WO2022136649A1 - Non-blocking human ccr8 binders - Google Patents

Non-blocking human ccr8 binders Download PDF

Info

Publication number
WO2022136649A1
WO2022136649A1 PCT/EP2021/087508 EP2021087508W WO2022136649A1 WO 2022136649 A1 WO2022136649 A1 WO 2022136649A1 EP 2021087508 W EP2021087508 W EP 2021087508W WO 2022136649 A1 WO2022136649 A1 WO 2022136649A1
Authority
WO
WIPO (PCT)
Prior art keywords
binder
amino acid
seq
vhh
hccr8
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2021/087508
Other languages
French (fr)
Inventor
Hui Qi LU
Catelijne Stortelers
Nadia VAN BOXEL
Shanna VAN ZWAM
Jimmy BORLOO
Bruno Dombrecht
Jo Van Ginderachter
Pascal Merchiers
Rosa MARTÍN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oncurious Nv
Vlaams Instituut voor Biotechnologie VIB
Vrije Universiteit Brussel VUB
Original Assignee
Oncurious Nv
Vlaams Instituut voor Biotechnologie VIB
Vrije Universiteit Brussel VUB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Oncurious Nv, Vlaams Instituut voor Biotechnologie VIB, Vrije Universiteit Brussel VUB filed Critical Oncurious Nv
Priority to CA3206124A priority Critical patent/CA3206124A1/en
Priority to US18/259,141 priority patent/US20240052044A1/en
Priority to EP21835339.9A priority patent/EP4267618A1/en
Priority to CN202180094418.1A priority patent/CN116888156A/en
Publication of WO2022136649A1 publication Critical patent/WO2022136649A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to human CCR8 (hCCR8) binders, wherein the hCCR8 binder is a non-blocking binder of hCCR8.
  • hCCR8 human CCR8
  • binders are particularly useful for the depletion of intra- tumoural regulatory T-cells and immunotherapy in general.
  • Treg cells are one of the integral components of the adaptive immune system whereby they contribute to maintaining tolerance to self-antigens and preventing auto-immune diseases.
  • Treg cells are also found to be highly enriched in the tumour microenvironment of many different cancers (Colombo and Piconese, 2007; Nishikawa and Sakaguchi, 2014; Roychoudhuri et al., 2015).
  • TAA tumour-associated antigen
  • Treg cells contribute to immune escape by reducing tumour-associated antigen (TAA)-specific T-cell immunity, thereby preventing effective anti-tumour activity.
  • TAA tumour-associated antigen
  • High tumour infiltration by Tregs is hence often associated with an invasive phenotype and poor prognosis in cancer patients (Shang et aL, 2015; Plitas et aL, 2016).
  • Treg cells Acknowledging the significance of tumour-infiltrating Treg cells and their potential role in inhibiting anti-tumour immunity, multiple strategies have been proposed to modulate Treg cells in the tumour microenvironment. Several studies have demonstrated that modulating Tregs has the potential to offer significant therapeutic benefit (Elpek et al, 2007).
  • Treg modulation is that systemic removal or inhibition of Treg cells may elicit autoimmunity. It is therefore critical to specifically deplete tumour-infiltrating Treg cells while preserving tumour-reactive effector T cells and peripheral Treg cells (e.g. circulating blood Treg cells) in order to prevent autoimmunity.
  • systemic removal or inhibition of Treg cells may elicit autoimmunity. It is therefore critical to specifically deplete tumour-infiltrating Treg cells while preserving tumour-reactive effector T cells and peripheral Treg cells (e.g. circulating blood Treg cells) in order to prevent autoimmunity.
  • the G protein-coupled CC chemokine receptor protein CCR8 (CKRL1/CMKBR8/CMKBRL2) and its natural ligand CCL1 have been known to be implicated in cancer and specifically in T- cell modulation in the tumour environment.
  • Eruslanov et al. (Clin Cancer Res 2013, 17:1670- 80) showed upregulation of CCR8 expression in human cancer tissues and demonstrated that primary human tumours produce substantial amounts of the natural CCR8 ligand CCL1 . This indicates that CCL1/CCR8 axis contributes to immune evasion and suggest that blockade of CCR8 signals is an attractive strategy for cancer treatment. Hoelzinger et al.
  • WO2018/181425 suggests that, in mice, a neutralizing anti-CCR8 mAb is able to deplete T reg cells in tumour tissues by antibody-dependent cell-mediated cytotoxicity (ADCC), and thereby enhance tumour immunity. Through their neutralizing activity, these antibodies inhibit Treg migration into the tumour, reverse the suppressive function of Tregs and deplete intratumoural Tregs (WO2019/157098 A1 ). Recently, Wang et al. (Cancer Immunol Immonother 2020, https://doi.org/10.1007/s00262-020-02583-y) showed that CCR8 blockade could destabilize intratumoural Tregs into a fragile phenotype accompanied with reactivation of the antitumour immunity and augment anti-PD-1 therapeutic benefits.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CCR8 therapeutics that have been disclosed up to now are invariably blocking human CCR8 binders.
  • W02013131010 A2 discloses methods for treating solid tumours by administering antagonists of CCR8 that reduce the binding of CCL1 to CCR8 and explicitly refers to the monoclonal antibodies described in W02007044756 A2.
  • This patent application from ICOS Corporation discloses antibodies against human CCR8 that block CCL1 -induced chemotaxis, including the preferred antibody 433H that is currently commercially available.
  • W02020138489 A1 provides antibodies against CCR8 for cancer treatment. Its humanized antibodies bind to human CCR8 and neutralize CC1 -induced calcium influx. It is indicated that binding to the N-terminal region of human CCR8 is in important element for exerting neutralizing activity.
  • hCCR8 human CCR8
  • a non-blocking binder of CCR8 having cytotoxic activity allows for the efficient depletion of tumour-infiltrating regulatory T-cells (Tregs).
  • Tregs tumour-infiltrating regulatory T-cells
  • the non-blocking hCCR8 binders of the invention therefore provide potential for efficacious tumour therapy, while displaying an improved safety profile.
  • the present invention provides an hCCR8 binder, wherein said hCCR8 binder is a non-blocking binder of hCCR8.
  • the hCCR8 binder binds to the N-terminal extracellular region of hCCR8.
  • the hCCR8 binder comprises a single-domain antibody moiety that binds to hCCR8.
  • the single-domain antibody moiety comprises three complementary determining regions (CDRs), namely CDR1 , CDR2 and CDR3, wherein CDR3 is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3.
