to the second antibody binding fragment via the second linker; wherein the first antibody binding fragment is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain. In some embodiments, two or more oligonucleotides are conjugated to the first antibody binding fragment. In some embodiments, two or more oligonucleotides are conjugated to the second antibody binding fragment. An exemplary targeting conjugate is shown in FIG. 2B.
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain; (E) a first oligonucleotide; (F) a second oligonucleotide; (G) a first moiety comprising a first antibody binding fragment, a first protease cleavage site (e.g., a uPA cleavage site) , and a first oligonucleotide binding peptide; (H) a second moiety comprising a second antibody binding fragment, a second protease cleavage site (e.g., a uPA cleavage site) , and a second oligonucleotide binding peptide; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds  to a second epitope; wherein the first oligonucleotide is conjugated non-covalently to the first oligonucleotide binding peptide; wherein the second oligonucleotide is conjugated non-covalently to the second oligonucleotide binding peptide; wherein the first antibody binding fragment is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain; wherein upon cleavage of the first cleavage site, the first oligonucleotide is released from the first antibody binding fragment; wherein upon cleavage of the second cleavage site, the second oligonucleotide is released from the second antibody binding fragment. In some embodiments, two or more oligonucleotides are conjugated to the first oligonucleotide binding peptide. In some embodiments, two or more oligonucleotides are conjugated to the second oligonucleotide binding peptide. An exemplary targeting conjugate is shown in FIG. 3A. An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 148-150; a crosslinker selected from the group consisting of: SMCC, maleimide-amido-PEG 2-TFP, and maleimide-PEG 2-DBCO; and a CpG ODN comprising a nucleic acid sequence of SEQ ID NO: 67.
In some embodiments, there is provided a targeting conjugate comprising: (A) a first antibody heavy chain; (B) a second antibody heavy chain; (C) a first antibody light chain; (D) a second antibody light chain, (E) a first oligonucleotide; (F) a second oligonucleotide; (G) a first moiety comprising a first antibody binding fragment and a first oligonucleotide binding peptide; (H) a second moiety comprising a second antibody binding fragment and a second oligonucleotide binding peptide; wherein the first antibody heavy chain and the first antibody light chain form a first antigen binding site that specifically binds to a first epitope; wherein the second antibody heavy chain and the second antibody light chain form a second antigen binding site that specifically binds to a second epitope; wherein the first oligonucleotide is conjugated non-covalently to the first oligonucleotide binding peptide; wherein the second oligonucleotide is conjugated non-covalently to the second oligonucleotide binding peptide; wherein the first antibody binding fragment is covalently conjugated to the first antibody heavy chain; wherein the second antibody binding fragment is covalently conjugated to the second antibody heavy chain. An exemplary targeting conjugate is shown in FIG. 3B. An exemplary targeting conjugate may comprise: a targeting moiety comprising an antibody heavy chain of SEQ ID NO: 102 and an antibody light chain of SEQ ID NO: 103; an antibody binding fragment comprising a sequence selected from the group consisting of SEQ ID NOs: 74 and  80-83; a crosslinker selected from the group consisting of: SMCC, maleimide-amido-PEG 2-TFP, and maleimide-PEG 2-DBCO; and a CpG ODN comprising a nucleic acid sequence of SEQ ID NO: 67.
In some embodiments according to any one of the targeting conjugates described in this section, the first and the second effector molecules are the same. In some embodiments, the first and the second effector molecules are different. In some embodiments, the first and the second oligonucleotides are the same. In some embodiments, the first and the second oligonucleotides are different. In some embodiments, the targeting moiety is monospecific. In some embodiments, the targeting moiety is multispecific, such as bispecific, or trispecific.
In some embodiments, there is provided a targeting conjugate comprising: (a) an antibody heavy chain comprising an amino acid sequence having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to SEQ ID NO: 102; (b) an antibody light chain comprising an amino acid sequence having at least 80% (e.g., at least about any one of 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%; or 100%) sequence identity to SEQ ID NO: 103; (c) an antibody binding fragment that is covalently conjugated to the antibody heavy chain; and (d) an effector molecule, wherein the effector molecule is conjugated to the antibody heavy chain via the antibody binding fragment. In some embodiments, the antibody binding polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156. In some embodiments, the effector molecule is a therapeutic agent, such as selected from compounds of Formulae (1) - (6) In some embodiments, the effector molecule is an oligonucleotide, such as a CpG oligonucleotide, e.g., an oligonucleotide comprising a nucleic acid selected from the group consisting of SEQ ID NOs: 66-67.
III. Methods of treatment
The targeting conjugates described herein and compositions thereof (such as pharmaceutical composition) can be used to treat or diagnose various diseases, such as cancer, including solid tumor or hematological cancer, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
Thus, in some embodiments, there is provided a method of treating a disease in an individual (such as a human) , comprising administering to the individual an effective amount of any one of the targeting conjugates described herein, wherein the targeting conjugate comprises an effector molecule selected from the group consisting of a therapeutic agent and an oligonucleotide. In some embodiments, the disease is selected from the group consisting of  tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease. In some embodiments, the disease is cancer. In some embodiments, the cancer is selected from the group consisting of bladder cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, esophageal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, non-Hodgkin’s lymphoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, thyroid cancer and uterine cancer.
In some embodiments, there is provided a method of treating a disease (such as cancer) associated with a target molecule in an individual, comprising administering to the individual an effective amount of a targeting conjugate comprising the structure of Formula I:
Figure PCTCN2021077866-appb-000025
