WO2022150372A1 - Guide rna designs and complexes for type v cas systems - Google Patents

Guide rna designs and complexes for type v cas systems Download PDF

Info

Publication number
WO2022150372A1
WO2022150372A1 PCT/US2022/011294 US2022011294W WO2022150372A1 WO 2022150372 A1 WO2022150372 A1 WO 2022150372A1 US 2022011294 W US2022011294 W US 2022011294W WO 2022150372 A1 WO2022150372 A1 WO 2022150372A1
Authority
WO
WIPO (PCT)
Prior art keywords
grna
ligand binding
linker
complex
binding complex
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/011294
Other languages
English (en)
French (fr)
Inventor
Hide Bueno Machado
Kevin HEMPHILL
Robert BLASSBERG
Amanda Smith
Michael Daniel RUSHTON
Pablo PEREZ-DURAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Revvity Discovery Ltd
Dharmacon Inc
Original Assignee
Horizon Discovery Ltd
Dharmacon Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Horizon Discovery Ltd, Dharmacon Inc filed Critical Horizon Discovery Ltd
Priority to JP2023541017A priority Critical patent/JP2024502114A/ja
Priority to CA3207094A priority patent/CA3207094A1/en
Priority to US18/270,747 priority patent/US20240060088A1/en
Priority to CN202280019354.3A priority patent/CN117242184A/zh
Priority to EP22737039.2A priority patent/EP4274903A4/en
Publication of WO2022150372A1 publication Critical patent/WO2022150372A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • C12N15/902Stable introduction of foreign DNA into chromosome using homologous recombination
    • C12N15/907Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1136Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/16Aptamers
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/35Nature of the modification
    • C12N2310/351Conjugate
    • C12N2310/3519Fusion with another nucleic acid
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/50Physical structure
    • C12N2310/53Physical structure partially self-complementary or closed
    • C12N2310/531Stem-loop; Hairpin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/106Plasmid DNA for vertebrates
    • C12N2800/107Plasmid DNA for vertebrates for mammalian