  • CDRs complementary determining regions
  • CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO:
  • CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGXSA (SEQ ID NO: 2), wherein X Is selected from the group consisting of N, S, and K, (b) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO:
  • SEQ ID NO: 2 is selected from the group consisting of N, S and K, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K.
  • the single-domain antibody moiety further comprises four framework regions (FRs) having at least 50%, preferably at least 60%, more preferably at least 70%, still more preferably at least 80%, more preferably at least 85% sequence identity to SEQ ID NO: 4 to 7.
  • FRs framework regions
  • X in SEQ ID NO: 4 is selected from D and E
  • X in SEQ ID NO: 6 is selected from D and G.
  • the single-domain antibody moiety comprises the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 9.
  • the hCCR8 binder inhibits signalling of human CCR8 by less than 90%, preferably less than 80%, more preferably less than 70%, still more preferably less than 60%, most preferably less than 50%.
  • the hCCR8 binder comprises a single-domain antibody moiety that binds to human CCR8 and further comprises at least one cytotoxic moiety.
  • the cytotoxic moiety induces antibody-dependent cellular cytotoxicity (ADCC), induces antibody-dependent cellular phagocytosis (ADCP), induces complement-dependent cytotoxicity (CDC), binds to and activates T-cells, or comprises a cytotoxic payload.
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement-dependent cytotoxicity
  • Another object of the present invention is to provide nucleic acids encoding the hCCR8 binder.
  • Yet another object of the present invention is to provide non-blocking hCCR8 binders for use as a medicine.
  • a further object of the present invention is to provide non-blocking hCCR8 binders for use in the treatment of a tumour.
  • the tumour is selected from the group consisting of breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck cancer, squamous cell carcinoma, skin cancer, colorectal cancer, kidney cancer and T cell lymphoma.
  • the administration of the hCCR8 binder leads to the depletion of tumour-infiltrating regulatory T-cells (Tregs).
  • the treatment further comprises administration of a checkpoint inhibitor.
  • a checkpoint inhibitor is a compound that blocks checkpoint proteins from binding to their partner proteins thereby activating the immune system function.
  • the checkpoint inhibitor blocks proteins selected from the group consisting of PD-1 , PD-L1 , CTLA-4, TIGIT, TIM-3, LAG-3, VISTA, B7-1 , and B7-2. More preferably the checkpoint inhibitor blocks PD-1 or PD-L1.
  • FIGURES Figure 1 illustrates the evaluation by flow cytometry of two VHHs (VHH-01 and VHH-06) derived from llama immunization with mouse CCR8 for their binding to full-length mouse CCR8 versus N-terminal deletion mouse CCR8 overexpressed in Hek293 cells.
  • Figure 2 presents a schematic representation of the VHH-Fc fusions VHH-Fc-14, VHH-Fc-25, VHH-Fc-41 and VHH-Fc-43.
  • Figure 3 illustrates the evaluation of VHH-Fc-14 and VHH-Fc-25 for their potential to functionally inhibit the protective activity of ligand mCCL1 against dexamethasone-induced apoptosis in BW5147 cells.
  • Figure 4 shows the effects on intratumoural Treg depletion by VHH-Fc-43, which is a mCCR8 blocking Fc fusion with ADCC activity, and VHH-Fc-41 , which lacks ADCC activity, as well as isotype control.
  • Figure 5 shows the effects on circulating Tregs by VHH-Fc-43 and VHH-Fc-41 and isotype control.
  • Figure 6 illustrates the effects on intestinal Treg levels by VHH-Fc-43 and VHH-Fc-41 and isotype control.
  • Figure 7 shows the in vivo effects of VHH-Fc-25 on tumour growth in comparison to isotype and VHH-Fc-14 in LLC-OVA tumors.
  • Figure 8 shows the in vivo effects of VHH-Fc-25 on tumour growth in comparison to isotype and VHH-Fc-14 in MC38 tumors.
  • FIG. 9 illustrates the evaluation by flow cytometry of one VHH (VHH-69) derived from llama immunization with human CCR8 for its binding to human CCR8 on stably transfected in HEK293 cells.
  • FIG. 10 illustrates the evaluation of VHH-69 as well as a CCR8-blocking control VHH (VHH- blocking) for their potential to functionally inhibit the action of the human CCL1 ligand on cAMP accumulation in CHO-K1 cells stably expressing recombinant human CCR8.
  • Figure 11 shows the evaluation of the three VHH-Fc fusions VHH-Fc-218 (SEQ ID NO: 27), VHH-Fc-219 (SEQ ID NO: 21 ) and VHH-Fc-220 (SEQ ID NO: 22) for their binding to human CCR8 on stably transfected in HEK293 cells, in comparison with two control anti-CCR8 mAbs.
  • Figure 12 illustrates the evaluation by flow cytometry of VHH-Fc fusions VHH-Fc-218, VHH- Fc-219 and VHH-Fc-220 for their binding to macaca CCR8 transiently expressed in HEK239T cells, in comparison with two control anti-CCR8 mAbs.
  • Figure 13 shows the effects on functional inhibition of the action of the human CCL1 ligand on cAMP accumulation in CHO-K1 cells stably expressing recombinant human CCR8 by VHH- Fc-219, as well as three control anti-CCR8 mAbs.
  • Figure 14 presents the amino acid sequence of VHH-69 (SEQ ID NO: 10), which is nonblocking hCCR8 binder.
  • Complementarity determining regions (CDRs) identified using the IMGT method are underlined, whereas CDRs identified using the Kabat method are represented in bold.
  • Asterisks indicate amino acids which are mutated in the humanized nonblocking hCCR8 binders VHH-123 (SEQ ID NO: 8) and VHH-124 (SEQ ID NO: 9).
  • Figure 15 illustrates the evaluation of VHH-Fc fusions VHH-123 (SEQ ID NO: 8) and VHH- 124 (SEQ ID NO: 9) for their capacity to compete with FLAG3-tagged VHH-69 (SEQ ID NO: 10) for binding to human CCR8 stably expressing in HEK293 cells, in comparison with a control (VHH-69 (E1 D)).
  • Figure 16 shows the evaluation of the PBMC mediated ADCC activity of both an afucosylated (AF) and a non-afucosylated version of VHH-Fc-262 (SEQ ID NO: 29) and VHH-Fc-264 (SEQ ID NO: 26) in comparison to isotype on hCCR8-expressing HEK292 cells.