wherein: A is a targeting moiety that specifically binds to the target molecule; B is a TBF comprising a targeting moiety binding peptide; P is a cleavage site; L is a linker; C is a conjugation site; D is a therapeutic agent or an oligonucleotide; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; and d=1-20. In some embodiments, z=0. In some embodiments, z=1. In some embodiments, y=0. In some embodiments, y=1. In some embodiments, x=0. In some embodiments, x=1. In some embodiments, a is 1 or more. In some embodiments, b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
In some embodiments, there is provided a method of diagnosing a disease in an individual (such as a human) , comprising administering to the individual an effective amount of any one of the targeting conjugates described herein, wherein the targeting conjugate comprises a detectable label, and wherein detection of the detectable label is indicative of the presence of the disease. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease. In some embodiments, the disease is cancer. In some embodiments, the cancer is selected from the group consisting of bladder cancer, brain cancer, breast cancer, cervical cancer, colorectal cancer, esophageal cancer, kidney cancer, leukemia, liver cancer, lung cancer, melanoma, non-Hodgkin’s lymphoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, thyroid cancer and uterine cancer.
In some embodiments, there is provided a method of diagnosing a disease (such as cancer) associated with a target molecule in an individual, comprising administering to the individual an effective amount of a targeting conjugate comprising the structure of Formula I:
Figure PCTCN2021077866-appb-000026
wherein: A is a targeting moiety that specifically binds to the target molecule; B is a TBF comprising a targeting moiety binding peptide; P is a cleavage site; L is a linker; C is a conjugation site; D is a detectable label; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; and d=1-20; wherein detection of the detectable label is indicative of the presence of the disease. In some embodiments, z=0. In some embodiments, z=1. In some embodiments, y=0. In some embodiments, y=1. In some embodiments, x=0. In some embodiments, x=1. In some embodiments, a is 1 or more. In some embodiments, b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
In some embodiments, there is provided a method of preferentially delivering an effector molecule (e.g., a therapeutic agent, an oligonucleotide and/or a detectable label) to a diseased site in an individual in need of treatment or diagnosis with the effector molecule, comprising administering to the individual an effective amount of a targeting conjugate comprising the structure of Formula I:
Figure PCTCN2021077866-appb-000027
wherein: A is a targeting moiety that specifically binds to the target molecule; B is a TBF comprising a targeting moiety binding peptide; P is a cleavage site; L is a linker; C is a conjugation site; D is a therapeutic agent or an oligonucleotide; x=0 or 1; y=0 or 1; z=0 or 1; a=1-20; b=1-20; and d=1-20. In some embodiments, z=0. In some embodiments, z=1. In some embodiments, y=0. In some embodiments, y=1. In some embodiments, x=0. In some embodiments, x=1. In some embodiments, a is 1 or more. In some embodiments, b is 1 or more. In some embodiments, a is 2-10. In some embodiments, b is 2-10. In some embodiments, d is 2-10. In some embodiments, the disease is selected from the group consisting of tumor, infection, inflammatory disease, autoimmune disease, and immunodeficiency disease.
In some embodiments, the method increases the effective concentration of the effector molecule at a diseased site in an individual in need of treatment with the effector molecule. In  some embodiments, the effective concentration of the effector molecule is increased by about any of 10%, 20%, 50%, 1x, 2x, 5x, 10x or more at the diseased site compared to administration of the effector molecule alone to the individual at the same effective amount.
In some embodiments, the method reduces binding of the effector molecule to a target molecule in normal tissues in an individual having a disease in need of treatment with the effector molecule. In some embodiments, administration of the targeting conjugate reduces binding of the effector molecule to its target molecule on normal cells by about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%or more compared to administration of the effector molecule alone to the individual.
In some embodiments, the method reduces toxicity (such as on-target off-tissue toxicity) of the effector molecule to an individual having a disease in need of treatment with the effector molecule. In some embodiments, administration of the targeting conjugate reduces the toxicity of the effector molecule by about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%or more compared to administration of the effector molecule alone at the same effective amount to the individual.
Also provided are any one of the targeting conjugates described herein for use in treating or diagnosing a disease in an individual in need thereof, or use of any one of the targeting conjugates described herein in the preparation of a medicament for treating or diagnosing a disease in an individual in need thereof.
The targeting conjugates described herein can be administered to an individual via various routes, for example, with the same route of administration as the targeting moiety in the targeting conjugate. Exemplary routes of administration include, but are not limited to parenteral, intravenous, intramuscular, and subcutaneous administration.
The effective amount, suitable dose, and dosing schedule of the targeting conjugate administered to an individual can vary depending on the particular composition, the route of administration, and the particular type of disease being treated. In some embodiments, the effective amount of the targeting conjugate is based on the effective amount of the targeting moiety and/or the effector molecule (e.g., therapeutic agent, oligonucleotide, and/or detectable label) .
In some embodiments, the individual is a mammal, such as human, rodents, or primates. In some embodiments, the individual is human.