Definitions

  • a tracrRNA trans-activating CRISPR RNA
  • a crRNA CRISPR RNA
  • a tracrRNA trans-activating CRISPR RNA
  • CRISPR RNA crRNA
  • the complementary sequence within the DNA thus becomes a target site, and the Cas9 protein may, based on its functional domain, cause editing at this target site.
  • Cas9 systems Among the limitations of Cas9 systems is that the functional domains upon which the Cas9 systems can act are defined by the functional domain of the Cas9 protein that one uses.
  • Other Cas proteins are known. Among these other Cas proteins, the potential of which has not been fully explored, are those within the Type V family. The use of enzymes from the Type V family is particularly underexplored when one seeks to introduce multiple edits at or near a target site. Therefore, there is a need to develop improved gRNAs (guide RNAs), as well as complexes and systems that incorporate and use them.
  • the present invention provides novel and non-obvious gRNA-ligand binding complexes, base editing complexes, and methods for base editing and genome modification. Through the use of various embodiments of the present invention, one may be able to efficiently and effectively cause base editing ex vivo, in vitro, and in vivo. Further, some embodiments of the present invention provide modular designs that allow for the same Type V Cas protein to be directed to different targeting sites and optionally associated with different effector proteins at the same or different sites.
  • the present invention provides a gRNA- ligand binding complex, wherein the gRNA-ligand binding complex comprises: (a) a gRNA, wherein the gRNA contains 60 to 210 nucleotides or 80 to 180 nucleotides and the gRNA comprises (i) a crRNA sequence, wherein the crRNA sequence is 36 to 60 nucleotides long or 35 to 60 nucleotides long and the crRNA sequence comprises a Cas association region, wherein the Cas association region is 18 to 30 nucleotides long and a targeting region, wherein the targeting region is 18 to 30 nucleotides long, and (ii) a tracrRNA sequence, wherein the tracrRNA sequence is 45 to 120 nucleotides long and wherein the tracrRNA sequence comprises an anti-repeat region and a distal region, wherein the anti-repeat region is at least 80% complementary to the Cas association region over at least 18 consecutive nucleotides of the
  • the present invention provides a base editing complex comprising: a gRNA-ligand binding complex of the present invention and a Type V Cas protein, wherein the Cas association region and the anti-repeat region of the gRNA-ligand binding complex are associated with the Type V Cas protein.
  • the ligand binding moiety is reversibly associated with a ligand that is attached to or a part of an effector molecule.
  • the present invention provides a method for base editing. The method comprises exposing a base editing complex of the present invention to double stranded DNA (“dsDNA”) or to single stranded DNA (“ssDNA”).
  • the base editing complex may be exposed to the dsDNA or ssDNA under conditions that permit base editing.
  • the gRNA-ligand binding complex comprises or encodes SEQ ID NO: 28.
  • the gRNA-ligand binding complex comprises or encodes any of SEQ ID NO: 59 to SEQ ID NO: 65.
  • the gRNA-ligand binding complex comprises or encodes any of SEQ ID NO: 67 to SEQ ID NO: 71.
  • the presence of the ligand binding moiety within the gRNA-ligand binding complex allows that complex to associate with the corresponding ligand associated with (or contained within) the effector.
  • the ligand binding moiety is associated with the gRNA in a manner and orientation that allows it to be capable of associating with a ligand.
  • the ligand is attached to or associated with the effector in a manner that renders it capable of reversibly associating with the ligand binding moiety.
  • the base editing complex also contains a Cas protein
  • that Cas protein and the effector can be retained in the same locality, e.g., at or near a target site of interest.
  • Figures 1A – 1D are representations of a Cas12b gRNA modified with one or two ligand binding moieties in which the tracrRNA and the crRNA are separate strands of oligonucleotides.
  • Figures 2A – 2D are representations of a Cas12b gRNA modified with one or two ligand binding moieties in which the tracrRNA and the crRNA are part of the same strand of oligonucleotides.
  • Figures 3A – 3D are representations of a Cas12e gRNA modified with a ligand binding moiety at different locations in which the tracrRNA and the crRNA are separate strands of oligonucleotides.
  • Figures 4A – 4C are representations of a Cas12e gRNA modified with ligand binding moieties in which the tracrRNA and the crRNA are separate strands of oligonucleotides.
  • Figures 5A – 5D are representations of a Cas12e gRNA modified with a ligand binding moiety at different locations in which the tracrRNA and the crRNA are part of the same strands of oligonucleotides.
  • Figures 6A – 6C are representations of a Cas12f gRNA modified with a ligand binding moiety at different locations in which the tracrRNA and the crRNA are separate strands of oligonucleotides.
  • Figures 7A – 7C are representations of a Cas12f gRNA modified with one or two ligand binding moieties in which the tracrRNA and the crRNA are part of the same strand of oligonucleotides.
  • Figures 8A and 8B are bar graphs that show the percentage of C to T transitions that were introduced by a Cas12b base editor in an HEK-293T cell line with different effectors.
  • Figures 9A – 9G are bar graphs that show the percentage of C to T transitions that were introduced by a Cas12b base editor in an HEK-293T cell line at multiple sites.
  • Figure 10 is a bar graph that shows the percentage of C to T transitions that were introduced by a Cas12b base editor in a U2OS cell line.
  • Figures 11A – 11D are bar graphs that show the percentage of C to T transitions that were introduced by a CasMINI base editor in an HEK-293T cell line.
  • 2′ modification refers to a nucleotide unit having a sugar moiety that is modified at the 2′ position of the sugar moiety.
  • An example of a 2′ modification is a 2′-O-alkyl modification that forms a 2'-O-alkyl modified nucleotide or a 2' halogen modification that forms a 2' halogen modified nucleotide.
  • 2′-O-alkyl modified nucleotide refers to a nucleotide unit having a sugar moiety, for example a deoxyribosyl or ribosyl moiety that is modified at the 2′ position such that an oxygen atom is attached both to the carbon atom located at the 2′ position of the sugar and to an alkyl group.
  • the alkyl moiety consists of or consists essentially of carbon(s) and hydrogens.
  • O-alkyl group e.g., -O-methyl, -O-ethyl, -O-propyl, -O-isopropyl, - O-butyl, -O-isobutyl, -O-ethyl-O-methyl (-OCH2CH2OCH3), and -O-ethyl-OH (- OCH 2 CH 2 OH).
  • a 2′-O-alkyl modified nucleotide may be substituted or unsubstituted.
  • halogen modified nucleotide refers to a nucleotide unit having a sugar moiety, for example a deoxyribosyl moiety that is modified at the 2′ position such that the carbon at that position is directly attached to a halogen species, e.g., Fl, Cl, or Br.
  • a “ligand binding moiety” refers to a moiety such as an aptamer e.g., oligonucleotide or peptide or another compound that binds to a specific ligand and can reversibly or irreversibly be associated with that ligand.
  • modified nucleotide refers to a nucleotide having at least one modification in the chemical structure of the base, sugar and/or phosphate, including, but not limited to, 5-position pyrimidine modifications, 8-position purine modifications, modifications at cytosine exocyclic amines, and substitution of 5- bromo-uracil or 5-iodouracil; and 2′- modifications, including but not limited to, sugar-modified ribonucleotides in which the 2′-OH is replaced by a group such as an H, OR, R, halo, SH, SR, NH2, NHR, NR2, or CN.
  • Modified bases refer to nucleotide bases such as, for example, adenine, guanine, cytosine, thymine, uracil, xanthine, inosine, and queuosine that have been modified by the replacement or addition of one or more atoms or groups.
  • nucleotide bases such as, for example, adenine, guanine, cytosine, thymine, uracil, xanthine, inosine, and queuosine that have been modified by the replacement or addition of one or more atoms or groups.
  • Some examples of these types of modifications include, but are not limited to, alkylated, halogenated, thiolated, aminated, amidated, or acetylated bases, alone and in various combinations.
  • More specific modified bases include, for example, 5-propynyluridine, 5-propynylcytidine, 6-methyladenine, 6-methylguanine, N,N,-dimethyladenine, 2- propyladenine, 2-propylguanine, 2-aminoadenine, 1-methylinosine, 3-methyluridine, 5-methylcytidine, 5-methyluridine and other nucleotides having a modification at the 5 position, 5-(2-amino)propyluridine, 5-halocytidine, 5-halouridine, 4-acetylcytidine, 1-methyladenosine, 2-methyladenosine, 3-methylcytidine, 6-methyluridine, 2- methylguanosine, 7-methylguanosine, 2,2-dimethylguanosine, 5- methylaminoethyluridine, 5-methyloxyuridine, deazanucleotides such as 7-deaza- adenosine, 6-azouridine, 6-azocytidine
  • Modified nucleotides also include those nucleotides that are modified with respect to the sugar moiety, as well as nucleotides having sugars or analogs thereof that are not ribosyl.
  • the sugar moieties may be, or be based on, mannoses, arabinoses, glucopyranoses, galactopyranoses, 4- thioribose, and other sugars, heterocycles, or carbocycles.
  • codes for and the term “encodes” mean that one sequence contains either a sequence that is identical to a referenced nucleotide sequence, a DNA or RNA equivalent of the referenced nucleotide sequence, or a DNA or RNA or a sequence that is a DNA or RNA complement of the referenced nucleotide sequence.
  • one refers to a sequence that codes for or encodes a recited DNA sequence one refers to a sequence that unless otherwise specified is any one of the following: the same DNA sequence, a complement of the DNA sequence, the RNA equivalent of that sequence, or the RNA complement of that sequence or any of the aforementioned in which one or more ribonucleotides is substituted for its deoxyribonucleotide counterpart or one or more deoxyribonucleotides is substituted for its ribonucleotide counterpart.
  • complementarity refers to the ability of a nucleic acid to form one or more hydrogen bonds with another nucleic acid sequence by either traditional Watson-Crick base-pairing or other non-traditional types of base pairs.
  • a percent complementarity indicates the percentage of residues in a nucleic acid molecule that can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary, respectively).
  • Perfectly complementary means that all of the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
  • substantially complementary refers to a degree of complementarity that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99%, over a region of, for example, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more consecutive nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
  • hybridization and “hybridizing” refer to a process in which completely, substantially, or partially complementary nucleic acid strands come together under specified hybridization conditions to form a double-stranded structure or region in which the two constituent strands are joined by hydrogen bonds. Unless otherwise stated, the hybridization conditions are naturally occurring or lab designed conditions. Although hydrogen bonds typically form between adenine and thymine or uracil (A and T or U) or between cytidine and guanine (C and G), other base pairs may form (see e.g., Adams et al., The Biochemistry of the Nucleic Acids, 11th ed., 1992).
  • nucleotide refers to a ribonucleotide or a deoxyribonucleotide or modified form thereof, as well as an analog thereof.
  • Nucleotides include species that comprise purines, e.g., adenine, hypoxanthine, guanine, and their derivatives and analogs, as well as pyrimidines, e.g., cytosine, uracil, thymine, and their derivatives and analogs.
  • a nucleotide comprises a cytosine, uracil, thymine, adenine, or guanine moiety.
  • nucleotide also includes those species that have a detectable label, such as for example a radioactive or fluorescent moiety, or mass label attached to the nucleotide.
  • nucleotide also includes what are known in the art as universal bases.
  • universal bases include but are not limited to 3-nitropyrrole, 5-nitroindole, or nebularine.
  • Nucleotide analogs are, for example, meant to include nucleotides with bases such as inosine, queuosine, xanthine, sugars such as 2′-methyl ribose, and non-natural phosphodiester internucleotide linkages such as methylphosphonates, phosphorothioates, phosphoroacetates and peptides.
  • bases such as inosine, queuosine, xanthine
  • sugars such as 2′-methyl ribose
  • non-natural phosphodiester internucleotide linkages such as methylphosphonates, phosphorothioates, phosphoroacetates and peptides.
  • tissue, cells and their progeny of an organism or other biological entity obtained in vivo or cultured in vitro are also encompassed within the terms subject and patient.
  • a subject may be an invertebrate animal, for example, an insect or a nematode; while in others, a subject may be a plant or a fungus.
  • treatment As used herein, "treatment,” “treating,” “palliating,” and “ameliorating” are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including, but not limited to, a therapeutic benefit and/or a prophylactic benefit.
  • therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment.
  • the complexes of the present invention may be administered to a subject, or a subject’s cells or tissues, or those of another subject extracorporeally before re-administration, at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, even though the disease, condition, or symptom might not have yet been manifested.
  • a number of ranges of values are provided. It is understood that each intervening value, to the tenth of the unit of the lower limit, unless the context clearly dictates otherwise, between the upper and lower limits of that range is also specifically disclosed.
  • the present invention comprises a gRNA- ligand binding complex that contains both a gRNA and a ligand binding moiety.
  • This complex has the ability to retain association with a Type V Cas protein.
  • the gRNA may be covalently bound directly to the ligand binding moiety or bound to the ligand binding moiety through a linker.
  • gRNA The gRNA of the gRNA-ligand binding complex is either a single strand of nucleotides that has at least one region that is self-complementary or two strands of nucleotides each of which has at least one region that is complementary to a region of the other strand. Within the gRNA, regardless of whether it is a single strand of nucleotides or two strands of nucleotides, there may be one or more loops.