  • AF afucosylated
  • SEQ ID NO: 29 non-afucosylated version of VHH-Fc-262
  • VHH-Fc-264 SEQ ID NO: 26
  • CCR8 is a member of the beta-chemokine receptor family which is predicted to be a seven transmembrane protein similar to G-coupled receptors. Identified ligands of CCR8 include its natural cognate ligand CCL1 (I-309). Human CCR8 received UniProt Knowledgebase entry number P51685.
  • a human CCR8 binder as used herein refers to a molecule capable of specifically binding to hCCR8. Such a binder is also referred to herein as a ”hCCR8 binder”.
  • Binder affinities towards membrane targets may be determined by a surface plasmon resonance based assay (such as the BIAcore assay as described in PCT Application Publication No.
  • a preferred method for determining apparent Kd or EC50 values is by using FACS at 21 °C with cells overexpressing hCCR8.
  • the binding moiety of the hCCR8 binder is proteinaceous, more particularly a hCCR8 binding polypeptide.
  • the binding moiety of the hCCR8 binder is antibody based or non-antibody based, preferably antibody based.
  • Non-antibody based binders include, but are not limited to, affibodies, Kunitz domain peptides, monobodies (adnectins), anticalins, designed ankyrin repeat domains (DARPins), centyrins, fynomers, avimers; affilins; affitins, peptides and the like.
  • the hCCR8 binder of the invention binds to an extracellular part of hCCR8, in particular an extracellular part of hCCR8 expressed on regulatory T-cells, such as the N-terminal region or one of the extracellular loops of hCCR8.
  • the hCCR8 binder of the invention binds to the N-terminal region, especially the N-terminal amino acids 1 to 35, such as 1 to 30, or 1 to 25 of hCCR8.
  • the terms “antibody”, “antibody fragment” and “active antibody fragment” refer to a protein comprising an immunoglobulin (Ig) domain or an antigen-binding domain capable of specifically binding the antigen, in this case the hCCR8 protein.
  • “Antibodies” can further be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies may be multimers, such as tetramers, of immunoglobulin molecules.
  • the binder comprises a hCCR8 binding moiety that is an antibody or active antibody fragment.
  • the binder is an antibody.
  • the antibody is monoclonal.
  • the antibody may additionally or alternatively be humanised or human.
  • the antibody is human, or in any case an antibody that has a format and features allowing its use and administration in human subjects.
  • Antibodies may be derived from any species, including but not limited to mouse, rat, chicken, rabbit, goat, bovine, nonhuman primate, human, dromedary, camel, llama, alpaca, and shark.
  • antigen-binding fragment is intended to refer to an antigen-binding portion of said intact polyclonal or monoclonal antibodies that retains the ability to specifically bind to a target antigen or a single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
  • the antigen-binding fragment comprises, but not limited to Fab; Fab'; F(ab')s; a Fc fragment; a single domain antibody (sdAb or dAb) fragment.
  • antigen-binding fragment also refers to fusion proteins comprising heavy and/or light chain variable regions, such as single-chain variable fragments (scFv).
  • the term “monoclonal antibody” refers to an antibody composition having a homogeneous antibody population. It is understood that monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional antibody (polyclonal) preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the binders of the invention preferably comprise a monoclonal antibody moiety that binds to hCCR8. In one aspect of the invention, the binder comprises an active antibody fragment.
  • active antibody fragment refers to a portion of any antibody or antibody-like structure that by itself has high affinity for an antigenic determinant, or epitope, and contains one or more antigen-binding sites, e.g. complementary-determining-regions (CDRs), accounting for such specificity.
  • CDRs complementary-determining-regions
  • Non-limiting examples include immunoglobulin domains, Fab, F(ab)’2, scFv, heavylight chain dimers, immunoglobulin single variable domains, single domain antibodies (sdAb or dAb), Nanobodies®, and single chain structures, such as complete light chain or complete heavy chain, as well as antibody constant domains that have been engineered to bind to an antigen.
  • immunoglobulin (Ig) domain or more specifically “immunoglobulin variable domain” (abbreviated as “IVD”) means an immunoglobulin domain essentially consisting of framework regions interrupted by complementary determining regions.
  • immunoglobulin domains consist essentially of four “framework regions” which are referred in the art and below as “framework region 1 ” or “FR1 as “framework region 2” or “FR2”; as “framework region 3” or “FR3”; and as “framework region 4” or “FR4”, respectively; which framework regions are interrupted by three “complementarity determining regions” or “CDRs”, which are referred in the art and herein below as “complementarity determining region 1 ” or “CDR1 as “complementarity determining region 2” or “CDR2”; and as “complementarity determining region 3” or “CDR3”, respectively.
  • framework regions are interrupted by three “complementarity determining regions” or “CDRs”, which are referred in the art and herein below as “complementarity determining region 1 ” or “CDR1 as “complementarity determining region 2” or “CDR2”; and as “complementarity determining region 3” or “CDR3”, respectively
  • an immunoglobulin variable domain can be indicated as follows: FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. It is the immunoglobulin variable domain(s) (IVDs) that confer specificity to an antibody for the antigen by carrying the antigenbinding site.
  • IVDs immunoglobulin variable domain(s)
  • a heavy chain variable domain (VH) and a light chain variable domain (VL) interact to form an antigen binding site.
  • VH heavy chain variable domain
  • VL light chain variable domain
  • the complementary determining regions (CDRs) of both VH and VL will contribute to the antigen binding site, i.e. a total of 6 CDRs will be involved in antigen binding site formation.
  • the antigen-binding domain of a conventional 4-chain antibody such as IgG, IgM, IgA, Ig D or Ig E molecule; known in the art
  • a conventional 4-chain antibody such as IgG, IgM, IgA, Ig D or Ig E molecule; known in the art
  • a pair of (associated) immunoglobulin domains such as light and heavy chain variable domains, i.e., by a VH-VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective antigen.
  • a single-domain antibody refers to a protein with an amino acid sequence comprising 4 framework regions (FR) and 3 complementarity determining regions (CDRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4.
  • Single-domain antibodies of this invention are equivalent to “immunoglobulin single variable domains” (abbreviated as “ISVD”) and refers to molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets single-domain antibodies apart from “conventional” antibodies or their fragments, wherein two immunoglobulin domains, in particular two variable domains interact to form an antigen binding site.
  • the binding site of a single-domain antibody is formed by a single VH/VHH or VL domain.
  • the antigen binding site of a single-domain antibody is formed by no more than 3 CDRs.
  • a single domain may be a light chain variable domain sequence, (e.g. a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g. a VH-sequence or VHH sequence) or a suitable fragment thereof; as long as it is capable of forming a single antigen binding unit (i.e., a functional antigen binding unit that essentially consists of a single variable domain, such that the single antigen binding domain does not need to interact with another variable domain to form a functional antigen binding unit).