In some embodiments, the targeting conjugate is used alone or in combination with other anticancer treatments such as chemotherapeutic agents, ionizing radiation, hormonal therapy, cytokines, immunotherapy, cellular therapy, vaccines, monoclonal antibodies,  antiangiogenic agents, targeted therapeutics (small molecule drugs) , or biological therapies. For example, chemotherapeutic agents include, but are not limited to, antitumor alkylating agents such as Mustards (mechlorethamine HCl, melphalan, chlorambucil, cyclophosphamide, ifosfamide, busulfan) , Nitrosoureas (BCNU/cannustine, CCNU/lomustine, MeCCNU/semustine, fotemustine, treptozotocin) , Tetrazines (dacarbazine, mitozolomide, temozolomide) , Aziridines (thiotepa, mitomycin C, AZQ/diaziquone) , procarbazine HCl, hexamethylmelamine, adozelesin; cisplatin and its analogues, cisplatin, carboplatin, oxaliplatin; antimetabolites, methotrexate, other antifolates, 5-fluoropyrimidines (5-fluorouracil/5-FU) , cytarabine, azacitidine, gemcitabine, 6-thiopurines (6-mercaptopurine, thioguanine) , hydroxyurea; topoisomerase interactive agents epipodophyllotoxins (etoposide, teniposide) , camptothecin analogues (topotecan HCl, irinotecan, 9-aminocamptothecin) , anthracyclines and related compounds (doxorubicin HCl, liposomal epirubicin, daunorubicin HCl, daunorubicin HCl citrate liposomal, epirubicin, idarubicin) , mitoxantrone, losoxantrone, actinomycin-D, amsacrine, pyrazoloacridine; antimicotubule agents Vinca alkaloids (vindesine, vincristine, vinblastine, vinorelbine) , the taxanes (paclitaxel, docetaxel) , estramustine; fludarabine, 2-chlorodeoxyadenosine, 2 '-deoxycoformycin, homoharringtonine, suramin, bleomycin, L-asparaginase, floxuridine, capecitabine, cladribine, leucovorin, pentostatin, retinoids (all-trans retinoic acid, 13-cis-retinoic acid, 9-cis-retinoic acid, isotretinoin, tretinoin) , pamidronate, thalidomide, cyclosporine; hormonal therapies antiestrogens (tamoxifen, toremifene, medroxyprogesterone acetate, megestrol acetate) , aromatase inhibitors (aminoglutethimide, letrozole/femara, anastrozole/arirnidex, exemestane/aromasin, vorozole) , gonadotropin-releasing hormone analogues, antiandrogens (flutamide, casodex) , fluoxymeterone, diethylstilbestrol, octreotide, leuprolide acetate, zoladex; steroidal and non-steroidal anti-inflammatory agents (dexamethasone, prednisone) ; Monoclonal antibodies including, but not limited to, anti-HER2/neu antibody (herceptin/trastuzumab) , anti-EGFR antibody (cetuximab/erbitux, ABX-EGF/panitumumab, nimotuzurnab) , anti-CD20 antibody (rituxan/rituximab, ibritumomab/Zevalin, tositumomab/Bexxar) , anti-CD33 antibody (gemtuzumab/MyloTarg) , alemtuzumab/Campath, bevacizumab/Avastin; and small molecule inhibitors.
IV. Pharmaceutical compositions, kits and articles of manufacture
Further provided by the present application are compositions (e.g., pharmaceutical compositions, or diagnostic compositions) , kits, and articles of manufacture comprising any one of the targeting conjugates disclosed herein. In some embodiments, there is provided a  pharmaceutical composition comprising any one of the targeting conjugates described herein, wherein the effector molecule is a therapeutic agent or an oligonucleotide, and a pharmaceutically-acceptable carrier. In some embodiments, the composition (such as pharmaceutical composition or diagnostic compositions) comprises a carrier, diluent, or excipient, which may facilitate administration of the composition to an individual in need thereof. Examples of carriers, diluents, and excipients include, but are not limited to, calcium carbonate, calcium phosphate, various sugars such as lactose, or types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols and physiologically compatible solvents.
In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) comprises a plurality of targeting conjugates. In some embodiments, the targeting conjugate molecules in the composition (e.g., pharmaceutical composition or diagnostic composition) do not have the same number of effector molecules. In some embodiments, at least two of the targeting conjugates in the composition (e.g., pharmaceutical composition or diagnostic composition) comprise different numbers of effector molecules. The ratio between the effector molecule and the targeting moiety in the pharmaceutical compositions is within a certain range in order for the composition (e.g., pharmaceutical composition or diagnostic composition) to receive regulatory approval.
In some embodiments, the average drug loading of the composition (e.g., pharmaceutical composition or diagnostic composition) is at least about any one of 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 60: 1, 70: 1, 80: 1, 90: 1, 100: 1 or more. In some embodiments, the average drug loading of the composition (e.g., pharmaceutical composition or diagnostic composition) is no more than about any one of 100: 1, 90: 1, 80: 1, 70: 1, 60: 1, 50: 1, 40: 1, 30: 1, 20: 1, 19: 1, 18: 1, 17: 1, 16: 1, 15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, or 2: 1. In some embodiments, the average drug loading of the composition (e.g., pharmaceutical composition or diagnostic composition) is about any one of 2: 1-4: 1, 2: 1-8: 1, 2: 1-10: 1, 2: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 20: 1-40: 1, 40: 1-100: 1, 2: 1-20: 1, 2: 1-40: 1, or 10: 1-40: 1.
In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) has an average ratio of the effector molecule to the targeting moiety of at least about any one of 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 11: 1, 12: 1, 13: 1, 14: 1, 15: 1, 16: 1, 17: 1, 17: 1, 18: 1, 19: 1, or 20: 1. In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) has an average ratio of the effector molecule to the targeting moiety of no more than about any one of 20: 1, 19: 1, 18: 1, 17: 1, 16: 1,  15: 1, 14: 1, 13: 1, 12: 1, 11: 1, 10: 1, 9: 1, 8: 1, 7: 1, 6: 1, 5: 1, 4: 1, 3: 1, 2: 1, or 1: 1. In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) has an average ratio of the effector molecule to the targeting moiety of about any one of 1: 1-2: 1, 2: 1-4: 1, 4: 1-8: 1, 1: 1-10: 1, 1: 1-16: 1, 4: 1-20: 1, 10: 1-20: 1, 1: 1-20: 1, or 2: 1-20: 1.
The composition (e.g., pharmaceutical composition or diagnostic composition) described herein can be prepared by mixing the ingredients following generally accepted procedures. For example, the selected components may be simply mixed in a blender or other standard device to produce a concentrated mixture which may then be adjusted to the final concentration and viscosity by the addition of water or thickening agent and possibly a buffer to control pH or an additional solute to control tonicity.
Other pharmaceutically acceptable carriers and their formulation are described in standard formulation treatises, e.g., Remington's Pharmaceutical Sciences by E.W. Martin. See also Wang, Y.J. and Hanson, M.A. “Parenteral Formulations of Proteins and Peptides: Stability and Stabilizers, ” Journal of Parenteral Science and Technology, Technical Report No. 10, Supp. 42: 2S (1988) .
In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) is a liquid suspension. In some embodiments, the composition (e.g., pharmaceutical composition or diagnostic composition) is a sterile composition.
Also provided are kits comprising any one of the targeting conjugates described herein. The kits of the invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags) , and the like. Kits may optionally provide additional components such as buffers and interpretative information. The present application thus also provides articles of manufacture, which include vials (such as sealed vials) , bottles, jars, flexible packaging, and the like.