  • the gRNA comprises two parts: a tracrRNA and a crRNA.
  • the nucleotides within the gRNA may be entirely RNA or a combination of ribonucleotides and other nucleotides such as deoxyribonucleotides.
  • Each nucleotide may be unmodified, or one or more nucleotides may be modified, e.g., with one of the following modifications: 2'-O-methyl, 2' fluoro or 2-aminopurine.
  • nucleotides there are consecutively modified nucleotides or a modification pattern of every second, or every third or every fourth nucleotide being modified at its 2' position with all other nucleotides being unmodified. Additionally or alternatively, between one or more pairs or every pair of consecutive nucleotides, there may be modified or unmodified internucleotide linkages.
  • the crRNA is 35 to 60 nucleotides or 36 to 60 nucleotides long or 40 to 55 nucleotides long.
  • a Cas association region which also may be referred to as a repeat region, that may be 18 to 30 nucleotides long or 20 to 25 nucleotides long
  • a targeting region which also may be referred to as a spacer region, that may be 18 to 30 nucleotides long or 20 to 25 nucleotides long.
  • the targeting region contains the targeting sequence, which is a variable sequence that may be selected based on where one wishes for the Cas protein and/or effector to cause base editing.
  • the targeting region may be designed to include a region that is complementary and capable of hybridization to a pre-selected target site of interest.
  • the region of complementarity between the targeting region and the corresponding target site sequence may be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 consecutive nucleotides in length or it may be at least 80%, at least 85%, at least 90%, or at least 95% complementary to a region of DNA over 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 consecutive nucleotides.
  • the targeting region is a region that does not hybridize with the tracrRNA and it may be downstream of the Cas association region.
  • the Cas association is designed based on the RNA binding domain of a Cas protein with which it is intended to associate. (Not all nucleotides within the Cas association need directly associate with the Cas protein.)
  • the tracrRNA sequence may, for example, be 30 to 210 nucleotides long or 45 to 120 nucleotides long or 60 to 100 nucleotides long or 70 to 90 nucleotides long.
  • the tracrRNA sequence comprises an anti-repeat region and a distal region. In some embodiments, the anti-repeat region is 18 to 60 nucleotides long or 25 to 50 nucleotides long or 30 to 40 nucleotides long.
  • the distal region may, for example, be 18 to 60 nucleotides long or 25 to 50 nucleotides long or 30 to 40.
  • the distal region is a region that does not hybridize with the crRNA and it may be upstream of the anti- repeat region.
  • the anti-repeat region is at least 80%, at least 85%, at least 90%, at least 95%, or 100% complementary to the Cas association region over at least 18 consecutive nucleotides of the Cas association region, and consequently, the Cas association region and the anti-repeat region are capable of hybridizing to form a hybridization region.
  • the gRNA When the tracrRNA and the crRNA hybridize over the hybridization region, the gRNA is capable of retaining association with an RNA binding domain of a Type V Cas protein. Preferably, this association is possible under both naturally occurring conditions and under laboratory conditions in which the complex is to be used.
  • the tracrRNA and crRNA are part of a contiguous strand of nucleotides, there may be a loop region between the tracrRNA and the crRNA of for example, 4 to 20 or 8 to 15 nucleotides.
  • the gRNA may comprise, consist essentially of or consist of the distal region, the anti-repeat region, the loop, the Cas association region and the targeting region.
  • tracrRNAs and crRNAs that may be of use in connection with the present invention appear below (all in 5' ⁇ 3' direction with N being any nucleotide, e.g., A, C, G, or U). In each sequence below a specific number of N nucleotides are shown.
  • the N may be 16 -30, which means that there can be 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides Alicyclobacillus acidoterrestris, AacCas12b crRNA SEQ ID NO: 1 5'-GUCGGAUCACUGAGCGAGCGAUCUGAGAAGUGGCACNNNNN NNNNNNNNNNN-3' SEQ ID NO: 2 5'-CGAGCGAUCUGAGAAGUGGCACNNNNNNNNNNNNNNNNNN-3' SEQ ID NO: 3 5'-CUGAGAAGUGGCACNNNNNNNNNNNNNNNNNNNNNN-3' AacCas12b tracrRNA SEQ ID NO: 4 5'-GUCUAGAGGACAGAAUUUUUCAACGGGUGUGCCAAUGGCCACUU UCCAGGUGGCAAAGCCCGUUGAGCUUCUCAAAAAG-3' SEQ ID NO: 5 5'-GUCUAGAGGACAGAAUUUUUCAACGGGUGUGCCAAUGGCCACU
  • Cas12b crRNA SEQ ID NO: 10 5'-GUCCAAGAAAAAAGAAAUGAUACGAGGCAUUAGCACNNNNNNN NNNNNNN-3' SEQ ID NO: 11 5'-AAAUGAUACGAGGCAUUAGCACNNNNNNNNNNNNNNNNNNNN-3' SEQ ID NO: 12 5'-CGAGGCAUUAGCACNNNNNNNNNNNNNNNN-3' Cas12e, CasX from Deltaproteobacteria Cas12e, DpbCasX, crRNA SEQ ID NO: 13 5'-CCGAUAAGUAAAACGCAUCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN-3' Cas12e, DpbCasX, tracrRNA SEQ ID NO: 14 5'-GGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUC GUAUGGACGAAGCGCUUAUUUAUCGGAGA-3' Cas12e, DpbCasX
  • the ligand binding moiety is an aptamer.
  • the ligand binding moiety may be bound to the gRNA directly, e.g., through a covalent bond, or through a linker.
  • the association of the ligand binding moiety with the gRNA, regardless of whether directly through a covalent bond or through a linker, may be at any of a number of locations, for example, the tracrRNA in either the anti-repeat region or the distal region or in the crRNA in the targeting region or the Cas association region, or a loop between the tracrRNA and the crRNA, if present.
  • a ligand binding moiety is bound directly to a gRNA if it is bound to a nucleotide within the gRNA, e.g., to the backbone phosphate of a unit or to a sugar moiety or to a nitrogenous base of a nucleotide.
  • the ligand binding moiety may be bound directly (through e.g., a covalent bond) to the 3' end of the gRNA or to the 5' end of the gRNA if the gRNA is a single strand (which correspond to the 5' end of the tracrRNA and the 3' end of the crRNA) or to the 3' end of the crRNA, the 3' end of the tracrRNA, the 5' end of the tracrRNA or the 5' end of the crRNA if they are separate strands.
  • the ligand binding moiety may be bound to the first or last nucleotide in the gRNA or in either strand of the gRNA.
  • the ligand binding moiety may be bound to a nucleotide that is not the first or last nucleotide in the gRNA (if a single stranded) or tracrRNA or crRNA (if separate strands).
  • the ligand binding moiety is a nucleotide sequence, and it is bound directly to the 5' end or the 3' end of the gRNA, it may be in the same 5' to 3' orientation as the gRNA.
  • nucleotides that contains both the ligand binding moiety and the gRNA and thus is either • 5' –[gRNA]-[ligand binding moiety]-3' or • 5' –[ligand binding moiety]-[gRNA]-3'.
  • the ligand binding moiety may be directly attached to the gRNA in an opposite orientation and thus is either • 5' –[gRNA]- 3'- 3' -[ligand binding moiety]-5' or • 3' –[ligand binding moiety]- 5' - 5'-[ gRNA]-3'.
  • the ligand binding moiety may also be attached to the gRNA at a position other than the 5' end or the 3'.
  • the ligand binding moiety is a nucleotide sequence it may be inserted in the gRNA, and thus there may, for example, be a first section of the gRNA that is 5' of the ligand binding moiety and a second section of the gRNA that is 3' of the ligand binding moiety such that there is one oligonucleotide sequence” 5' –[first section of gRNA]-[ligand binding moiety]-[second section of gRNA]-3'.
  • the complex that contains the gRNA and the ligand binding moiety inserted there may be no deletion of nucleotides from either the Cas association region or the targeting region. Alternatively, there may be a deletion of one or more nucleotide (e.g., 1 to 10 nucleotides) at the location of insertion.
  • the ligand binding moiety forms a stem and loop complex. In some embodiments, this stem and loop complex of the ligand binding moiety may be at a location at which in the absence of the ligand binding moiety there is a bulge or another stem-loop complex.
  • the ligand binding moiety when it is not a nucleotide sequence and it is bound to the gRNA as the location other than the 5' or 3' end it may, for example, be bound between two consecutive nucleotides: • 5' –[first section of gRNA]-[ligand binding moiety]-[second section of gRNA]-3', or it may be attached at either the 5' or 3' end of the gRNA to the phosphorous moiety, the sugar at e.g., the 2', 3' or 5' position or the nitrogenous base.
  • ligand binding moieties may, for example, be bound at the location of a bulge or a stem loop of the gRNA or at a location that has an absence of a bulge or stem-loop.
  • the ligand binding moiety is bound to a linker that is bound to the to the 3' end of the gRNA or to the 5' end of the gRNA or to another one or more locations within the gRNA.
  • each of the linker and the ligand binding moiety may independently comprise, consist essentially, or consist of nucleotides.
  • each of the linker and the ligand binding moiety may independently comprise, consist essentially, or consist of a moiety other than nucleotides.
  • the linker and ligand binding moiety may be in the same 5' to 3' orientation. In these circumstances, there is a continuous strand of nucleotides that contains both the ligand binding moiety and the gRNA either • 5' –[gRNA]-[linker]-[ligand binding moiety]-3' or • 5' –[ligand binding moiety]-[linker]-[gRNA]-3'.
  • the ligand binding moiety and/or the linker can be directly attached to the gRNA in an opposite orientation and thus is • 5' –[gRNA]- 3'- 3' –[linker]-5'-3'-[ligand binding moiety]-5' or • 5' –[gRNA]- 3'- 5' –[linker]-3'-3'-[ligand binding moiety]-5' or • 3' –[ligand binding moiety]-5'- 3' –[linker]-5'-5'-[gRNA]-3' or • 3' -[ligand binding moiety]-5' - 5' –[linker]-3'-5'-[gRNA]-3'.
  • the ligand binding moiety may also be attached to the gRNA through a linker at a position other than the 5' end or the 3'.
  • the ligand binding moiety and the linker are nucleotide sequences, they may be inserted in the gRNA, and thus there may for example be a first section of the gRNA that is 5' of the ligand binding moiety and linker and a second section of the gRNA that is 3' of the ligand binding moiety and linker.
  • linker sequence When there is only one linker sequence it may be either 5' or 3' of the ligand binding moiety such that the complex is • 5' –[first section of gRNA]-[linker]-[ligand binding moiety]-[second section of gRNA]-3', or • 5' –[first section of gRNA]- [ligand binding moiety]-[linker]- second section of gRNA]-3'.
  • a first linker may be 5' of the ligand binding moiety and the second linker is 3' of the ligand binding moiety, with such that the complex is • 5' –[first section of gRNA]-[first linker]-[ligand binding moiety]-[second linker]-[second section of gRNA]-3'.
  • each of the first section of gRNA the linker, the ligand binding moiety, the second linker an the second section of gRNA are nucleotide sequences in the same orientation.
  • one or more of the first linker, ligand binding moiety and the second linker are in the opposite orientation to that of the first section of gRNA and the second section of gRNA, which are in the same orientation.
  • the ligand binding moiety when the ligand binding moiety is between the first section of the gRNA and the second section of the gRNA (and if one or two linkers are present they are also between the first section of the gRNA and the second section of the gRNA): • the first section of the gRNA contains a portion of the distal region, and the second section of the gRNA contains the remainder of the distal region and the entire anti-repeat region; • the first section of the gRNA contains a portion of the distal region, and the second section of the gRNA contains the remainder of distal region, the entire anti-repeat region and the crRNA; • the first section of the gRNA contains the entire the distal region, and the second section of the gRNA contains the entire anti-repeat
  • gRNA Relative to a gRNA that does not contain the ligand binding moiety (and optionally one or more linkers), in a complex that contains the gRNA and the ligand binding moiety inserted therein, there may be no deletion of nucleotides from or around the region of insertion. Alternatively, there may be a deletion of one or more nucleotides (e.g., 1 to 10 nucleotides) at or around the location of insertion. [0076] When there are two linkers present, they may be of sufficient complementary such that they can hybridize to each under.
  • each linker may be 1 to 20 nucleotides long and the linkers may be at least 80%, at least 85%, at least 90%, at least 95% at least 98% or 100% complementary and have no bulges one or more bulges.
  • the linkers are the same size; in other embodiments, the linkers are different sizes.
  • the bonding may, for example, be at the first nucleotide in the loop, the second nucleotide in the loop, the third nucleotide in the loop, the fourth nucleotide in the loop, the center nucleotide in the loop if the loop has an odd number of nucleotides or one of the two center most nucleotides in the loop if the loop has an even number of nucleotides, or the last nucleotide in the loop.
  • any one or more of the aforementioned nucleotides and/or the 5' and/or 3' internucleotide linkage corresponding to them may be modified. These modifications may, for example, occur where the ligand binding moiety is bound to the gRNA (directly or through a linker) or only at locations other than where the ligand binding moiety is bound to the gRNA (directly or through a linker).
  • the ligand binding moiety can be attached to a 2’ position of a sugar or attached to a nitrogenous base in the gRNA oligonucleotide sequence.
  • the ligand binding moiety comprises, consists essentially of, or consists of an oligonucleotide sequence that is unmodified or comprises one or more modified nucleotides.
  • the ligand binding moiety may be 10 to 50 or 18 to 50 nucleotides long.
  • the ligand binding moiety forms a stem-loop structure. If there is no linker present, the ligand binding moiety may appear as an extension of the gRNA sequence immediately 5' or 3' of the gRNA or 5' or 3' of the tracrRNA or the crRNA or it may appears as an insertion.
  • the ligand binding moiety comprises, consists essentially of, or consists of biotin or streptavidin.