  • a single antigen binding unit i.e., a functional antigen binding unit that essentially consists of a single variable domain, such that the single antigen binding domain does not need to interact with another variable domain to form a functional antigen binding unit.
  • the hCCR8 binder as detailed above comprises a single-domain antibody moiety.
  • the single-domain antibody may be a Nanobody® (as defined herein) or a suitable fragment thereof (Note: Nanobody®, Nanobodies® and Nanoclone® are registered trademarks of Ablynx N.V., a Sanofi Company).
  • Nanobodies® reference is made to the further description below, and described in the prior art such as e.g. W02008/020079.
  • VHH domains also known as VHHs, VHH antibody fragments and VHH antibodies, have originally been described as the antigen binding immunoglobulin (Ig) (variable) domain of “heavy chain antibodies” (i.e. of “antibodies devoid of light chains”; see e.g.
  • VHH domain has been chosen to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VH domains”) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VL domains”).
  • VHHs and Nanobodies® For a further description of VHHs and Nanobodies®, reference is made to the review article by Muyldermans (Reviews in Molecular Biotechnology 74: 277-302, 2001 ), as well as to the following patent applications, which are mentioned as general background art: WO 94/04678, WO 95/04079 and WO 96/34103 of the Vrije Universiteit Brussel; WO 94/25591 , WO 99/37681 , WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301 , EP 1134231 and WO 02/48193 of Unilever; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527 of the Vlaams Instituut voor Biotechnologie (VIB); WO 03/050531 of Algonomics N.V
  • Nanobody® in particular VHH sequences and partially humanized Nanobody®
  • a further description of the Nanobody®, including humanization and/or camelization of Nanobody, as well as other modifications, parts or fragments, derivatives or “Nanobody fusions”, multivalent or multispecific constructs (including some non-limiting examples of linker sequences) and different modifications to increase the half-life of the Nanobody® and their preparations can be found e.g. in WO 08/101985 and WO 08/142164.
  • VHHs and Nanobodies® are among the smallest antigen binding fragment that completely retains the binding affinity and specificity of a full-length antibody (see e.g. Greenberg et aL, Nature 374:168-73 (1995); Hassanzadeh-Ghassabeh et aL, Nanomedicine (Lond), 8:1013-26 (2013)).
  • binders of the present invention may be monospecific, bispecific, or multispecific. “Multispecific binders” may be specific for different epitopes of one target antigen or polypeptide, or may contain antigen-binding domains specific for more than one target antigen or polypeptide (Kufer et al. Trends Biotechnol 22:238-44 (2004)).
  • the binder is a monospecific binder. As discussed further below, in an alternative aspect the binder is a bispecific binder.
  • binder refers to a binder having the capacity to bind two distinct epitopes either on a single antigen or polypeptide, or on two different antigens or polypeptides.
  • Bispecific binders of the present invention as discussed herein can be produced via biological methods, such as somatic hybridization; or genetic methods, such as the expression of a nonnative DNA sequence encoding the desired binder structure in a cell line or in an organism; chemical methods (e.g. by chemical coupling, genetic fusion, noncovalent associated or otherwise to one or more molecular entities, such as another binder of fragment thereof); or combination thereof.
  • binders of the invention may include reduced side effects, such as reduced effects on T cell populations expressing CCR8 which are not tumour-infiltrating Tregs, in particular non-tumour-infiltrating Treg cell populations expressing CCR8, such as the intestinal and/or skin Treg populations.
  • the non-blocking binders of the invention may include the absence of or a lowered inhibition of dendritic cell migration towards lymph nodes.
  • CCR8 binders having cytotoxic activity characterized in that the CCR8 binder is a non-blocking binder of CCR8 can nonetheless specifically deplete tumour-infiltrating regulatory T-cells (Tregs), obtaining the same and higher efficacies, while reducing unwanted systemic side effects, as evidenced by the examples below.
  • a “non-blocking” binder of hCCR8 means that it does not block or substantially block the binding of a hCCR8 ligand to hCCR8, in particular, the binder does not block the binding of at least one ligand selected from hCCL1 , hCCL8, hCCL16, and hCCL18 to hCCR8, in particular it does not block binding of hCCL1 or hCCL18 to hCCR8, preferably it does not block the binding of hCCL1 to hCCR8.
  • Blockade of ligand binding to hCCR8 may be determined by methods known in the art.
  • Examples thereof include, but are not limited to, the measurement of the binding of a ligand such as hCCL1 to hCCR8, the migration of hCCR8-expressing cells towards a ligand such as hCCL1 , increase in intracellular Ca 2+ levels by a hCCR8 ligand such as hCCL1 , rescue from dexamethasone-induced apoptosis by a ligand such as hCCL1 , and variation in the expression of a gene sensitive to hCCR8 ligand stimulation, such as hCCL1 stimulation.
  • references to “non-blocking”, “non-ligand blocking”, “does not block” or “without blocking” and the like include embodiments wherein the hCCR8 binder of the invention does not block or does not substantially block the signalling of hCCR8 ligand via hCCR8, in particular the signalling of hCCL1 via hCCR8. That is, the hCCR8 binder inhibits less than 50% of ligand signalling compared to ligand signalling in the absence of the binders.
  • the hCCR8 binder inhibits less than 40%, 35%, 30%, preferably less than about 25% of ligand signalling compared to ligand signalling in the absence of the binders.
  • the percentage of ligand signalling is measured at a hCCR8 binder molar concentration that is at least 10, in particular at least 50, more in particular at least 100 times the binding EC50 of the hCCR8 binder to hCCR8.
  • the percentage of ligand signalling is measured at a hCCR8 binder molar concentration that is at least 10, in particular at least 50, more in particular at least 100 times the molar concentration of the ligand.
  • Non-blocking hCCR8 binders allow binding of hCCR8 without interfering with the binding of at least one ligand to hCCR8, or without substantially interfering with the binding of at least one ligand to hCCR8.
  • Ligand signalling such as hCCL1 signalling, via hCCR8 may be measured by methods as discussed in the Examples and as known in the art. Comparison of ligand signalling in the presence and absence of the hCCR8 binder can occur under the same or substantially the same conditions.
  • hCCR8 signalling can be determined by measuring the cAMP release.