The article of manufacture can comprise a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, etc. The containers may be formed from a variety of materials such as glass or plastic. Generally, the container holds a composition which is effective for treating or diagnosing a disease as described herein, and may have a sterile access port. The label or package insert indicates that the composition is used for treating or diagnosing a disease in an individual. The label or package insert will further comprise instructions for administering the composition to the individual.
Package insert refers to instructions customarily included in commercial packages of therapeutic products that contain information about the indications, usage, dosage,  administration, contraindications and/or warnings concerning the use of such therapeutic products. In some embodiments, the package insert indicates that the composition is used for treating a disease (such as cancer) .
Additionally, the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI) , phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
EXAMPLES
The examples below are intended to be purely exemplary of the invention and should therefore not be considered to limit the invention in any way. The following examples and detailed description are offered by way of illustration and not by way of limitation.
Example 1 Design, synthesis and characterization of TBP
1. Overall design and synthesis
Targeting moiety binding peptides (TBPs) with or without oligonucleotide binding peptides (OBPs) (in the sequence table of SEQ ID NOs: 74-83, 148-150, 152, and 156) were designed and synthesized by solid phase synthesis, and verified by LC-MS. SEQ ID NO: 151 (NH 2- (PEG)  12-RSQSRSRYYRQRQRSRRRRRRS) lacking an antibody binding peptide was designed and synthesized as a control.
2. Affinities between TBP and antibody
The affinities between TBPs and antibody Ab2B (heavy chain SEQ ID NO: 102, light chain SEQ ID NO: 103) were measured with Biacore. Anti-human Fab was ligated to Biacore chips at pH 4.5. Ab2B was captured as ligand for 110s at 10 μL/min flow speed. TBPs were flowed through the chip as analytes at 30 μL/min. 10 mM glycine at pH 1.5 was used for regeneration of the chip. Conditions were optimized as needed. The experimental design is shown in Table 2.
Table 2. Experimental design
Figure PCTCN2021077866-appb-000028
Figure PCTCN2021077866-appb-000029
The results are shown in Table 3. SEQ ID NO: 151 lacking an antibody binding peptide section did not bind to Ab2B. The other TBPs tested effectively bound to Ab2B with high affinities (Table 3) .
Table 3. Results of Biacore affinity measurements
Figure PCTCN2021077866-appb-000030
Example 2 Design, synthesis and characterization of TBF-Drug conjugates
TBF-drug conjugates of compounds of Formulae (7) - (12) (shown below) were designed and synthesized by solid phase synthesis of peptides and then by chemical conjugation. The general formula of TBF-drug conjugate is TBF-R- (PEG)  m-VC-PAB- (DMAE)  k-Drug (Formula V) , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1. In some embodiments, the linker is represented by TBF-R- (PEG)  m-P-PAB- (DMAE)  k-Drug (Formula VI) , wherein R is an amine-reactive or sulfhydryl-reactive group, P is a cleavage site, m and k are integers, m≥0, and k is 0 or 1.
The expected conjugation products (Formulae (7) - (12) ) are shown below:
Compound of Formula (7) GSCGSDCAWHLGELVWCT-MAL-VC-PAB-DMAE-phenol linked SN38
Figure PCTCN2021077866-appb-000031
Compound of Formula (8) GSCGSDCAWHLGELVWCT-MAL-VC-PAB-DMAE-α-hydroxy lactone linked SN38
Figure PCTCN2021077866-appb-000032
Compound of Formula (9) GSCGSDCAWHLGELVWCT-MAL-VC-PAB-MMAE
Figure PCTCN2021077866-appb-000033
Compound of Formula (10) GSCGSDCAWHLGELVWCT-MAL-LGGSGRNAQVRLE-PAB-DMAE-phenol linked  SN38
Figure PCTCN2021077866-appb-000034
(10) Compound of Formula (11) GSCGSDCAWHLGELVWCT-MAL-LGGSGRNAQVRLE-PAB-DMAE-α-hydroxy lactone  linked SN38
Figure PCTCN2021077866-appb-000035
(11) Compound of Formula (12) GSCGSDCAWHLGELVWCT-MAL-LGGSGRNAQVRLE-PAB-MMAE
Figure PCTCN2021077866-appb-000036
(12) Example 3 Design and screening of uPA substrate peptides
1. Peptide cleavage efficiency
Urokinase-type Plasminogen Activator (uPA) substrate peptides (SEQ ID NOs: 50-54) were screened for the efficiency of substrates cleavage by uPA but resistance to Tissue-type Plasminogen Activator (tPA) digestion. Substrate peptides and PBS were added to 384 plates and mixed with uPA or tPA. Efficiency of digestion was measure by Fluorescence Resonance Energy Transfer (FRET) method. Experimental designs were shown in Table 4. Results are shown in Tables 5-7.
Table 4. Experimental Design
Figure PCTCN2021077866-appb-000037
Figure PCTCN2021077866-appb-000038
uPA effectively cleaved peptides of SEQ ID NOs: 50-54, as shown in Table 5 below:
Table 5. uPA cleavage for SEQ ID NOs: 50-54
Figure PCTCN2021077866-appb-000039
The shorter the time it took to reach plateau in fluorescence intensity, the faster the uPA digestion. The higher the fold of increase in fluorescence intensity, the more efficient the uPA digestion. Therefore, the rankings of uPA digestion rates for the peptides were: SEQ ID NOs: 52, 54 > SEQ ID NO: 53 > SEQ ID NO: 50 > SEQ ID NO: 51. The rankings of reaction  efficiency were: SEQ ID NO: 51> SEQ ID NO: 50> SEQ ID NO: 54 > SEQ ID NO: 52 > SEQ ID NO: 53.
At 7.5×10 -3 mg/mL tPA concentration, only SEQ ID NOs: 51 and 52 were mildly digested, as shown in Table 6:
Table 6. tPA digestion at 7.5×10 -3 mg/mL concentration
Figure PCTCN2021077866-appb-000040
At 2.25×10 -2 mg/mL tPA concentration, SEQ ID NOs: 51, 52 and 54 were digested, as shown in Table 7:
Table 7. tPA digestion at 2.25×10 -2 mg/mL concentration
Figure PCTCN2021077866-appb-000041
2. Stability of the substrate peptides in plasma measured by FRET
Plasma was mixed with antibiotics (penicillin-streptomycin) and then peptides of SEQ ID NOs: 50-54 were added to the plasma mixture. The reaction mixture was incubated at room temperature. Samples were taken at 0 hour, 8 hours, 24 hours, 32 hours, 48 hours, 72 hours, 96 hours, 120 hours and 144 hours for FRET measurements. The experimental design is shown in Table 8.
Table 8. Experimental Design
Figure PCTCN2021077866-appb-000042
Fold of increase in fluorescence intensity for each of the substrate peptides in plasma is shown in Table 9 below:
Table 9. Fold increase of fluorescence intensity for SEQ ID NOs: 50-54
Figure PCTCN2021077866-appb-000043
The rankings of peptides stability in the plasma are approximately: SEQ ID NO: 53 >SEQ ID NOs: 51, 52 > SEQ ID NO: 50> SEQ ID NO: 54.
3. Stability of the substrate peptides in plasma from kinetic measurements
Experiments were designed as shown in Table 10. Plasma-peptide mixtures were incubated at room temperature for 12 hours and fluorescence intensities were measured continuously. Results are shown in Table 11. PS: penicillin-streptomycin.
Table 10. Experimental Design
No. V peptide (μL) V PS (μL) V (μL) V total (μL) C peptide (mM)
1 SEQ ID NO 50: 6.34 2.5 35.86 50 0.5
2 SEQ ID NO 51: 4.30 2.5 37.9 50 0.5
3 SEQ ID NO 52: 8.14 2.5 39.36 50 0.5
4 SEQ ID NO 53: 8.70 2.5 37 50 0.5
5 SEQ ID NO 54: 9.77 2.5 37.08 50 0.5
6 0 2.5 42.2 50 0