  • the ligand binding moiety is selected from the group consisting of moieties that associate with the following ligands: MS2 coat protein (MCP), Ku, PP7 coat protein (PCP), Com RNA binding protein or the binding domain thereof, SfMu, Sm7, Tat, Glutathione S-transferase (GST), CSY4, Qbeta, COM, pumilio, Anti-His Tag (6H7), SNAP-Tag, lambdaN22, a lectin (in which case ligand binding moiety may be carbohydrate or glycan or oligosaccharide), and PDGF beta- chain.
  • MCP MS2 coat protein
  • PCP PP7 coat protein
  • Com RNA binding protein or the binding domain thereof SfMu, Sm7, Tat, Glutathione S-transferase (GST), CSY4, Qbe
  • the ligand binding moiety is an aptamer that comprises deoxyribonucleotides, ribonucleotides or a combination of both. Therefore, as non- limiting examples, one may use DNA aptamers, RNA aptamers, DNA aptamers with modified nucleosides in the backbones, RNA aptamers with modified nucleosides in the backbones and combinations thereof. [0081] In some embodiments, a naturally occurring MS2 aptamer is used as the ligand binding moiety.
  • the 2-amino purine may, for example, be 2-amino purine is 2' deoxy-2-aminopurine or 2' ribose 2-aminopurine.
  • the modification at any one position may be in addition to a modification at another position or to the exclusion of a modification at any or all of the other positions.
  • the ligand binding moiety is an aptamer that comprises a 5' modified nucleotide, wherein the 5' modified nucleotide comprises at least one of a 2' modification, a 5' PO4 group, or a modification of the nitrogenous base.
  • the ligand binding moiety is an aptamer that is or comprises one part of an aptamer-ligand pair, and as discussed below, the effector is linked to or comprises the other part of the aptamer-ligand pair.
  • the aptamer may comprise a MS2 operator motif that specifically binds to an MS2 coat protein, MCP.
  • the aptamer can comprise the MCP moiety (or other ligand) in which case the effector would comprise or be linked to the MS2 operator motif (or other corresponding ligand binding moiety).
  • Linkers when present, may be a species that connects the ligand binding moiety to the gRNA. It may be attached to each of the ligand binding moiety and the gRNA at one location or it may be attached to either or both of the gRNA and the ligand binding moiety at a plurality of locations. Attachments at a plurality of locations may allow for greater control in three dimensional space of the ligand binding moiety and in turn the effector to be used.
  • the linker may attach to the gRNA at one location and to the ligand binding moiety at two or more locations; or the linker may attach to the ligand binding moiety at one location and to the gRNA at two or more locations.
  • the linker When the linker is attached to the gRNA at two or more locations, the linker may be attached to the gRNA exclusively in the targeting region, exclusively in the Cas association region or in both the targeting region and the Cas association region, exclusively in the anti-repeat region, exclusively in the distal region, in both the anti-repeat region and the distal region, in both the distal region and the targeting region, in both the anti-repeat region and the Cas association region, in both the anti- repeat region and the targeting region, or in both the Cas association region and the distal region.
  • the linker comprises, consists essentially of, or consists of an oligonucleotide sequence and optionally the linker comprises at least one or a plurality of 2' modifications, e.g., all nucleotides are 2' modified nucleotides within the linker.
  • the nucleotide sequence may be random or intentionally designed not to be undesirably complementary to sequence within the aptamer, the gRNA or the target site of the DNA.
  • the linker comprises, consists essentially of, or consists of at least one phosphorothioate linkage.
  • the linker comprises, consists essentially of, or consists of a levulinyl moiety. [0090] In some embodiments, the linker comprises, consists essentially of, or consists of an ethylene glycol moiety. [0091] In some embodiments, the linker comprises or is selected from the group consisting of 18S, 9S or C3. [0092] In some embodiments, the linker is a nucleotide sequence that is one to sixty or one to twenty-four or two to twenty or five to fifteen nucleotides long.
  • the linker is GC rich, e.g., having at least 50%, at least 60%, at least 70%, at least 80% or at least 90% GC nucleotides.
  • a linker comprises nucleotides, it may, for example, be single stranded or double stranded or partially single stranded and partially double stranded.
  • the linker may be exclusively RNA, exclusively DNA or a combination thereof.
  • the linker is a nucleotide sequence that is upstream or downstream of the ligand binding moiety.
  • linker When the linker is upstream of a ligand binding moiety and the gRNA is upstream of the linker, there may be another sequence that is complementary to the linker that is downstream of the ligand binding moiety. Similarly, when the linker is downstream of a ligand binding moiety and the gRNA is downstream of the linker, there may be another sequence that is complementary to the linker that is upstream of the ligand binding moiety. As persons of ordinary skill in the art will recognize, complementarity is determined when the oligonucleotide self-folds and the strands align with each relevant section in a 5' to 3' direction.
  • the ligand binding moiety e.g., MS2 has an upstream sequence that is 1 to 12 nucleotides long and a downstream sequence that is 1 to 12 nucleotides long, wherein the upstream and downstream sequences immediately flank the ligand binding moiety (i.e., there are no other nucleotides between the ligand binding moiety and each of the upstream and downstream sequences) and the upstream sequence is complementary to the downstream sequence.
  • each of the upstream sequence and the downstream sequence is 1 nucleotide long, 2 nucleotides long, 3 nucleotides long, 4 nucleotides long, 5 nucleotides long, 6 nucleotides long, 7 nucleotides long, 8 nucleotides long, 9 nucleotides long, 10 nucleotides long, 11 nucleotides long, or 12 nucleotides long.
  • each of the upstream sequence and the downstream sequence comprises or is GC. When there are both upstream and downstream sequences, they may also be referred to as extension sequences.
  • At least one of the gRNA or the ligand binding moiety is modified, or if a linker is present, at least one of the gRNA, the ligand binding moiety or the linker is modified.
  • the modification refers to the introduction of a moiety or species that does not occur under naturally occurring conditions. Modifications may be used to increase one or both of stability and specificity. In some embodiments, stability is improved with respect to resistance to one or both of the active domain of the Cas protein (e.g., RuvC domain) and the active domain of one or more other enzymes within the system into which a complex of the present invention is introduced, including but not limited to any effector.
  • Nucleotides may be modified at the ribose, phosphate linkage, and/or base moiety.
  • a phosphorothioate backbone may be used, at one, a plurality or all positions within the gRNA, the anti-repeat region, the distal region, the targeting region or the Cas association region and/or the ligand binding moiety and/or linker if present.
  • the modification is the presence of one or more 2' modified nucleotides (e.g., 2'-O-methyl or 2'-fluoro) and/or the presence of a phosphorothioate internucleotide linkage or the introduction of a 5'-PO4 group of the gRNA and/or ligand binding moiety.
  • a modification or set of modifications is selected such that it imparts resistance to a RuvC active nuclease domain relative to a gRNA-ligand binding complex that lacks that modification or set of modifications. The resistance may, in some embodiments, be caused by steric hindrance.
  • the modification(s) is/are located within and/or between one or more if not all of the nucleotides within the targeting region.
  • the modifications may, for example, all be in the targeting region; all be in the Cas association region; all be in the anti-repeat region; all be in the distal region; all be in the ligand binding moiety; all be in the linker if present; be in both the targeting region and the Cas association region; be in both the Cas association region and the ligand binding moiety; be in both the Cas association region and the linker if present; be in both the targeting region and the ligand binding moiety; be in both the targeting region and the linker if present; be in both the ligand binding moiety and the linker if present; be in all three of the Cas association region, the targeting region and the ligand binding moiety; be in the Cas association region, the targeting region and the linker if present; be in the Cas association region, the targeting region and the linker if present; be in
  • the set of 2' modifications may be located: in the targeting region; in the anti-repeat region; in the distal region; in the ligand binding moiety if the ligand binding moiety is or comprises an oligonucleotide sequence; or in the Cas association region or in combinations thereof.
  • the modifications may be on consecutive nucleotides or there may be one or more pairs of unmodified nucleotides between modified nucleotides in regular or irregular patterns.
  • any one or more of positions 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or 18 comprises a 2'-O- alkyl group, wherein the positions are measured from the 5' end or the 3' end of the gRNA or the tracrRNA or the crRNA.
  • 2' modified nucleotides there are modified internucleotide linkages such as phosphorothioate linkage.
  • modifications to the backbones of the gRNA, the ligand binding moiety (in an oligonucleotide), and the linker (if present and an oligonucleotide), include but are not limited to phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'- alkylene phosphonates, 5'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, phosphorodiamidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, selenophosphates and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those having inverted polarity
  • Suitable oligonucleotides having inverted polarity comprise a single 3' to 3' linkage at the 3'-most internucleotide linkage i.e., a single inverted nucleoside residue that may be abasic (the nucleobase is missing or has a hydroxyl group in place thereof).
  • Various salts such as, for example, potassium or sodium
  • mixed salts and free acid forms of the aforementioned internucleotide linkages are also included within the scope of the present invention.
  • polynucleotide backbones that do not include a phosphorus atom therein and instead have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages.
  • modifications include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; riboacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH 2 component parts.
  • one or more of the parts of a complex has one to sixty or one to twenty or one to ten or ten to twenty or twenty to thirty or thirty to forty to forty to fifty or fifty to sixty phosphorothioate linkages.
  • These phosphorothioate linkages may: all be in the targeting region; all be in the Cas association region; all be in the anti-repeat region; all be in the distal region; all be in the ligand binding moiety; all be in the linker if present; be in both the targeting region and the Cas association region; be in both the Cas association region and the ligand binding moiety; be in both the Cas association region and the linker if present; be in both the targeting region and the ligand binding moiety; be in both the targeting region and the linker if present; be in both the ligand binding moiety and the linker if present; be in all three of the Cas association region, the targeting region and the ligand binding moiety; be in the Cas association region,
  • nucleotide within a complex of the present invention may include one or more substituted sugar moieties.
  • These nucleotides may comprise a sugar substituent group selected from: OH; H; F; O-, S-, or N-alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-Co-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted C1 to C10 alkyl or C2 to C10 alkenyl and alkynyl.
  • O((CH 2 )nO)mCH 3 O(CH 2 )nOCH 3 , O(CH2)nNH 2 , O(CH2)nCH3, O(CH2)nONH2, and O(CH2)nON((CH2)nCH3)2, where n and m are from 1 to about 10.
  • nucleotides comprise a sugar substituent group selected from: C1 to C10 lower alkyl, substituted lower alkyl, alkenyl, alkynyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH 3 , OCN, Cl, Br, CN, CF 3 , OCF 3 , SOCH3, SO2CH3, ONO2, NO2, N3, NH2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of an oligonucleotide, or a group for improving the pharmacodynamic properties of an oligonucleotide, and other substituents having similar properties.
  • a sugar substituent group selected from: C1 to C10 lower alkyl, substituted lower alkyl, alkenyl, alkyny
  • a suitable modification includes 2′-methoxyethoxy (2'-O- CH2CH2OCH3, also known as 2′-O-(2-methoxyethyl) or 2′-MOE) (Martin et al., Helv. Chim. Acta, 1995, 78, 486-504) or another alkoxyalkoxy group.
  • a further suitable modification includes 2′-dimethylaminooxyethoxy, i.e., a O(CH2)2ON(CH3)2 group, also known as 2′-DMAOE, and 2′-dimethylaminoethoxyethoxy (also known in the art as 2′-O-dimethyl-amino-ethoxy-ethyl or 2′-DMAEOE), i.e., 2′-O-CH2-O-CH2- N(CH3)2.
  • Other suitable sugar substituent groups include methoxy (-O-CH 3 ), aminopropoxy (-O CH2CH2CH2NH2), allyl (-CH2-CH ⁇ CH2), -O-allyl CH2-CH ⁇ CH2) and fluoro (F).
  • 2′-sugar substituent groups may be in the arabino (up) position or ribo (down) position.
  • a suitable 2′-arabino modification is 2′-F.
  • Similar modifications may also be made at other positions on the oligomeric compound, particularly the 3′ position of the sugar on the 3′ terminal nucleoside or in 2′-5′ linked oligonucleotides and the 5′ position of 5′ terminal nucleotide.
  • Any nucleotide within a complex of the present invention may also include nucleobase (often referred to in the art simply as “base”) modifications or substitutions.
  • Modified nucleobases include, but are not limited to other synthetic and natural nucleobases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2- thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl (- C ⁇ C-CH 3 ) uracil and cytosine and other alkynyl derivatives of pyrimidine bases, 6- azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8- amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted
  • nucleobases include, but are not limited to tricyclic pyrimidines such as phenoxazine cytidine (1H-pyrimido(5,4- b)(1,4)benzoxazin-2(3H)-one), phenothiazine cytidine (1H-pyrimido(5,4- b)(1,4)benzothiazin-2(3H)-one), G-clamps such as a substituted phenoxazine cytidine (e.g.9-(2-aminoethoxy)-H-pyrimido(5,4-(b) (1,4)benzoxazin-2(3H)-one), carbazole cytidine (2H-pyrimido(4,5-b)indol-2-one), pyridoindole cytidine (H- pyrido(3′,2′:4,5)pyrrolo(2,3-d)pyrimidin-2-one) and 5-methoxy
  • Heterocyclic base moieties may also include, but are not limited to, those in which the purine or pyrimidine base is replaced with other heterocycles, for example, 7-deaza-adenine, 7-deazaguanosine, 2-aminopyridine and 2-pyridone.
  • examples of other nucleobases include those disclosed in U.S. Pat. No.3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science And Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y.
  • nucleobases are useful for increasing the binding affinity of an oligomeric compound: 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and O-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. Additionally, 5-methylcytosine substitutions may be advantageous when combined with 2'-O-methoxyethyl sugar modifications.
  • ligand binding moieties associated with a gRNA there are two ligand binding moieties associated with a gRNA: a first ligand binding moiety and a second ligand binding moiety.
  • first linker and the second linker may each be attached to the Cas association region; or the first linker and the second linker may each be attached to the targeting region; or one of the first linker and the second linker may be attached to the Cas association region and the other of the first linker and the second linker may be attached to the targeting region, or the first linker and the second linker may each be attached to the anti-repeat region; or the first linker and the second linker may each be attached to the distal region; or one of the first linker and the second linker may be attached to the distal region and the other of the first linker and the second linker may be attached to the anti-repeat region; or one of the first linker and the second linker may be attached to the distal region and the other of the first linker and the second linker may be attached to the Cas association region; or one of the first linker and the second linker may be attached to the distal region and the other of the first linker and the second linker may be attached to the Cas association region;
  • Figure 1A is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 114 is bound to the 5' end of a tracrRNA 112 in a Cas12b gRNA in which the crRNA 110 is a separate strand that hybridizes with part of the tracrRNA.
  • Figure 1B is a representation of a gRNA- ligand binding complex of the present invention in which a ligand binding moiety 124 is bound to the 3' end of a tracrRNA 122. Also shown is the crRNA 120.
  • Figure 1C is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 134 is bound to the 5' end of a crRNA 130. Also shown is the tracrRNA 132.
  • Figure 1D is a representation of a gRNA-ligand binding complex of the present invention in which a first ligand binding moiety 146 is bound to the 5' end of a tracrRNA 142 and a second ligand binding moiety 144 is bound to the 5' end of a crRNA 140.
  • each of the ligand binding moieties shown in figures 1A to 1D and in all other figures may, for example, be a DNA or an RNA aptamer, a carbohydrate or oligosaccharide group, a benzylguanine or benzylcytosine group for SNAP/CLIP tagging, a bioconjugation group (e.g., azide-alkyne group for click chemistry), biotin or other functional group used for affinity or covalent binding.
  • a bioconjugation group e.g., azide-alkyne group for click chemistry
  • biotin or other functional group used for affinity or covalent binding.
  • different or similar functional groups can be attached to each molecule to further increase functionality.
  • Figure 2A is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 214 is bound to the 5' end of a tracrRNA 212 in a Cas12b gRNA with the crRNA 210 being part of the same strand of nucleotides as the tracrRNA.
  • Figure 2B is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 224 is bound to a loop between tracrRNA 222 and crRNA 220 in a Cas12b gRNA.
  • Figure 2C is a representation of a gRNA-ligand binding complex of the present invention in which a first ligand binding moiety 234 is bound to the loop region between the tracrRNA 232 and the crRNA 230 and a second ligand binding moiety 236 is bound to the 5' end of the tracrRNA in a Cas12b gRNA.
  • Figure 2D is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 244 is bound to a loop within the tracrRNA region 242 and a crRNA 240 forms the 3' portion of the gRNA in a Cas12b gRNA.
  • Figure 3A is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 314 is bound to the 3' end of a tracrRNA 312 in a Cas12e gRNA that has a separate crRNA strand 310.
  • Figure 3B is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 324 is bound to the 5' end of a tracrRNA 322 in a Cas12e gRNA that has a separate crRNA strand 320.
  • Figure 3C is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 334 is bound to the 5' end of a crRNA 330 in a Cas12e gRNA that has a separate tracrRNA 332.
  • Figure 3D is a representation of a gRNA-ligand binding complex of the present invention in which a ligand binding moiety 334 is bound to the 3' end of a crRNA 340 in a Cas12e gRNA in which there is a separate strand that forms the tracrRNA 342.
  • Figure 4A is a representation of a gRNA for a Cas 12e system in which a first ligand binding moiety 414 is attached to the 5’ end of the crRNA 410 and a second ligand binding moiety 416 is attached to the 5' end of the tracrRNA 412.
  • Figure 4B is a representation of a gRNA for a Cas 12e system in which a first ligand binding moiety 426 is attached to the 3' end of the crRNA 420 and a second ligand binding moiety 424 is attached to the 3' end of the tracrRNA 422.
  • Figure 4C is a representation of a gRNA for a Cas 12e system in which a first ligand binding moiety 434 is attached to the 5' end of the tracrRNA 432 and a second ligand binding moiety 436 is attached to the 3' end of the crRNA 430.
  • Figure 5A is a representation of a gRNA for a Cas 12e system in which a ligand binding moiety 514 is attached to the 5' end of the tracrRNA 512 and the crRNA 510 is part of the same strand of nucleotides as the tracrRNA.
  • Figure 5B is a representation of a gRNA for a Cas 12e system in which a ligand binding moiety 524 is attached to the loop between the tracrRNA 522 and the crRNA 520.
  • Figure 5C is a representation of a gRNA for a Cas 12e system in which a ligand binding moiety 534 is attached to the 3' end of the crRNA 530 that is downstream of and forms a hairpin with the tracrRNA 532.
  • Figure 5D is a representation of a gRNA for a Cas 12e system in which a ligand binding moiety 544 is attached to a loop within a tracrRNA 542 and a crRNA 540 forms a hairpin with the tracrRNA.
  • Figure 6A is a representation of a gRNA for a Cas 12f system in which a ligand binding moiety 614 is attached to the 5' end of the tracrRNA 612 and the crRNA 610 is a separate strand that forms a hybridization region with the tracrRNA.
  • Figure 6B is a representation of a gRNA for a Cas 12f system in which a ligand binding moiety 624 is attached to the 3' end of the tracrRNA 622 and the crRNA 620 is a separate strand that forms a hybridization region with the tracrRNA.
  • Figure 6C is a representation of a gRNA for a Cas 12f system in which a ligand binding moiety 634 is attached to the 5' end of the crRNA 630 and the tracrRNA 632 is shown.
  • Figures 7A shows a gRNA that is a single strand of nucleotides that contains both the tracrRNA and the crRNA for a Cas 12f system in which the ligand binding moiety 714 is bound to the 5' end of the tracrRNA 712, which forms a contiguous strand of nucleotides with the crRNA 710.
  • Figures 7B shows a gRNA that is a single strand of nucleotides that contains both the tracrRNA 722 and the crRNA 720 for a Cas 12f system in which the ligand binding moiety 724 is bound to the loop between the tracrRNA and the crRNA.
  • Figure 7C shows a gRNA for a Cas 12f system in which a first ligand binding moiety 736 is located at the 5' end of the tracrRNA 732 of the gRNA and a second ligand binding moiety 734 is located at the loop between the tracrRNA and the crRNA 730 of the gRNA.
  • Base editing complexes there is a base editing complex.
  • the base editing complex comprises, consists essentially of, or consists of a gRNA-ligand binding complex of the present invention; and a Type V Cas protein, wherein the Cas association region and anti-repeat region of the gRNA- ligand binding complex are associated with the Type V Cas protein.
  • the gRNA is capable of associating with the Cas protein. After association has occurred, the Cas protein will, based on the identity of targeting sequence, find the target site.
  • Type V Cas protein [00119]
  • a Cas protein includes at least one RNA binding domain. The RNA binding domain interacts with the guide RNA at the Cas association region.
  • the Type V Cas protein that is of use in the present invention is one with which the gRNA-ligand binding complex can associate in the presence of a tracrRNA that contains an anti-repeat region that is of sufficient complementarity to the Cas association region.
  • the Type V Cas protein is an endonuclese that contains a RuvC domain. This RuvC domain can be mutated such that the endonuclease activity is deactivated.
  • the protein is a nickase that contains an active or deactivated RuvC domain.
  • Type V Cas proteins that may be of use in connection with the present invention include, but are not limited to, Cas12b, Cas12e, CasMINI and Cas12f in active or deactivated form.
  • the Cas protein may be provided in purified or isolated form or can be part of a composition or a complex. Preferably, when in a composition, the protein is first purified to some extent, more preferably to a high level of purity (e.g., about 80%, 90%, 95%, or 99% or higher).
  • compositions in which the complexes and components of the present invention may be stored and transported may be any type of composition desired, e.g., aqueous compositions suitable for use as, or inclusion in, a composition for RNA-guided targeting that a person of ordinary skill in the art would appreciate would be of use in connection with the present invention.
  • the Type V Cas proteins comprise a fusion protein having (a) an active, partially deactivated or deactivated Type V Cas protein, and (b) a uracil DNA glycosylase (UNG) inhibitor peptide (UGI).
  • UNG uracil DNA glycosylase
  • the UGI peptide can be fused directly to the Type V Cas protein or through a linker peptide comprised of 1 to 100 hundred amino acid residues.
  • the UGI comprises the wild type UGI sequence from the Bacillus phage PBS2 (https://www.ncbi.nlm.nih.gov/protein/P14739): MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENV MLLTSDAPEYKPWALVIQDSNGENKIKML (SEQ ID NO: 22).
  • the UGI comprises variants of SEQ ID NO: 22 that comprises a fragment of the wild type UGI peptide or a homologous amino acid sequence to SEQ ID NO: 22.
  • the UGI fragment of homologous sequence comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 99%, or at least 99.5% homology to the wild type UGI peptide sequence (SEQID NO: 22).
  • the active or deactivated Type V Cas protein comprises a fusion with two or more UGI peptides or variants.
  • the UGI peptides, or variants of the UGI peptide can be connected directly to another UGI peptide or Type V Cas protein or via a linker of 1 to 100 amino acid residues to another UGI peptide or Type V Cas protein.
  • the Cas protein or Cas protein fusion may be provided in purified or isolated form or can be part of a composition or complex.
  • Effectors [00126]
  • the base editing complexes of the present invention may contain an effector that is attached to a ligand.
  • the ligand is capable of reversibly or irreversibly associating with the ligand binding moiety.
  • the ligand binding moiety recruits an effector, e.g. base editing enzyme that is fused to or otherwise associated with the ligand, because the ligand binding moiety is capable of retaining association with the ligand.
  • This design may be particularly advantageous because it provides a modular design in which the nucleic acid sequence targeting function of the gRNA and effector function reside in different molecules.
  • effectors that may be of use in connection with the present invention are deaminases such as those that have cytidine deamination or adenine deamination activity, as well as transcriptional regulators, repair enzymes, epigenetic modifiers, histone acetylases, deacetylases, methylases (of histones ad nucleotides), and demethylases (of histones and nucleotides).
  • deaminases such as those that have cytidine deamination or adenine deamination activity, as well as transcriptional regulators, repair enzymes, epigenetic modifiers, histone acetylases, deacetylases, methylases (of histones ad nucleotides), and demethylases (of histones and nucleotides).
  • the effector is selected from the group consisting of AID, CDA, APOBEC1, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D, APOBEC3F, ADA, ADAR and tRNA adenosine deaminase.
  • AID CDA
  • APOBEC1 APOBEC1
  • APOBEC3A APOBEC3B
  • APOBEC3C APOBEC3D
  • APOBEC3F ADA
  • ADAR tRNA adenosine deaminase
  • AID activation induced cytidine deaminase, a.k.a AICDA
  • APOBEC1 apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 1.
  • APOBEC3A apolipoprotein B mRNA editing enzyme
  • APOBEC3B apolipoprotein B mRNA editing enzyme
  • APOBEC3C apolipoprotein B mRNA editing enzyme
  • APOBEC3D apolipoprotein B mRNA editing enzyme
  • APOBEC3F apolipoprotein B mRNA editing enzyme
  • APOBEC3G apolipoprotein B mRNA editing enzyme
  • APOBEC3H apolipoprotein B mRNA editing enzyme
  • a first effector and a second effector When there are two effectors they may be referred to as: a first effector and a second effector. Each effector may be attached to a different ligand binding moiety through a different ligand. Alternatively, when there are two effectors present, one is attached to a ligand and associated with the gRNA through the ligand binding moiety and another is attached directly to the Cas protein.
  • Ligands [00131] As noted above, the effector is bound to a ligand, e.g., by one or more covalent bonds.
  • Table 2 A non-exhaustive list of examples of ligand binding moiety-ligand pairs that may be used in various embodiments of the present invention is provided in Table 2.
  • Telomerase Sm7 binding motif / Sm7 homoheptamer a Sm consensus site (single stranded) 5’-AAUUUUUGGA-3’ (SEQ ID No: 26) b. Monomeric Sm – like protein (archaea) GSVIDVSSQRVNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAE ELEDGEVTRRLGTVLIRGDNIVYISP(SEQ ID No: 27) 3.