  • CHO-K1 cells stably expressing recombinant human CCR8 receptor (such as FAST-065C available from EuroscreenFAST) are suspended in an assay buffer of KRH: 5 mM KCI, 1.25 mM MgSO4, 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH2PO4, 1.45 mM CaCI2, 0.5 g/l BSA, supplemented with 1 mM IBMX.
  • the CCR8 binder is added at a concentration of 100nM and incubated for 30 minutes at 21 °C.
  • iM forskolin and human CCL1 in assay buffer is added to reach a final assay concentration of 5 nM hCCL1.
  • the assay mixture is then incubated for 30 minutes at 21 °C. After addition of a lysis buffer and 1 hour incubation, the concentration of cAMP is measured.
  • cAMP can be measured by e.g. determining fluorescence levels, such as with the HTRF kit from Cisbio using manufacturer assay conditions (catalogue #62AM9PE).
  • a non-blocking binder leads to a change of less than 50% of the amount of cAMP compared to a control that lacks the binder. In particular less than 40%, more in particular less than 30%, such as less than 20%.
  • a non-blocking binder leads to a change of less than 10%, more preferably less than 5% of cAMP compared to control.
  • epitopes refers to a site on an antigen to which a binder, such as an antibody, binds.
  • epitopes can be formed both from contiguous amino acids (linear epitope) or non-contiguous amino acids juxtaposed by tertiary folding of a protein (conformational epitopes). Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation.
  • sequence identity means that two polypeptide or polynucleotide sequences are identical (i.e. on an amino acid-by-amino acid, or on a nucleotide-by-nucleotide basis, respectively) over a window of comparison.
  • percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical amino acid or nucleic acid base, whichever relevant, occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e. the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
  • the term “substantially identical” or “substantial identity” denotes a characteristic of a polypeptide or polynucleotide sequence, wherein the polypeptide or polynucleotide comprises a sequence that has at least 80% sequence identity, preferably at least 85% sequence identify, more preferably 90% sequence identity, still more preferably 95% sequence identity, yet more preferably 99% sequence identity as compared to a reference sequence, wherein the percentage of sequence identify is calculated by aligning the reference sequence to the polypeptide or polynucleotide sequence which may include deletions or additions which in total amount 20% or less of the reference sequence over the window of comparison.
  • the reference sequence may be a subset of a larger sequence. Optimal alignment of sequences may be carried out by conventional software or methods known by those of ordinary skill in the art.
  • the term “corresponds to” or “corresponding to” is intended to mean that a polypeptide or a polynucleotide sequence is identical or similar to all or a portion of a reference polypeptide or a polynucleotide sequence.
  • the term “complementary to” as used herein in the relation to a polypeptide or a polynucleotide sequence is intended to mean that the complementary sequence is homologous to all or a portion of a reference polypeptide or a polynucleotide sequence.
  • the nucleotide sequence “TATAC” corresponds to a reference sequence “TATAC” and is complementary to a reference sequence “GTATA”.
  • the hCC8 binder comprises a single-domain antibody moiety which comprises at least one complementarity determining region (CDR) of a single-domain antibody moiety as described herein, or an amino acid sequence having at least 80% amino acid identity the said CDR sequences, or an amino acid sequence having 3, 2, or 1 amino acid sequence difference with said CDR sequences.
  • CDR complementarity determining region
  • the CDRs and the locations thereof in the sequence of said single-domain antibody moiety can be readily identified by conventional methods known by those of ordinary skill in the art, such as but not limited to, KABAT system (Kabat), Chothia, AHo or international ImMunoGeneTics information system (IMGT).
  • the preferred method for determining CDR sequences is the IMGT method (Lefranc, M.-P. et aL, 2009, Nucleic Acids Research, D1006- 1012, http://www.imgt.org).
  • a specific and preferred hCCR8 binder according to the invention comprises a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10.
  • Figure 14 presents a schematic representation of the amino acid sequence of SEQ ID NO: 10, wherein CDRs are identified using the IMGT method (underlined) or the Kabat method (bold).
  • the CDRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 3 (AAGTTIGQYTY) wherein X is selected from the group consisting of N, S and K.
  • X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
  • the single-domain antibody as referred-to herein comprises three CDRs comprising the sequence of SEQ ID NO: 33, 12, and 34, wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
  • CDRs as identified within the single-domain antibody moiety correspond to:
  • X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
  • the single-domain antibody as referred-to herein comprises three CDRs comprising the sequence of SEQ ID NO: 11 , 12, and 13, wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
  • the single-domain antibody moiety comprises at least one, preferably at least two and most preferably three CDR(s) selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, or at least one, preferably at least two and most preferably three amino acid sequence(s) having at least 80% amino acid identity to said CDR sequences, or at least one, preferably at least two and most preferably three amino acid sequence(s) having 3, 2, or 1 amino acid sequence difference with said CDR sequences.
  • the single-domain antibody moiety comprises a CDR3 which is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3. More preferably, CDR3 corresponds to SEQ ID NO: 3.
  • CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 1 ; and/or the CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGXSA (SEQ ID NO: 2), wherein X is selected from the group consisting of N, S and K, (b) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K.
  • the present invention provides a hCCR8 binder comprising a combination of CDR1 , CDR2, and CDR3 as described herein, including the allowable variation described for these CDR regions.
  • the binder of the invention comprises at least one CDR region of the single-domain antibody moieties as described herein.
  • the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 10.
  • the binder of the invention comprises the three CDR regions of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 10.
  • the single-domain antibody moiety comprises three CDRs having the sequence of SEQ ID NO: 1 , 2 and 3, wherein X is selected from the group consisting of N, S and K.
  • the single-domain antibody moiety further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to at least one framework region (FR) of a single-domain antibody moiety described herein.
  • the single-domain antibody moiety further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to the four framework regions (FR) of a single-domain antibody moiety described herein. It is understood that the method used for determining the FRs of said single-domain antibody moiety is the same as that used for identifying the CDRs.
  • the FRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 6 IIANSVKXRFTISRDNAKNTVYLQMNSLRPEDTAVYYC
  • SEQ ID NO: 7 (WGQGTLVTVSS) wherein X in SEQ ID NO: 4 is selected from D and E and wherein X in SEQ ID NO: 6 is selected from D and G.
  • the single-domain antibody moiety comprises at least one, preferably at least two, more preferably at least three and most preferably four amino acid sequences having at least 85%, preferably 90%, more preferably 95% sequence identity to the sequences selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 7, wherein X in SEQ ID NO: 4 is selected from D and E and wherein X in SEQ ID NO: 6 is selected from D and G.