Table 11. Kinetic measurements of substrate stability
Figure PCTCN2021077866-appb-000044
The rankings of peptide stability in the plasma were approximately SEQ ID NOs: 52, 53 > SEQ ID NO: 50 > SEQ ID Nos: 51, 54. For SEQ ID NOs 52 and 53, the fluorescence intensities increased with time to 2.0-fold and 1.7-fold respectively, but did not reach a plateau within 12 hours. SEQ ID NO: 50 reached plateau in 4.8 hours, and the maximum fold of increase in fluorescence intensity was 2.8-fold. The fluorescence intensities of SEQ ID NOs: 51 and 54 increased to 2.3-fold and 2.7-fold within 3.6 hours, respectively.
4. uPA digestion in antibodies
Antibodies Ab3C (heavy chain sequence SEQ ID NO: 108, light chain sequence SEQ ID NO: 109) , Ab3E (heavy chain sequence SEQ ID NO: 110, light chain sequence SEQ ID NO: 111) and Ab5D (heavy chain sequence SEQ ID NO: 124, light chain sequence SEQ ID NO: 125) containing a uPA substrate sequence in the heavy chain were used to test uPA digestion efficiency in antibodies. Antibody Ab5C (heavy chain sequence SEQ ID NO: 122, light chain sequence SEQ ID NO: 123) that does not contain a uPA substrate sequence was used as a control. Experimental design is shown in Table 12 below. The reaction mixtures were incubated at 37℃ for 24 hours.
Table 12. Experimental design
Figure PCTCN2021077866-appb-000045
1Initial concentrations of Ab3C, Ab3E, Ab5C, and Ab5D were 2.12 mg/mL, 1.07 mg/mL, 9.2 mg/mL, and 7.8 mg/mL, respectively.  2Initial concentration of uPA was 0.25 mg/mL.  3Concentration of EDTA was 1mM.
The antibody sequences are as shown below:
SEQ ID NO: 108 (Ab3C, heavy chain sequence)
Figure PCTCN2021077866-appb-000046
Figure PCTCN2021077866-appb-000047
SEQ ID NO: 109 (Ab3C light chain sequence)
Figure PCTCN2021077866-appb-000048
SEQ ID NO: 110 (Ab3E heavy chain sequence)
Figure PCTCN2021077866-appb-000049
SEQ ID NO: 111 (Ab3E light chain sequence)
Figure PCTCN2021077866-appb-000050
SEQ ID NO: 122 (Ab5C heavy chain sequence)
Figure PCTCN2021077866-appb-000051
Figure PCTCN2021077866-appb-000052
SEQ ID NO: 123 (Ab5C light chain sequence)
Figure PCTCN2021077866-appb-000053
SEQ ID NO: 124 (Ab5D heavy chain sequence)
Figure PCTCN2021077866-appb-000054
SEQ ID NO: 125 (Ab5D light chain sequence)
Figure PCTCN2021077866-appb-000055
uPA digestion products were analyzed with LC-MS. The heavy chains of Ab3C, Ab3E and Ab5D were cleaved by uPA to yield fragments of expected molecular weight. Ab5C was not cleaved by uPA.
Example 4. Crosslinking between crosslinker and TBP
1. Experimental design
Homobifunctional and heterobifunctional crosslinkers were tested in conjugation to TBPs (SEQ ID NOs: 81, 82, 148 and 149) . Experimental design is shown in Table 13.
Table 13. Experimental design
Figure PCTCN2021077866-appb-000056
Structures of the crosslinkers are shown in Table 14:
Table 14. Chemical structures of the crosslinkers
Figure PCTCN2021077866-appb-000057
Figure PCTCN2021077866-appb-000058
2. Results
The expected conjugation products are shown below:
TBF1 (SEQ ID NO: 81 + DSG, Formula (13) )
Figure PCTCN2021077866-appb-000059
TBF2 (SEQ ID NO: 81 + DSS, Formula (14) )
Figure PCTCN2021077866-appb-000060
TBF3 (SEQ ID NO: 82 + SMCC, Formula (15) )
Figure PCTCN2021077866-appb-000061
TBF4 (SEQ ID NO: 82 + maleimide-amido-PEG 2-TFP, Formula (16) )
Figure PCTCN2021077866-appb-000062
TBF5 (SEQ ID NO: 82 + maleimide-amido-PEG 4-TFP, Formula (17) )
Figure PCTCN2021077866-appb-000063
TBF6 (SEQ ID NO: 82 + maleimide-amido-PEG 2-DBCO, Formula (18) )
Figure PCTCN2021077866-appb-000064
TBF7 (SEQ ID NO: 82 + maleimide-amido-PEG 4-DBCO, Formula (19) )
Figure PCTCN2021077866-appb-000065
TBF8 (SEQ ID NO: 148 + DSG, Formula (20) )
Figure PCTCN2021077866-appb-000066
TBF9 (SEQ ID NO: 148 + DSS, Formula (21) )
Figure PCTCN2021077866-appb-000067
TBF10 (SEQ ID NO: 149 + SMCC, Formula (22) )
Figure PCTCN2021077866-appb-000068
TBF11 (SEQ ID NO: 149 + maleimide-amido-PEG 2-TFP, Formula (23) )
Figure PCTCN2021077866-appb-000069
TBF12 (SEQ ID NO: 149 + maleimide-amido-PEG 4-TFP, Formula (24) )
Figure PCTCN2021077866-appb-000070
TBF13 (SEQ ID NO: 149 + maleimide-amido-PEG 2-DBCO, Formula (25) )
Figure PCTCN2021077866-appb-000071
TBF14 (SEQ ID NO: 149 + maleimide-amido-PEG 4-DBCO, Formula (26) )
Figure PCTCN2021077866-appb-000072
For SEQ ID NOs: 81 and 148, crosslinking products with DSS or DSG underwent hydrolysis. For SEQ ID NOs: 82 and 149, crosslinking with SMCC, maleimide-amido-PEG 2-TFP or maleimide-amido-PEG 4-TFP had over 90%yield, and crosslinking with maleimide-amido-PEG 2-DBCO or maleimide-amido-PEG 4-DBCO had over 90%yield.
Crosslinking products between TBPs and homobifunctional crosslinkers such as DSS and DSG had low stability and underwent hydrolysis. Heterobifunctional crosslinkers, on the contrary, formed stable crosslinking products with TBPs.
Example 5. Characterization of the antibodies
Monospecific PD-L1 antibodies Ab2B (heavy chain SEQ ID NO: 100, light chain SEQ ID NO: 101) , Ab3A (heavy chain SEQ ID NO: 104, light chain SEQ ID NO: 105) , Ab3B (heavy chain SEQ ID NO: 106, light chain SEQ ID NO: 107) , Ab3C (heavy chain SEQ ID NO: 108, light chain SEQ ID NO: 109) , Ab3E (heavy chain SEQ ID NO: 110, light chain SEQ ID NO: 111) , Ab3F (heavy chain SEQ ID NO: 112, light chain SEQ ID NO: 113) . The results of affinity to PD-L1 are shown in Table 15. The results show that the monospecific antibodies maintained high affinities to the antigen.
The antibody sequences are as shown below:
SEQ ID NO: 104 (Ab3A, heavy chain sequence)
Figure PCTCN2021077866-appb-000073
Figure PCTCN2021077866-appb-000074
SEQ ID NO: 105 (Ab3A, light chain sequence)
Figure PCTCN2021077866-appb-000075
SEQ ID NO: 106 (Ab3B heavy chain sequence)
Figure PCTCN2021077866-appb-000076
SEQ ID NO: 107 (Ab3B light chain sequence)
Figure PCTCN2021077866-appb-000077
SEQ ID NO: 112 (Ab3F heavy chain sequence)
Figure PCTCN2021077866-appb-000078
SEQ ID NO: 113 (Ab3F light chain sequence)
Figure PCTCN2021077866-appb-000079
Table 15. Affinities of antibodies to PD-L1
NO Ligand ka (1/Ms) kd (1/s) KD (M)
1 Ab2B 1.125E+06 1.658E-04 1.474E-10
2 Ab3A 7.363E+05 2.124E-04 2.884E-10
3 Ab3B 1.018E+06 1.163E-04 1.142E-10
4 Ab3C 1.010E+06 2.399E-04 2.375E-10
5 Ab3E 8.390E+05 2.527E-04 3.012E-10
6 Ab3F 7.311E+05 2.225E-04 3.044E-10
Example 6. TBF directed antibody-drug conjugation (TD-ADC)
TBF-drug conjugates selected from the group consisting of Compound of Formula (7) - (12) are mixed with the antibodies at 5: 1-50: 1 molar ratios, and the reaction mixtures are incubated under room temperature for 2-24 hours. Final products (TD-ADCs) are obtained by dialysis.
Example 7. TBF directed antibody-CpG ODN conjugation (TD-AOC)
TBF selected from the group consisting of Compound of Formula (13) - (26) are mixed with the antibodies at 5: 1-50: 1 molar ratios, and the reaction mixtures are incubated under room temperature for 2-24 hours. Ligation products are obtained by dialysis, and subjected to further ligation with CpG ODN at molar ratios between 1: 5-1: 50. Final products (TD-AOCs) are obtained by dialysis.