  • MS2 phage operator stem loop 5’- GCACAUGAGGAUCACCCAUGUGC -3’ SEQ ID No:28
  • PP7 phage operator stem loop / PP7 coat protein a.
  • PP7 phage operator stem loop 5’-AUAAGGAGUUUAUAUGGAAACCCUUA -3’ SEQ ID No: 30
  • the base-editing complexes of the present invention are combined with additional chemistry technologies.
  • a base editing complex further comprises a cysteine/selenocysteine tag.
  • the base editing complex comprises or is associated with elements for cycloaddition via click chemistry.
  • Methods for base-editing [00137] In another embodiment, the present invention provides methods for base editing.
  • a base editing complex of the present invention to double-stranded DNA or to a solution that contains dsDNA or to a cell that contains dsDNA or to a subject.
  • the method may occur in vitro or be conducted in vivo or ex vivo and may comprise delivering the base editing complex to a subject as part of a medicament for treatment.
  • These methods may, for example, be used to modify an immune cell selected from a T cell (including a primary T cell), Natural Killer (NK cell), B cell, or CD34+ hematopoietic stem progenitor cell (HSPC).
  • the immune cell may be an engineered immune cell, such as T-cell comprising a CAR or TCR.
  • Suitable stem cells include, but are not limited to, mammalian stem cells such as human stem cells, including, but not limited to, hematopoietic, neural, embryonic, induced pluripotent stem cells (iPSC), mesenchymal, mesodermal, liver, pancreatic, muscle, and retinal stem cells.
  • mammalian stem cells such as human stem cells, including, but not limited to, hematopoietic, neural, embryonic, induced pluripotent stem cells (iPSC), mesenchymal, mesodermal, liver, pancreatic, muscle, and retinal stem cells.
  • stems cells include, but are not limited to, mammalian stem cells such as mouse stem cells, e.g., mouse embryonic stem cells.
  • mammalian stem cells such as mouse stem cells, e.g., mouse embryonic stem cells.
  • methods for genome engineering e.g., altering or manipulating the expression of one or more genes or one or more gene products
  • prokaryotic or eukaryotic cells in vitro, in vivo, or ex vivo.
  • the methods provided herein may be useful for targeted base editing disruption in mammalian cells including primary human T cells, natural killer (NK) cells, CD34+ hematopoietic stem and progenitor cells (HSPCs), such as HSPCs isolated from umbilical cord blood or bone marrow and cells differentiated from them.
  • NK natural killer
  • HSPCs hematopoietic stem and progenitor cells
  • haematopoietic stem cells such as T cells
  • the methods are configured to produce genetically engineered T cells arising from HSCs or iPSCs, that are suitable as “universally acceptable” cells for therapeutic application.
  • Haemopoietic stem cells arise from hemangioblasts, which can give rise to HSCs, vascular smooth muscle cells and angioblasts, which differentiate into vascular endothelial cells.
  • HSCs can give rise to common myeloid and common lymphoid progenitors from which arise T cells, Natural Killer (NK) cells, B cells, myeloblasts, erythroblasts and other cells involved in the production of cells of blood, bone marrow, spleen, lymph nodes, and thymus.
  • NK Natural Killer
  • B cells B cells
  • myeloblasts myeloblasts
  • erythroblasts and other cells involved in the production of cells of blood, bone marrow, spleen, lymph nodes, and thymus.
  • NK natural killer
  • HSPCs CD34+ hematopoietic stem and progenitor cells
  • HSPCs hematopoietic stem and progenitor cells
  • the target sequence can be any disease- associated polynucleotide or gene.
  • useful applications of mutation or correction of an endogenous gene sequence according to the present invention include but are not limited to: alterations of disease-associated gene mutations, alterations in sequences encoding splice sites, alterations in regulatory sequences, alterations in sequences to cause a gain-of-function mutation, and/or alterations in sequences to cause a loss- of-function mutation, and targeted alterations of sequences encoding structural characteristics of a protein.
  • Delivery of components into cells may be delivered to target cells and organisms via various methods and various formats (DNA, RNA or protein) or combination of these different formats.
  • the base editing components may be delivered as: (a) DNA polynucleotides that encode the relevant sequence for the protein effectors or the guide RNAs; (b) synthetic RNA encoding the sequence for the protein effectors (messenger RNA) or the guide RNAs; (c) purified protein for the effectors.
  • the Type V Cas protein can be assembled with the guide RNAs to form a ribonucleoprotein complex (RNP) for delivery into target cells and organisms.
  • RNP ribonucleoprotein complex
  • the components or complexes as assembled may be delivered together or separately by electroporation, by nucleofection, by transfection, via nanoparticles, via viral mediated RNA delivery, via non-viral mediated delivery, via extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast ) and other methods that can package molecules such that they can be delivered to a target viable cell without changes to the genomic landscape.
  • electroporation by nucleofection, by transfection, via nanoparticles, via viral mediated RNA delivery, via non-viral mediated delivery, via extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast ) and other methods that can package molecules such that they can be delivered to a target viable cell without changes to the genomic landscape.
  • Other methods include, but are not limited to, non-integrative transient transfer of DNA polynucleotides that include the relevant sequence for the protein recruitment so that the molecule can be transcribed into the desired RNA molecule and for amino acid containing components translated into a protein or protein fragment.
  • DNA-only vehicles for example, plasmids, MiniCircles, MiniVectors, MiniStrings, Protelomerase generated DNA molecules (for example Doggybones), artificial chromosome (for example HAC), and cosmids
  • DNA vehicles by nanoparticles, extracellular vesicles (for example, exosome and microvesicles), via eukaryotic cell transfer (for example, by recombinant yeast), transient viral transfer by AAV, non-integrating viral particles (for example, lentivirus and retrovirus based systems), cell penetrating peptides and other technology that can mediate the introduction of DNA into a cell without direct integration into the genomic landscape.
  • RNA components include the use of integrative gene transfer technology for stable introduction of the machinery for RNA transcription into the genome of the target cells, this can be controls via constitutive or promoter inducible systems to attenuate the RNA expression and this can also be designed so that the system can be removed after the utility has been met (for example, introducing a Cre-Lox recombination system), such technology for stable gene transfer includes, but is not limited to, integrating viral particles (for example, lentivirus, adenovirus and retrovirus based systems), transposase mediate transfer (for example Sleeping Beauty and Piggybac), exploitation of the non-homologous repair pathways introduced by DNA breaks (for example, utilizing CRISPR and TALEN) technology and a surrogate DNA molecule, and other technology that encourages integration of the target DNA into a cell of interest.
  • integrative gene transfer technology for stable introduction of the machinery for RNA transcription into the genome of the target cells, this can be controls via constitutive or promoter inducible systems to attenuate
  • the various components of the complexes of the present invention may be created chemically or, if naturally occurring, isolated and purified from naturally occurring sources. Methods for chemically and enzymatically synthesizing the various embodiments of the present invention are well known to persons of ordinary skill in the art. Similarly, methods for ligating or introducing covalent bonds between components of the present invention are also well known to persons of ordinary skill in the art. [00148] Applications [00149] By way of a non-limiting example, the complexes of the present invention may be used to recruit transcriptional activators such as p65 and V64, as well as moieties that introduce epigenetic modifications or affect HDR.
  • the complexes of the present invention can also be used for the following applications; base editing, genome editing, genome screening, generation of therapeutic cells, genome tagging, epigenome editing, karyotype engineering, chromatin imaging, transcriptome and metabolic pathway engineering, genetic circuits engineering, cell signaling sensing, cellular events recording, lineage information reconstruction, gene drive, DNA genotyping, miRNA quantification, in vivo cloning, site-directed mutagenesis, genomic diversification, and proteomic analysis in situ.
  • a cell or a population of cells are exposed to a base editing complex of the present invention and the cell or cells are introduced to a subject by infusion.
  • [00150] Applications also include research of human diseases such as cancer immunotherapy, antiviral therapy, bacteriophage therapy, cancer diagnosis, pathogen screening, microbiota remodeling, stem-cell reprogramming, immunogenomic engineering, vaccine development, and antibody production.
  • Examples [00152]
  • Example 1 Transfection of plasmid components for Cas12e base editing in mammalian cells (prophetic)
  • Vector construction [00154] The coding sequence for the Cas12e may be synthetically obtained and cloned into a vector under the control of the mouse CMV promoter (mCMV) in a T2A polycistronic cassette with a red fluorescent protein-puromycin fusion.
  • mCMV mouse CMV promoter
  • a deactivated version of the Cas12e and 2xUGI fusion to the deactivated Cas12e variants may also be obtained and cloned in the aforementioned vector.
  • the coding sequence for MS2 coat protein APOBEC fusion (MCP-APOBEC) may be obtained and cloned into an expression vector under control of the mouse CMV promoter.
  • the sequence for gRNAs containing the MS2 ligand binding moiety and unique spacer regions may be cloned into an expression vector under control of the hU6 promoter.
  • Transfection [00156] HEK 293T cells (ATCC, #CRL-11268) may be seeded at 20,000 cells per well in a 96-well plate one day prior to transfection.
  • Cells may be co-transfected using DharmaFECT Duo Transfection Reagent (Horizon Discovery, #T-2010) and 200ng Cas12e plasmid, or its deactivated variants fused or not with UGI, 50ng MCP- APOBEC plasmid, and 50 ng gRNA plasmid.
  • the gRNA plasmid may consist of a constant region length of 101 nucleotides, different spacer sequences targeting transcripts within PPIB or EMX1 gene targets, and have the MS2 ligand binding moiety at the 5' terminus, the 3' terminus, internally not at either the 5' or 3' terminus, or combinations therein.
  • Cells may be selected in puromycin containing media and harvested 48 hours post-transfection for further processing as described below and the following sequences may be used.
  • Cas12e gRNA sequences [00159] 5'-GCGCACATGAGGATCACCCATGTGCGGCGCGUUUAUUC CAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGUAUGGACGAAGCGC UUAUUUAUCGGAGAGAAACCGAUAAGUAACGCAUCAAANNNNNNNN NNNNNNNNNNN-3' (SEQ ID No: 38) [00160] 5'-GGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCA GCGACUGCGCACATGAGGATCACCCATGTGCUGUCGUAUGGACGAAGCG CUUAUUUAUCGGAGAGAAACCGAUAAGUAACGCAUCAAANNNNNNN NNNNNNNN-3' (SEQ ID No: 39) [00161] 5'-GGCGCGUUUAU
  • RNA synthesis [00179] The crRNA may be synthesized by Horizon Discovery using either 2'- acetoxy ethyl orthoester (2'-ACE) or 2'-tert-butyldimethylsilyl (2'-TBDMS) protection chemistries. RNA oligos may be 2'-depotected/desalted and purified by either high- performance liquid chromatography (HPLC) or polyacrylamide gel electrophoresis (PAGE). Oligos may be resuspended in 10 mM Tris pH7.5 buffer prior to electroporation.
  • HPLC high- performance liquid chromatography
  • PAGE polyacrylamide gel electrophoresis
  • HEK 293T cells (ATCC, #CRL-11268) may be electroporated using the InvitrogenTM NeonTM Transfection System, 10 ⁇ l Kit. A mixture of 50,000 cells, 1 ⁇ g of Cas12e or dCas12e-UGI mRNA and MCP-APOBEC mRNA, and 3 ⁇ M of synthetic crRNA and tracrRNA may be electroporated at 1150V for 20 ms and for 2 pulses.
  • the chemically synthesized crRNA may consist of a constant region length of 23 nucleotides, different spacer sequences targeting transcripts within PPIB or EMX1 gene targets, and have the MS2 ligand binding moiety at the 5' terminus, the 3' terminus, internally not at either the 5' or 3' terminus, or combinations therein.
  • Each sequence may contain chemical modifications at one or more bases and within one or more linkages.
  • Cells may be plated in a 96-well plate with full serum media and harvested after 72 hours for further processing. The sequences below may be used.
  • Cas12e crRNA sequences (N, target sequence): [00182] 5'-GCGCACATGAGGATCACCCATGTGCCCGAUAAGU AAAACGCAUCAAAGNNNNNNNNNNNNNNNNNNN-3' (SEQ ID No: 53) [00183] 5'-CCGAUAAGUAAAACGCAUCAAAGNNNNNNNNNNNGCGCACATGAGGATCACCCATGTGC-3' (SEQ ID No: 54) [00184] Cas12e tracrRNA sequences (N, target sequence): [00185] 5'-GCGCACATGAGGATCACCCATGTGCGGCGCGUUUAU UCCAUUACUUUGGAGCCAGUCCCAGCGACUAUGUCGUAUGGACGAAGC GCUUAUUUAUCGGAGA-3' (SEQ ID No: 55) [00186] 5'-GGCGCGUUUAUUCCAUUACUUUGGAGCCAGUCCCAG CGACUGCACATGAGGATCACCCATGTGCUGUC
  • This cell lysate may be used to generate PCR amplicons spanning the region containing the base editing site(s). Unpurified PCR amplicons between 500-1000 bp in length may be sequenced by Sanger sequencing. [00191] Editing analysis [00192] Base editing efficiencies may be calculated using the Chimera analysis tool, an adaptation of the open source tool BEAT ((Xu et al.2019. BEAT: A Python Program to Quantify Base Editing from Sanger Sequencing. The CRISPR Journal 2, 223–229). Chimera determines editing efficiency by first subtracting the background noise to define the expected variability in a sample. This allows the estimation of editing efficiency without the need to normalize to control samples.
  • gRNA sequences [00196] For examples 3-5 (using Cas12b base editor), gRNA sequences encoded by the sequences listed in table 3 were used. All gRNA designs were based on the A. acidoterrestris Cas12b gRNA consisting of a 91 nt constant gRNA sequence, a target specific 20 nt spacer sequence, and a 7 nt poly-T U6 termination signal.