  • said single-domain antibody moiety comprises four framework regions (FRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, wherein FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 4, wherein X is selected from the group consisting of D and E, FR2 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 5, FR3 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 6, wherein X is selected from the group consisting of D and G, and FR4 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 7.
  • FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 4
  • FR2 has at least 85%, preferably 90%,
  • the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 10 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto; wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 2 wherein X is N, S, or K, and a CDR3 of SEQ ID NO: 3.
  • X in SEQ ID NO: 2 is N.
  • the binder of the invention comprises the amino acid sequences corresponding to SEQ ID NO: 10.
  • humanized binder refers to a binder produced by molecular modelling techniques to identify an optimal combination of human and non-human (such as mouse or rabbits) binder sequences, that is, a combination in which the human content of the binder is maximized while causing little or no loss of the binding affinity attributable to the variable region of the non-human antibody.
  • a humanized antibody also known as a chimeric antibody comprises the amino acid sequence of a human framework region and of a constant region from a human antibody to "humanize” or render non-immunogenic the complementarity determining regions (CDRs) from a non-human antibody.
  • human binder means a binder having an amino acid sequence corresponding to that of a binder that can be produced by a human and/or which has been made using any of the techniques for making human antibodies known to a skilled person in the art or disclosed herein. It is also understood that the term “human antibody” encompasses antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide. One such example is an antibody comprising murine light chain and human heavy chain polypeptides.
  • single variable domains such as VHHs and Nanobodies® can be subjected to sequence optimization, such as humanization, i.e. increase the degree of sequence identity with the closest human germline sequence, and other optimization techniques, such as to improve physicochemical or other properties of the binders.
  • sequence optimization such as humanization, i.e. increase the degree of sequence identity with the closest human germline sequence, and other optimization techniques, such as to improve physicochemical or other properties of the binders.
  • humanized immunoglobulin single variable domains, such as VHHs and Nanobodies® may be single-domain antibodies in which at least one single amino acid residue is present (and in particular, at least one framework residue) that is and/or that corresponds to a humanizing substitution (as defined further herein).
  • Humanized single-domain antibodies in particular VHHs and Nanobodies®, may have several advantages, such as a reduced immunogenicity, compared to the corresponding naturally occurring VHH domains.
  • humanized is meant mutated so that immunogenicity upon administration in human patients is minor or non-existent.
  • the humanizing substitutions should be chosen such that the resulting humanized amino acid sequence and/or VHH still retains the favourable properties of the VHH, such as the antigen-binding capacity.
  • the non-blocking hCCR8 binder as described above, is an optimized non-blocking hCCR8 binder.
  • the optimized non-blocking hCCR8 binder comprises a single-domain antibody moiety as described above. More preferably, the single-domain antibody has been humanized by introducing mutations, in particular substitutions, for example at any one of positions of 1 , 55 and/or 65 of SEQ ID NO: 10. These residues have also been highlighted by asterisks in Figure 14. Specifically, a mutation substituting a Glutamic acid residue (E) by an Aspartic acid (D) at position 1 of SEQ ID NO: 10 was found to increase chemical stability of the binders.
  • the present invention provides a binder comprising the amino acid sequence of SEQ ID NO: 10, optionally comprising one or more of the substitutions E1 D, N55S, N55K, and G65D.
  • a binder comprising the amino acid sequence of SEQ ID NO: 10 comprising the substitutions E1 D, G65D, and N55S or N55K. In an even further embodiment, a binder comprising the amino acid sequence of SEQ ID NO: 10 comprising the substitution N55K.
  • the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 8. In an even further embodiment, the binder of the invention comprises the three CDR regions of a singledomain antibody moiety having the amino acid sequence of SEQ ID NO: 8. In yet another embodiment, the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 9. In an even further embodiment, the binder of the invention comprises the three CDR regions of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 9.
  • amino acid sequences and/or single-domain antibody of the invention may be suitably humanized at any position and in particular at any framework residue(s), such as at one or more Hallmark residues (as defined above) or at one or more other framework residues (i.e. non-Hallmark residues) or any suitable combination thereof.
  • any framework residue(s) such as at one or more Hallmark residues (as defined above) or at one or more other framework residues (i.e. non-Hallmark residues) or any suitable combination thereof.
  • deletions and/or substitutions may also be designed in such a way that one or more sites for posttranslational modification (such as one or more glycosylation sites) are removed, as will be within the ability of the person skilled in the art.
  • substitutions or insertions may be designed so as to introduce one or more sites for attachment of functional groups (as described herein), for example to allow site-specific pegylation.
  • the humanized non-blocking hCC8 binder comprises a single-domain antibody moiety which comprises at least one complementarity determining region (CDR) of a single-domain antibody moiety as described herein, or an amino acid sequence having at least 80% amino acid identity the said CDR sequences, or an amino acid sequence having 3, 2, or 1 amino acid sequence difference with said CDR sequences.
  • CDR complementarity determining region
  • the CDRs and the locations thereof in the sequence of said single-domain antibody moiety can be readily identified by conventional methods known by those of ordinary skill in the art, such as but not limited to, KABAT system (Kabat), Chothia, AHo or international ImMunoGeneTics information system (IMGT).
  • two specific humanized hCCR8 binders according to the invention comprise a single-domain antibody moiety corresponding to SEQ ID NO: 8 or 9.
  • the CDRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 14 (TDWTGSSA) or SEQ ID NO: 15 (TDWTGKSA)
  • the CDRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 16 RTDWTGSSAIIANSVKD
  • SEQ ID NO: 17 RTDWTGKSAIIANSVKD
  • SEQ ID NO: 34 (GTTIGQYTY).
  • the CDRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 16 RTDWTGSSAIIANSVKD
  • SEQ ID NO: 17 RTDWTGKSAIIANSVKD
  • the single-domain antibody moiety comprises at least one, preferably at least two and most preferably three CDR(s) selected from the group consisting of SEQ ID NO: 1 , 14, 15 and 3, or at least one, preferably at least two and most preferably three amino acid sequence(s) having at least 80% amino acid identity the said CDR sequences, or at least one, preferably at least two and most preferably three amino acid sequence(s) having 3, 2, or 1 amino acid sequence difference with said CDR sequences.
  • the single-domain antibody moiety comprises a CDR3 which is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3. More preferably, CDR3 corresponds to SEQ ID NO: 3.
  • CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 1
  • the CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGSSA (SEQ ID NO: 14), (b) the amino acid sequence of TDWTGSSA (SEQ ID NO : 15), (c) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO: 14 or 15, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 14 or 15.