Claims (62)

  1. A targeting conjugate comprising a targeting moiety and an effector molecule, wherein the effector molecule is attached to the targeting moiety via a targeting moiety binding fragment (TBF) comprising a targeting moiety binding peptide, wherein the effector molecule can be released from the targeting conjugate via cleavage.
  2. The targeting conjugate of claim 1, wherein the targeting conjugate comprises the following structure:
    Figure PCTCN2021077866-appb-100001
    wherein:
    A is the targeting moiety;
    B is the targeting moiety binding fragment (TBF) ;
    P is a cleavage site;
    L is a linker;
    C is the conjugation site;
    D is the effector molecule;
    x = 0 or 1;
    y = 0 or 1;
    z = 0 or 1;
    a = 1-20;
    b = 1-20; and
    d = 1-20.
  3. The targeting conjugate of claim 1 or 2, wherein the targeting moiety comprises an antibody or antigen-binding fragment thereof.
  4. The targeting conjugate of claim 3, wherein the antibody or antigen-binding fragment thereof is selected from the group consisting of: a human antibody, a humanized antibody, a chimeric antibody, a monospecific antibody, a multispecific antibody, a diabody, a nanobody, an scFv, an scFab, a Fab fragment, a Fab’ fragment, a F (ab’)  2 fragment, and a dsFv.
  5. The targeting conjugate of claim 3 or 4, wherein the targeting moiety comprises an antibody-peptide fusion protein.
  6. The targeting conjugate of any one of claims 1-5, wherein the targeting moiety specifically binds to a target molecule at a target site.
  7. The targeting conjugate of any one of claims 1-6, wherein the cleavage is triggered by a condition at a target site for the targeting moiety.
  8. The targeting conjugate of claim 7, wherein the condition at a target site is selected from the group consisting of: protease, pH change, redox change, hypoxia, oxidative stress, hyperthermia, and extracellular ATP concentration.
  9. The targeting conjugate of claim 7 or 8, wherein the target site is site of a disease.
  10. The targeting conjugate of claim 9, wherein the disease is tumor.
  11. The targeting conjugate of any one of claims 1-10, wherein the cleavage is by a protease.
  12. The targeting conjugate of claim 11, wherein the protease is selected from the group consisting of: urokinase plasminogen activator (uPA) , legumain, plasmin, TMPRSS3, TMPRSS4, TMPRSS6, MMPl, MMP2, MMP-3, MMP-9, MMP-8, MMP-14, MT1-MMP, CATHEPSIN D, CATHEPSIN K, CATHEPSIN S, ADAM 10, ADAM12, ADAMTS, Caspase-1, Caspase-2, Caspase-3, Caspase-4, Caspase-5, Caspase-6, Caspase-7, Caspase-8, Caspase-9, Caspase-10, Caspase-11, Caspase-12, Caspase-13, Caspase-14, TACE, human neutrophil elastase, beta-secretase, fibroblast associated protein, matriptase, PSMA and PSA.
  13. The targeting conjugate of any one of claims 1-12, wherein the effector molecule is selected from the group consisting of a therapeutic agent, an oligonucleotide, and a detectable label.
  14. The targeting conjugate of claim 13, wherein the effector molecule is a therapeutic agent.
  15. The targeting conjugate of claim 14, wherein the effector molecule is selected from the group consisting of a protein-based drug, a small molecule drug, a cytotoxic agent, a toxin, an immunomodulatory agent, an anti-inflammatory agent, an anti-infective agent, and an epigenetic modulating agent.
  16. The targeting conjugate of claim 13, wherein the effector molecule is an oligonucleotide.
  17. The targeting conjugate of claim 16, wherein the oligonucleotide is about 2 to about 100 nucleotides long.
  18. The targeting conjugate of any one of claims 16 or 17, wherein the oligonucleotide is selected from the group consisting of: a double stranded DNA, a single stranded DNA, a double stranded RNA, a single stranded RNA, an antisense RNA, a small interference RNA, a microRNA, a short hairpin RNA (shRNA) , and a CpG oligonucleotide.
  19. The targeting conjugate of claim 16, wherein the oligonucleotide is a CpG oligonucleotide.
  20. The targeting conjugate of any one of claims 1-19, wherein the targeting conjugate comprises two or more effector molecules.
  21. The targeting conjugate of any one of claims 2-20, wherein x = 0 and C is an endogenous or engineered conjugation site on B.
  22. The targeting conjugate of any one of claims 2-20, wherein C is present in a cationic peptide or neutral charge peptide linked to B.
  23. The targeting conjugate of any one of claims 2-22, wherein C is a covalent conjugation site.
  24. The targeting conjugate of any one of claims 2-22, wherein C is a non-covalent conjugation site.
  25. The targeting conjugate of any one of claims 2-24, wherein x is 0.
  26. The targeting conjugate of any one of claims 2-20 and 22-24, wherein x is 1.
  27. The targeting conjugate of any one of claims 2-26, wherein y is 0.
  28. The targeting conjugate of any one of claims 2-26, wherein y is 1.
  29. The targeting conjugate of any one of claims 2-28, wherein z is 0.
  30. The targeting conjugate of any one of claims 2-28, wherein z is 1.
  31. The targeting conjugate of any one of claims 2-30, wherein a is 1 or more.
  32. The targeting conjugate of any one of claims 2-31, wherein b is 1 or more.
  33. The targeting conjugate of any one of claims 2-32, wherein d is 1 or more.
  34. The targeting conjugate of any one of claims 2-33, wherein a is between 2 to 10.
  35. The targeting conjugate of any one of claims 2-34, wherein b is between 2 to 10.
  36. The targeting conjugate of any one of claims 2-35, wherein d is between 2 to 10.
  37. The targeting conjugate of any one of claims 1-36, wherein the TBF is linked to the targeting moiety covalently.