  • gRNA sequences encoded by the sequences listed in table 4 were used . All gRNA designs were based on the Acidibacillus sulfuroxidans Cas12f gRNA consisting of a 162 nt constant gRNA sequence, a target specific 23 nt spacer sequence, and a 7 nt poly-T U6 termination signal. All modifications were made to the constant component of the gRNA and consist of the inclusion of the RNA aptamer hairpins and truncations of stem-loops.
  • a single copy of the MS2 hairpin sequence (C5 variant) was incorporated into either the 5’, 5’ and a truncation of the stem loop 1, stem loop 1 extension, replacement of stem loop 2 and truncation of stem loop 1, or replacement of the repeat:antirepeat.
  • the relevant gRNA sequences were cloned into a separate expression vector under control of the hU6 promoter.
  • N denotes the 23 nt target specific spacer sequence.
  • the constant gRNA sequence is highlighted in bold.
  • the MS2 (C5 variant) is displayed in italics whilst the extensions to the aptamer are shown in italics and underlined.
  • Design 1 corresponds to a 5’MS2
  • design 2 corresponds to 5’MS2 and a stem loop 1 truncation
  • design 3 corresponds to an MS2 located as an extension of stem loop 1
  • design 4 corresponds to a MS2 located as a replacement of stem loop 2 and a truncation of stem loop 1
  • design 5 corresponds to a MS2 located as a replacement of the repeat:antirepeat region.
  • Table 4 gRNA sequences for use with CasMINI
  • Plasmid design [00203] Aside from the gRNA, all components of the systems used were encoded on two vectors and expressed from a CMV promoter.
  • the first vector encoded an enhanced human Apobec3A-MCP or Anolis carolinensis Apobec1a-MCP fusion protein (Deaminase vector).
  • the second vector encoded a dCas12b (D569A, E847A, D976A) or dCasMINI (D325A; D509A) fused to two copies of UGI through its C-terminus (Cas vector).
  • dCasMINI is a previously described version of dUn1Cas12f1.
  • the dCas12b-UGI-UGI and dCasMINI-UGI-UGI fusion proteins were flanked by 2 copies of the SV40 NLS at the N terminus of the Cas sequence and the C terminus of UGI sequence. Additionally, the vector encoded the expression of turboRFP to allow the monitoring of transfection efficiency. [00204] The relevant gRNA sequences were cloned into a separate expression vector under control of the hU6 promoter (gRNA expression vector). [00205] One plasmid, which appears below as SEQ ID NO: 72 and was used in examples 3, 4, and 5, encodes a dead Cas12b fused to two UGIs: dCas12b-UGI-UGI.
  • the gRNA was expressed as a single unit encompassing the crRNA and tracrRNA components of A. acidoterrestris Cas12b or Acidibacillus sulfuroxidans Cas12f linked by an artificial tetra-loop as previously described.
  • a list of gRNA target sequences for each Cas protein are shown in table 5.
  • HEK293 cells were grown in Dulbecco’s modified Eagle medium (DMEM) supplemented with 10% fetal bovine serum (FBS) and 100 U ml-1 penicillin/streptomycin.24 hours prior to transfection 10,000 cells were seeded into a single well of a 96-well plate to achieve ⁇ 70% confluency for transfection.
  • DMEM Dulbecco modified Eagle medium
  • FBS fetal bovine serum
  • the cells were lipid transfected with 200 ng of plasmid DNA (75 ng Cas vector, 75 ng Deaminase vector, and 50 ng gRNA expression vector) with 0.7 ⁇ l of DharmaFECT DUO (Horizon discovery) per well of a 96 well plate.
  • plasmid DNA 75 ng Cas vector, 75 ng Deaminase vector, and 50 ng gRNA expression vector
  • DharmaFECT DUO Horizon discovery
  • NGS analysis the Q5 high-fidelity 2x master mix (NEB) was used for amplification of sgRNA target sites, reaction mixes were set up as follows: [00221] The PCR reaction was performed under the thermocycling conditions identified as follows: [00222] For Sanger sequencing analysis, regions of interest were PCR- amplified using GoTaq Hot Start polymerase (Promega). Reaction mixes were set up as follows: [00223] Primers used are detailed in table 4. [00224] Table 6: Primers [5' ⁇ 3'] [00225] Base editing analysis [00226] PCR products were submitted for Sanger sequencing (Genewiz). Data was analysed by proprietary in-house software (Chimera).
  • Example 3 Base editing using Cas12b
  • next-generation sequencing analysis of the Site2 amplicon region shows specific C to T transitions introduced by introduction of a Cas12b base editor in an HEK-293T cell line.
  • Two different effectors were used, either hApobec3A (Apobec3A-MCP) or AnoApobec (Anolis carolinensis Apobec1a- MCP), which were introduced through transfection of a plasmid expressing the sequence highlighted in SEQ ID NO: 76 and SEQ ID NO: 78, respectively.
  • dCas12b-UGI-UGI was introduced through transfection of a plasmid expressing the sequence highlighted in SEQ ID NO: 72.
  • gRNAs were introduced through transfection of plasmids expressing gRNA backbones that correspond to SEQ ID NOs: 58 to 65.
  • the target site sequences correspond to SEQ ID NO: 80.
  • the components were delivered by DNA plasmid lipid transfection and the cells were subsequently lysed 72 hours post-transfection, after which the targeted loci were amplified by PCR and analyzed by next-generation sequencing. [00229] The results are reported in figure 8A and figure 8B respectively.
  • FIGS. 1-10 show the level of C to T transitions achieved by delivery of the base editing components by DNA plasmid transfection in HEK-293 cells.
  • the X-axes denote different locations of the MS2 aptamer in the gRNA and correspond to those sequences highlighted in Table 3.
  • U->G indicates a change in an internal polyU stretch present in the Cas12b gRNA scaffold, introduced to increase efficiency of transcription under a hU6 promoter.
  • the Y axes display the percentage of C to T edits at the specified C residue within the protospacer as measured by NGS.
  • Each bar represents a targeted C residue within the targeted protospacer with the number in the figure legend denoting the position of the relevant C residue with 1 being PAM proximal and 20 PAM distal .
  • Two gRNA designs are functional with editing observed with both the 5’MS2 design and PolyU-MS2 design, furthermore no editing is apparent in the absence of the MS2 aptamer (MS2-less) indicating the observed editing is dependent on the recruitment of the deaminase through interaction between the MCP ligand and MS2 ligand binding moiety and subsequent assembly of the base editing complex. Editing is observed over a wide window, in a departure from that observed with Cas9 base editors, with up to 5 C residues edited over a 14 nt window. The shifted editing window highlights the general applicability of the tool and its potential to broaden the scope of sites that can be targeted for base editing.
  • Example 4 Base editing in multiple sites [00232] This example demonstrates that the Cas12b base editor is functional at multiple genomic loci and sequence contexts. Base editing analysis shows that the Cas12b base editor introduces C to T transitions in different sites in the HEK-293T cell line.
  • VEGFA_sgRNA1 SEQ ID NO: 82
  • FANCF_sgRNA3, SEQ ID NO: 84 site2_sgRNA2, SEQ ID NO: 93; site2_sgRNA4, SEQ ID NO: 81; B2M_sgRNA2, SEQ ID NO: 94; and B2M_sgRNA3, SEQ ID NO: 95.
  • Two different effectors were used, either hApobec3A or AnoApobec, which were introduced through transfection of plasmids expressing the sequences that correspond to SEQ ID NO: 76 and SEQ ID NO: 78, respectively.
  • Cas12b was introduced through transfection of a plasmid that expresses the sequence corresponding to SEQ ID NO: 72.
  • a 5’MS2 version of the gRNA (SEQ ID NO: 59) was used for all conditions.
  • the target site sequences correspond to SEQ ID NOs: 93-95, and 81-84.
  • Components were delivered by DNA plasmid lipid transfection and the cells were subsequently lysed 72 hours post- transfection, after which the targeted loci were amplified by PCR and analyzed by Sanger sequencing. Spacer sequences are shown in Table 5 and primers to amplify the edited region are shown in Table 6.
  • FIG. 9A (VEGFA_sgRNA1), figure 9B (VEGFA_sgRNA6), figure 9C (FANCF _sgRNA3), figure 9D (site2_sgRNA2), figure 9E (site2_sgRNA4), figure 9F (B2M_sgRNA2), and figure 9G (B2M_sgRNA3).
  • Level of C to T transitions achieved by delivery of the base editing components by DNA plasmid transfection in HEK-293 cells at multiple genomic sites and sequence contexts.
  • the Y axes display the percentage of C to T edits at the specified C residue within the protospacer as measured by Sanger sequencing and subsequent Chimera analysis.
  • Each bar represents a targeted C residue within the targeted protospacer with the number in the figure legend denoting the position of the relevant C residue with 1 being PAM proximal and 20 PAM distal . Error bars represent the standard error of the mean from 2 replicates.
  • Figures 9A-9G demonstrate that the Cas12b base editor is viable as a general base editing tool, with editing observed at multiple genomic loci and sequence contexts.
  • Example 5 Base editing in different cells lines
  • This example demonstrates that the Cas12b base editor is functional in different cell lines with Sanger sequencing and Chimera analysis shows that the Cas12b base editor introduces C to T transitions in the U2OS cell line.
  • One region targeted by one sgRNA is shown, VEGFA_sgRNA1, SEQ ID NO: 83.
  • Two different effectors were used, either hApobec3A or AnoApobec, which were introduced through transfection of plasmids that express the sequences that correspond to SEQ ID NO: 76 and SEQ ID NO: 78, respectively.
  • Cas12b was introduced through transfection of a plasmid that expresses the sequence that corresponds to SEQ ID NO: 72.
  • Transfection of plasmid expressing a 5’MS2 version of the sgRNA (SEQ ID NO: 59) was used for all conditions.
  • Components were delivered by DNA plasmid lipid transfection and the cells were subsequently lysed 72 hours post-transfection, after which the targeted loci were amplified by PCR and analyzed by Sanger sequencing.
  • Figure 10 shows the level of C to T transitions achieved by delivery of the base editing components by DNA plasmid transfection in U2OS cells. Data is shown for the guide VEGFA_sgRNA1, SEQ ID NO: 83.
  • the Y axis displays the percentage of C to T edits at the specified C residue within the protospacer as measured by Sanger sequencing and subsequent Chimera analysis.
  • Each bar represents a targeted C residue within the targeted protospacer with the number in the figure legend denoting the position of the relevant C residue with 1 being PAM proximal and 20 PAM distal .
  • Error bars represent the standard error of the mean from 2 replicates.
  • Figure 10 shows that the Cas12b base editor is functional in U2OS cell line for the same sgRNAs as in figure 9A, further demonstrating the general applicability of the base editing tool. Editing is observed with both deaminases and, as witnessed in HEK-293 cells, editing is apparent over a broad window.
  • Example 6 Base editing using CasMINI
  • This example demonstrates that the gRNA-ligand base editing system can be applied to other Type V enzymes other than Cas12b.
  • a CasMINI base editor introduces C to T transitions in different sites in HEK-293T cells.
  • Two different effectors were used, either hApobec3A or AnoApobec, which were introduced through transfection of plasmids that express sequences corresponding to SEQ ID NO: 76 and SEQ ID NO: 78, respectively.
  • CasMINI was introduced through transfection of a plasmid that expresses the sequence that corresponds to SEQ ID NO: 74.
  • gRNAs were introduced through transfection of plasmids expressing gRNA backbones that correspond to SEQ ID NOs: 66 to 71. Two different regions targeted by two different sgRNAs are shown; VEGFA_sgRNA1, SEQ ID NO: 85, and VEGFA_sgRNA2, SEQ ID NO: 86. Components were delivered by DNA plasmid lipid transfection and the cells were subsequently lysed 72 hours post-transfection, after which the targeted loci were amplified by PCR and analyzed by Sanger sequencing. [00241] Figures 11A-11D. Level of C to T transitions achieved by delivery of the CasMINI base editing components by DNA plasmid transfection in HEK-293 cells.
  • the X-axes denote different locations of the MS2 aptamer in the gRNA and correspond to those sequences highlighted in Table 4; sgRNA-design 1, SEQ ID NO: 67, corresponds to a 5’MS2, sgRNA-design 2, SEQ ID NO: 68, corresponds to 5’MS2 and a stem loop 1 truncation, sgRNA-design 3, SEQ ID NO: 69, corresponds to an MS2 located as an extension of stem loop 1, sgRNA-design 4, SEQ ID NO: 70, corresponds to a MS2 located as a replacement of stem loop 2 and a truncation of stem loop 1, sgRNA-design 5, SEQ ID NO: 71, corresponds to a MS2 located as a replacement of the repeat:antirepeat region.
  • MS-2less in these figures corresponds to SEQ ID NO: 66.
  • the Y axes display the percentage of C to T edits at the specified C residue within the protospacer as measured by Sanger sequencing and subsequent Chimera analysis.
  • Each bar represents a targeted C residue within the targeted protospacer with the number in the figure legend denoting the position of the relevant C residue with 1 being PAM proximal and 20 PAM distal. Error bars represent the standard error of the mean from 2 replicates.
  • Figures 11A, 11B, 11C, and 11D show that CasMINI base editor is functional in HEK-293T cells.
  • both AnoApobec and hApobec3a are functional as part of the CasMINI base editor and 3 different gRNA designs are consistently functional (designs 2, 3 and 4). Intriguingly the placement of the ligand binding moiety had a clear impact on editing behavior, with design 4 demonstrating a wide editing window and broad elevated levels of editing, whilst designs 2 and 3 show a marked preference for a particular C residue within the protospacer. This ability to alter editing windows (both positionally and their size) through alternative placement of the ligand binding moiety within the gRNA further exemplifies the unique practical application and flexibility of the gRNA-ligand base editing system.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Medicinal Chemistry (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Cell Biology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Saccharide Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2022/011294 2021-01-05 2022-01-05 Guide rna designs and complexes for type v cas systems Ceased WO2022150372A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
JP2023541017A JP2024502114A (ja) 2021-01-05 2022-01-05 V型CasシステムのためのガイドRNAデザインおよび複合体
CA3207094A CA3207094A1 (en) 2021-01-05 2022-01-05 Guide rna designs and complexes for type v cas systems
US18/270,747 US20240060088A1 (en) 2021-01-05 2022-01-05 Guide RNA Designs and Complexes for Type V Cas Systems
CN202280019354.3A CN117242184A (zh) 2021-01-05 2022-01-05 向导RNA设计及用于V型Cas系统的复合物
EP22737039.2A EP4274903A4 (en) 2021-01-05 2022-01-05 GUIDE RNA DESIGNS AND COMPLEXES FOR CAS TYPE V SYSTEMS