  • the single-domain antibody moiety as detailed above comprises three CDRs having the sequence of SEQ ID NO: 1 , 14 and 3, or having the sequence of SEQ ID NO: 1 , 15 and 3.
  • the single-domain antibody moiety further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to at least one framework region (FR) of a single-domain antibody moiety described herein. It is understood that the method used for determining the FRs of said single-domain antibody moiety is the same as that used for identifying the CDRs.
  • the FRs as identified within the single-domain antibody moiety correspond to:
  • SEQ ID NO: 18 (DVQLVESGGGLVQPGGSLRLSCTAS)
  • SEQ ID NO: 19 IIANSVKGRFTISRDNAKNTVYLQMNSLRPEDTAVYYC
  • the single-domain antibody moiety comprises at least one, preferably at least two, more preferably at least three and most preferably four amino acid sequences having at least 85%, preferably 90%, more preferably 95% sequence identity to the sequences selected from the group consisting of SEQ ID NO: 18, 5, 19 and 7.
  • said single-domain antibody moiety as detailed above four framework regions (FRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, wherein FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 18, FR2 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 5, FR3 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 19, and FR4 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 7.
  • FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 18
  • FR2 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 5
  • FR3 has at least 85%, preferably
  • said single-domain antibody moiety comprises the amino acid sequences corresponding to SEQ ID NO: 8 or 9.
  • the binder of the invention comprises the amino acid sequence of SEQ ID NO: 8.
  • the binder of the invention comprises the amino acid sequence of SEQ ID NO: 9.
  • the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto, wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 14, and a CDR3 of SEQ ID NO: 3.
  • the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 9 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto, wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 15, and a CDR3 of SEQ ID NO: 3.
  • the invention provides a binder, such as an antibody or antigen-binding fragment thereof, that competes for specific binding to hCCR8 with a binder as described herein.
  • a binder such as an antibody or antigen-binding fragment thereof
  • the present invention provides non-blocking hCCR8 binder that competes for specific binding to hCCR8 with a single-domain antibody having the amino acid sequence of SEQ ID NO: 8, 9, or 10. It can easily be determined if a binder competes for specific binding to hCCR8 with a binder as described herein using routine methods known in the art.
  • the binder of the invention is allowed to bind to a hCCR8 protein under saturation conditions. Next, the ability of the test binder is evaluated. If the test binder cannot bind to the hCCR8 protein, it can be concluded that the test antibody competes with the binder of the invention for specific binding to hCCR8.
  • Cytotoxicity refers to the ability of a binder to be toxic to a cell that it is bound to.
  • any type of cytotoxicity can be used in the context of the invention.
  • Cytotoxicity can be direct cytotoxicity, wherein the binder itself directly damages the cell (e.g.
  • the binder induces extracellular mechanisms that cause damage to the cell (e.g. an antibody that induces antibody-dependent cellular activity).
  • the binder of the invention can signal the immune system to destroy or eliminate the cell it is bound to or the binder can carry a cytotoxic payload to destroy the cell it is bound to.
  • the cytotoxic activity is caused by the presence of cytotoxic moiety. Examples of such cytotoxic moieties includes moieties which induce antibody-dependent cellular activity (ADCC), induce antibody-dependent cellular phagocytosis (ADCP), induce complementdependent cytotoxicity (CDC), bind to and activate T-cells, or comprise a cytotoxic payload. Most preferably, said cytotoxic moiety induces antibody-dependent cellular activity (ADCC).
  • Antibody-dependent cellular cytotoxicity refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors recognize binders on a target cell and subsequently cause lysis of the target cell.
  • non-specific cytotoxic cells that express Fc receptors include natural killer cells, neutrophils, monocytes and macrophages.
  • Complement-dependent cytotoxicity refers to the lysis of a target in the presence of complement.
  • the complement activation pathway is initiated by the binding of the first component of the complement system (C1q) to a binder complexed with a cognate antigen.
  • ADCP Antibody-dependent cellular phagocytosis
  • CDC, ADCC and ADCP can be measured using assays that are known in the art (Vafa et al. Methods 2014 Jan 1 ;65(1 ):1 14-26 (2013)).
  • Binding to and activation of T-cells refers to the binding of a T-cell marker that is distinct from hCCR8 and the resulting activation of said T-cell. Activation of the T-cell induces the cytotoxic activity of the T-cell against the cell on which the binder of the invention is bound. Therefore, in a particular embodiment, the binder of the invention binds to hCCR8 and binds to and activates T-cells.
  • the cytotoxic moiety may bind to hCD3.
  • the cytotoxic moiety comprises an antibody or antigen-binding fragment thereof that binds to hCD3.
  • the binder of the invention may bind to hCCR8 and hCD3.
  • the binder of the invention binds to intratumoural Tregs and directs the cytotoxic activity of T-cells to these Tregs, thereby depleting them from the tumour environment.
  • the binder of the invention comprises a moiety that binds to hCCR8 and a moiety that binds to hCD3, wherein at least one moiety is antibody based, particularly wherein both moieties are antibody based. Therefore, in a particular embodiment, the present invention provides a bispecific construct comprising an antibody or antigen-binding fragment thereof that specifically binds to hCCR8 and an antibody or antigen-binding fragment thereof that specifically binds to hCD3.
  • a cytotoxic payload refers to any molecular entity that causes a direct damaging effect on the cell that is contacted with the cytotoxic payload. Cytotoxic payloads are known to the persons skilled in the art. In a particular embodiment, the cytotoxic payload is a chemical entity. Particular examples of such cytotoxic payloads include toxins, chemotherapeutic agents and radioisotopes or radionuclides.
  • the cytotoxic payload comprises an agent selected from the group consisting of alkylating agents, anthracyclines, cytoskeletal disruptors, epothilones, histone deacetylase inhibitors, inhibitors of topoisomerase I, inhibitors of topoisomerase II, kinase inhibitors, nucleotide analogues and precursor analogues, peptide antibiotics, platinum-based agents, retinoids, vinca alkaloids and derivatives, peptide or small molecule toxins, and radioisotopes.
  • Chemical entities can be coupled to proteinaceous inhibitors, e.g. antibodies or antigen-binding fragments, using techniques known in the art. Such coupling can be covalent or non-covalent and the coupling can be labile or reversible.
  • FcyR Fey receptors
  • IgG antibodies The communication of IgG antibodies with the immune system is controlled and mediated by FcyRs, which relay the information sensed and gathered by antibodies to the immune system, providing a link between the innate and adaptive immune systems, and particularly in the context of biotherapeutics (Hayes J et aL, 2016. J Inflamm Res 9: 209-219).