  38. The targeting conjugate of any one of claims 1-36, wherein the TBF is linked to the targeting moiety non-covalently.
  39. The targeting conjugate of any one of claims 1-38, wherein the TBF comprises a TBP selected from the group consisting of Fc-BP1, FcBP-2, and Fc-III.
  40. The targeting conjugate of any one of claims 1-39, wherein the TBF comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 75-79, 152, and 156.
  41. The targeting conjugate of claim 40, wherein the TBF comprises a crosslinker selected from the group consisting of disuccinimidyl glutarate (DSG) , disuccinimidyl suberate (DSS) , Succinimidyl 4- [N-Maleimidomethyl] Cyclohexane-1-Carboxylate (SMCC) , Maleimide-amido-PEG n-TFP (TFP: tetrafluorophenyl) , and Maleimide-PEG n-DBCO (DBCO: dibenzocyclooctyne) , wherein n is an integer of 1-12.
  42. The targeting conjugate of any one of claims 1-41, wherein the targeting conjugate comprises a structure represented by the formula: TBF- (PEG)  n-P i-OBP j, wherein P is a cleavage site and OBP is an oligonucleotide binding peptide, and wherein n ≥ 0, i = 0 or 1, j = 0 or 1.
  43. The targeting conjugate of claim 42, wherein the targeting conjugate comprises a sequence that is selected from the group consisting of SEQ ID NOs: 74-83, 148-150, 152, and 156.
  44. The targeting conjugate of claim 42, wherein the targeting conjugate comprises a structure represented by a formula selected from the group consisting of Formulae (13) - (26) .
  45. The targeting conjugate of any one of claims 2-44, wherein L is represented by the formula: SH 2-Spacer, MAL-Spacer, NH 2-Spacer, or Osu-Spacer.
  46. The targeting conjugate of any one of claims 2-45, wherein L is represented by the formula: R- (PEG)  m-VC-PAB- (DMAE)  k , wherein R is an amine-reactive or sulfhydryl-reactive group, m and k are integers, m≥0, and k is 0 or 1.
  47. The targeting conjugate of any one of claims 2-45, wherein L is represented by R- (PEG)  m-P-PAB- (DMAE)  k, wherein R is an amine-reactive or sulfhydryl-reactive group, P is a cleavage site, m and k are integers, m≥0, and k is 0 or 1.
  48. The targeting conjugate of any one of claims 1-47, wherein the targeting conjugate comprises a structure represented by the formula TBF-R- (PEG)  m-VC-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, m and k are integers, m≥0, and k is 0 or 1.
  49. The targeting conjugate of any one of claims 1-47, wherein the targeting conjugate comprises a structure represented by the formula TBF-R- (PEG)  m-P-PAB- (DMAE)  k-Drug, wherein R is an amine-reactive or sulfhydryl-reactive group, Drug is a therapeutic agent, P is a cleavage site, m and k are integers, m≥0, and k is 0 or 1.
  50. The targeting conjugate of claims 48 or 49, wherein the targeting conjugate comprises a structure that is selected from the group consisting of Formulae (7) - (12) .
  51. The targeting conjugate of any one of claims 1-15 and 20-50, wherein the effector molecule is a therapeutic agent, and wherein the effector molecule is selected from the group consisting of compounds of Formulae (1) - (6) .
  52. A targeting conjugate comprising a targeting moiety conjugated to a therapeutic agent having a structure of a formula selected from the group consisting of compounds of Formulae (1) - (6) .
  53. A targeting conjugate comprising a targeting moiety conjugated to an effector molecule via a targeting moiety binding fragment, wherein the targeting moiety binding fragment comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 76-79, 152, and 156.
  54. The targeting conjugate of claim 42, wherein the targeting conjugate comprises a structure of a formula selected from the group consisting of Formulae (13) - (26) .
  55. A composition comprising a plurality of targeting conjugates of any one of claims 1-54.
  56. The composition of claim 55, wherein the average ratio of the effector molecule and the targeting moiety in the composition is at least about 1: 1.
  57. The composition of claim 55 or 56, wherein at least two of the targeting conjugates in the composition comprise different numbers of effector molecules.
  58. The composition of any one of claims 55-57, wherein the effector molecule is a therapeutic agent or oligonucleotide, and wherein the composition is a pharmaceutical composition.
  59. A method of treating a disease in an individual, comprising administering to the individual an effective amount of the pharmaceutical composition of claim 58.
  60. The composition of any one of claims 55-57, wherein the effector molecule is a detectable label, and wherein the composition is a diagnostic composition.
  61. A method of diagnosing a disease in an individual, comprising administering to the individual an effective amount of the diagnostic composition of claim 60, wherein the detection of the detectable label is indicative of the presence of the disease.
  62. A method of making a targeting conjugate of any one of claims 1-54, wherein the method comprises conjugating the effector molecule to the targeting moiety.
PCT/CN2021/077866 2021-02-25 2021-02-25 Targeting conjugates comprising targeting moiety binding fragments and uses thereof WO2022178753A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
PCT/CN2021/077866 WO2022178753A1 (en) 2021-02-25 2021-02-25 Targeting conjugates comprising targeting moiety binding fragments and uses thereof
PCT/CN2022/077725 WO2022179571A1 (en) 2021-02-25 2022-02-24 Targeting conjugates comprising targeting moiety binding fragments and uses thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
PCT/CN2021/077866 WO2022178753A1 (en) 2021-02-25 2021-02-25 Targeting conjugates comprising targeting moiety binding fragments and uses thereof