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163133945P 2021-01-05 2021-01-05
US63/133,945 2021-01-05

Publications (1)

Publication Number Publication Date
WO2022150372A1 true WO2022150372A1 (en) 2022-07-14

Family

ID=82358142

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/011294 Ceased WO2022150372A1 (en) 2021-01-05 2022-01-05 Guide rna designs and complexes for type v cas systems

Country Status (6)

Country Link
US (1) US20240060088A1 (cg-RX-API-DMAC7.html)
EP (1) EP4274903A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024502114A (cg-RX-API-DMAC7.html)
CN (2) CN117242184A (cg-RX-API-DMAC7.html)
CA (1) CA3207094A1 (cg-RX-API-DMAC7.html)
WO (1) WO2022150372A1 (cg-RX-API-DMAC7.html)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12054756B2 (en) 2022-03-01 2024-08-06 Epicrispr Biotechnologies, Inc. Engineered nucleases, compositions, and methods of use thereof
WO2024235293A1 (zh) * 2023-05-17 2024-11-21 中国科学院遗传与发育生物学研究所 基于环状rna的引导编辑系统
WO2024245139A1 (en) * 2023-05-26 2024-12-05 Correctsequence Therapeutics (Shanghai) Co., Ltd Gene editing systems and uses thereof
US12415994B2 (en) 2020-09-01 2025-09-16 The Board Of Trustees Of The Leland Stanford Junior University Synthetic miniature Crispr-Cas (CasMINI) system for eukaryotic genome engineering
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US12612618B2 (en) 2019-01-31 2026-04-28 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180327784A1 (en) * 2015-07-15 2018-11-15 Rutgers, The State University Of New Jersey Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof
WO2019126716A1 (en) * 2017-12-22 2019-06-27 The Broad Institute, Inc. Cas12b systems, methods, and compositions for targeted rna base editing

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4485466A3 (en) * 2016-08-17 2025-04-02 The Broad Institute Inc. Novel crispr enzymes and systems
AU2019265019B2 (en) * 2018-05-11 2025-11-06 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
KR20210126680A (ko) * 2019-02-13 2021-10-20 빔 테라퓨틱스, 인크. 알파-1 항트립신 결핍증을 치료하기 위한 조성물 및 방법

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180327784A1 (en) * 2015-07-15 2018-11-15 Rutgers, The State University Of New Jersey Nuclease-Independent Targeted Gene Editing Platform and Uses Thereof
WO2019126716A1 (en) * 2017-12-22 2019-06-27 The Broad Institute, Inc. Cas12b systems, methods, and compositions for targeted rna base editing

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
See also references of EP4274903A4 *
STRECKER ET AL.: "Engineering of CRISPR-Cas12b for human genome editing", NAT COMMUN, vol. 10, no. 1, 2019, XP055792773, DOI: 10.1038/s41467-018-08224-4 *

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12612618B2 (en) 2019-01-31 2026-04-28 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
US12415994B2 (en) 2020-09-01 2025-09-16 The Board Of Trustees Of The Leland Stanford Junior University Synthetic miniature Crispr-Cas (CasMINI) system for eukaryotic genome engineering
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12054756B2 (en) 2022-03-01 2024-08-06 Epicrispr Biotechnologies, Inc. Engineered nucleases, compositions, and methods of use thereof
WO2024235293A1 (zh) * 2023-05-17 2024-11-21 中国科学院遗传与发育生物学研究所 基于环状rna的引导编辑系统
WO2024245139A1 (en) * 2023-05-26 2024-12-05 Correctsequence Therapeutics (Shanghai) Co., Ltd Gene editing systems and uses thereof

Also Published As

Publication number Publication date
CA3207094A1 (en) 2022-07-14
EP4274903A1 (en) 2023-11-15
CN117242184A (zh) 2023-12-15
CN117098844A (zh) 2023-11-21
JP2024502114A (ja) 2024-01-17
EP4274903A4 (en) 2025-04-16
US20240060088A1 (en) 2024-02-22

Similar Documents

Publication Publication Date Title
US20240060088A1 (en) Guide RNA Designs and Complexes for Type V Cas Systems
JP7844400B2 (ja) 異常ヘモグロビン症の治療用組成物および方法
EP3956449B1 (en) Methods and compositions for editing rnas
CN115651927B (zh) 编辑rna的方法和组合物
US20240067983A1 (en) Guide RNA Designs and Complexes for Tracr-less Type V Cas Systems
JP7030522B2 (ja) 幹細胞における遺伝子編集のための最適化crispr/cas9システムおよび方法
JP2021500889A (ja) 内因性t細胞受容体の標的置換
KR20170106486A (ko) 일차 조혈 세포에서의 단백질 전달
EP3129484A1 (en) Crispr/cas-related methods and compositions for treating hiv infection and aids
WO2022256448A2 (en) Compositions and methods for targeting, editing, or modifying genes
Park et al. Enhancing genome editing in hPSCs through dual inhibition of DNA damage response and repair pathways
CN116507629B (zh) Rna支架
US20240309347A1 (en) Fusion Proteins for CRISPR-based Transcriptional Repression
HK40081918B (en) Methods and compositions for editing rna
WO2025096825A1 (en) Gene targets for t-cell immunotherapy to overcome t cell exhaustion
HK40061041A (en) Methods and compositions for editing rnas
HK40056042B (en) Methods and compositions for editing rnas
HK40056042A (en) Methods and compositions for editing rnas

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22737039

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3207094

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 18270747

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2023541017

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022737039

Country of ref document: EP

Effective date: 20230807

WWE Wipo information: entry into national phase

Ref document number: 202280019354.3

Country of ref document: CN