Publications (1)

Publication Number Publication Date
WO2022178753A1 true WO2022178753A1 (en) 2022-09-01

Family

ID=83047600

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/CN2021/077866 WO2022178753A1 (en) 2021-02-25 2021-02-25 Targeting conjugates comprising targeting moiety binding fragments and uses thereof
PCT/CN2022/077725 WO2022179571A1 (en) 2021-02-25 2022-02-24 Targeting conjugates comprising targeting moiety binding fragments and uses thereof

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/CN2022/077725 WO2022179571A1 (en) 2021-02-25 2022-02-24 Targeting conjugates comprising targeting moiety binding fragments and uses thereof

Country Status (1)

Country Link
WO (2) WO2022178753A1 (en)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106938051A (en) * 2016-08-22 2017-07-11 复旦大学 Target the antibody drug conjugates of tissue factor
US20180141976A1 (en) * 2015-05-20 2018-05-24 Kagoshima University Specific modification of antibody with igg-binding peptide
CN110997010A (en) * 2019-08-07 2020-04-10 烟台迈百瑞国际生物医药有限公司 Antibody drug conjugate and application thereof

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180141976A1 (en) * 2015-05-20 2018-05-24 Kagoshima University Specific modification of antibody with igg-binding peptide
CN106938051A (en) * 2016-08-22 2017-07-11 复旦大学 Target the antibody drug conjugates of tissue factor
CN110997010A (en) * 2019-08-07 2020-04-10 烟台迈百瑞国际生物医药有限公司 Antibody drug conjugate and application thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
MASO KATIA; MONTAGNER ISABELLA MONIA; GRIGOLETTO ANTONELLA; SCHIAVON ODDONE; ROSATO ANTONIO; PASUT GIANFRANCO: "A non-covalent antibody complex for the delivery of anti-cancer drugs", EUROPEAN JOURNAL OF PHARMACEUTICS AND BIOPHARMACEUTICS, vol. 142, 12 June 2019 (2019-06-12), NL , pages 49 - 60, XP085764889, ISSN: 0939-6411, DOI: 10.1016/j.ejpb.2019.06.012 *
SATOSHI KISHIMOTO, YUICHI NAKASHIMADA, RIRI YOKOTA, TAKAAKI HATANAKA, MOTOYASU ADACHI, YUJI ITO: "Site-Specific Chemical Conjugation of Antibodies by Using Affinity Peptide for the Development of Therapeutic Antibody Format", BIOCONJUGATE CHEMISTRY, vol. 30, no. 3, 20 March 2019 (2019-03-20), US , pages 698 - 702, XP055722777, ISSN: 1043-1802, DOI: 10.1021/acs.bioconjchem.8b00865 *
SUN YU, RONG HUANG, SUN BAI-WANG: "Advances in the study of site-specific antibody-drug conjugates", ACTA PHARMACEUTICA SINICA, vol. 50, no. 10, 31 December 2015 (2015-12-31), CN , pages 1225 - 1231, XP055961396, ISSN: 0513-4870, DOI: 10.16438/j.0513-4870.2015.10.023 *

Also Published As

Publication number Publication date
WO2022179571A1 (en) 2022-09-01

Similar Documents

Publication Publication Date Title
TWI804499B (en) Ror1 antibody immunoconjugates
TW201803599A (en) NaPi2b-targeted antibody-drug conjugates and methods of use thereof
KR20210042120A (en) Combination of antibody-drug conjugate and tubulin inhibitor
JP7337824B2 (en) Anti-CD33 and anti-CD7 combination therapy
JP7383682B2 (en) Anti-EDB antibodies and antibody-drug conjugates
AU2019360608A1 (en) Combination therapy utilizing DNA alkylating agents and ATR inhibitors
WO2021228044A1 (en) Drug conjugates containing alpha-enolase antibodies and uses thereof
US20230001006A1 (en) Amhrii-binding antibody drug conjugates and their use thereof in the treatment of cancers
CN114173823A (en) Use of anti-CEACAM 5 immunoconjugates for treating lung cancer
WO2022178753A1 (en) Targeting conjugates comprising targeting moiety binding fragments and uses thereof
WO2022179570A1 (en) Targeting conjugates comprising effector molecules and uses thereof
WO2022205316A1 (en) Targeting conjugates comprising effector molecules and uses thereof
WO2022178751A1 (en) Targeting conjugates comprising effector molecules and uses thereof
WO2022179572A1 (en) Targeting conjugates with therapeutic agents and oligonucleotides and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21927194

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21927194

Country of ref document: EP

Kind code of ref document: A1