  • IgG subclasses vary in their ability to bind to FcyR and this differential binding determines their ability to elicit a range of functional responses.
  • FcyRllla is the major receptor involved in the activation of antibody-dependent cell-mediated cytotoxicity (ADCC) and lgG3 followed closely by IgG 1 display the highest affinities for this receptor, reflecting their ability to potently induce ADCC.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • lgG2 have been shown to have weaker binding for this receptor binders having the human lgG2 isotype have also been found to efficiently deplete Tregs.
  • the binder of the invention induces antibody effector function, in particular antibody effector function in human.
  • the binder of the invention binds FcyR with high affinity, preferably an activating receptor with high affinity.
  • the binder binds FcyRI and/or FcyRlla and/or FcyRllla with high affinity.
  • the binder binds to FcyRllla.
  • the binder binds to at least one activating Fey receptor with a dissociation constant of less than about 10 -6 M, 10 -7 M, 10 -8 M, 10- 9 M, 10 -1 ° M, 10- 11 M, 10- 12 M or 10- 13 M.
  • the cytotoxic moiety may comprise a fragment crystallisable (Fc) region moiety or it may comprise a binding part, such as an antibody or antigen-binding part thereof that specifically binds to an FcyR.
  • Fc fragment crystallisable
  • the cytotoxic moiety comprises a fragment crystallisable (Fc) region moiety.
  • the Fc region moiety is an IgG Fc domain derived from IgG 1 , lgG2, lgG3 and lgG4 antibody. More preferably, the Fc region moiety is an IgG Fc domain derived from a human lgG1 antibody. More preferably, the Fc region moiety is an IgG Fc domain derived from a short hinge variant of a human lgG1 antibody.
  • the Fc region moiety comprises the amino acid sequence of SEQ ID NO: 30 or an amino acid sequence having at least 80% sequence identity, such as at least 85% sequence identity or 90% sequence identity. In a further embodiment, an amino acid sequence of SEQ ID NO: 30 or an amino acid sequence having at least 95%, 96%, 97% sequence identity, in particular at least 98% sequence identity, more in particular at least 99% sequence identity.
  • the Fc region moiety has been engineered to increase ADCC, CDC and/or ADCP activity.
  • ADCC may be increased by methods that reduce or eliminate the fucose moiety from the Fc moiety glycan and/or through introduction of specific mutations on the Fc region of an immunoglobulin, such as lgG1 (e.g. S298A/E333/K334A, S239D/I332E/A330L or G236A/S239D/A330L/I332E) (Lazar et al. Proc Natl Acad Sci USA 103:2005-2010 (2006); Smith et al. Proc Natl Acad Sci USA 209:6181 -6 (2012)).
  • ADCP may also be increased by the introduction of specific mutations on the Fc portion of human IgG (Richards et al.
  • the binder comprising an Fc region moiety is optimized to elicit an ADCC response, that is to say the ADCC response is enhanced, increased or improved relative to other hCCR8 binders comprising an Fc region moiety, including those that do not inhibit the binding of CCL1 to CCR8 and, for example, unmodified anti-CCR8 monoclonal antibodies.
  • the hCCR8 binder has been engineered to elicit an enhanced ADCC response.
  • the binder comprising an Fc region moiety is optimized to elicit an ADCP response, that is to say the ADCP response is enhanced, increased or improved relative to other hCCR8 binders comprising an Fc region moiety, including those that do not inhibit the binding of hCCL1 to hCCR8 and, for example, unmodified anti-hCCR8 monoclonal antibodies.
  • the cytotoxic moiety comprises a moiety that binds to an Fc gamma receptor. More in particular binds to and activates an FcyR, in particular an activating receptor, such as FcyRI and/or FcyRlla and/or FcyRllla, especially FcyRllla.
  • the moiety that binds to an FcyR may be antibody based or non-antibody based as described herein before. If antibody based, the moiety may bind the FcyR through its variable region.
  • the hCCR8 binder as detailed above comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, as detailed above.
  • the hCCR8 binder is a genetically engineered polypeptide that comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, joined together by a direct bond.
  • the hCCR8 binder is a genetically engineered polypeptide that comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, joined together by a direct bond or a linker.
  • the linker is a peptide linker.
  • the linker is a flexible linker having an amino acid sequence consisting primarily of stretches of Glycine (G) and Serine (S) residues (a so-called “GS” or “GlySer” linker).
  • G G
  • S Serine residues
  • at least 80%, in particular at least 85%, more in particular at least 90% of amino acid residues in the peptide linker are selected from glycine and serine.
  • the peptide linker comprises from 1 to 50 amino acids, such as from 1 to 40, in particular from 1 to 30. In a particular embodiment from 5 to 25 amino acids, preferably from 8 to 22 amino acids, such as from 10 to 20 amino acids.
  • a preferred example of such a GS linker comprises the sequence of GGGGS (SEQ ID NO: 20). In such a linker, the sequence of SEQ ID NO: 20 can be repeated “n” times to optimize the length of the GS linker to achieve appropriate properties of the binder, so that the sequence of the linker will be that of (SEQ ID NO: 20) n . Typically the copy number “n” ranges from 1 to 10, or from 2 to 4.
  • the amino acid sequence of the Fc region moiety and/or the single domain antibody moiety region(s) may be humanized to reduce immunogenicity for humans.
  • the hCCR8 binder of the invention has the formula B- L-C; wherein B refers to a hCCR8 binding moiety as described herein, L refers to a linker as described herein, and C refers to a cytotoxic moiety as described herein.
  • B comprises a single-domain antibody moiety that binds to hCCR8
  • L is either a direct bond or has the sequence (SEQ ID NO: 20) n wherein n is an integer from 1 to 10, and C is an Fc region moiety.
  • the hCCR8 binder of the invention has the formula B-L-C, wherein B is a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, L is a linker corresponding to (SEQ ID NO: 20) n , wherein “n” ranges from 1 to 10, and C is an Fc region moiety.
  • the hCCR8 binder of the invention has the formula B-L-C, wherein B is a singledomain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, L is a linker corresponding to (SEQ ID NO: 20) n , wherein “n” is 2 or 4, and C is an IgG Fc domain derived from a short hinge variant of a human IgG 1 antibody.
  • said hCCR8 binder as detailed above comprises the amino acid sequences corresponding to any of SEQ ID NO: 21 to 26.
  • the hCCR8 binder of the invention has the formula B-C, wherein B is a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, and C is an Fc region moiety.
  • the hCCR8 binder of the invention has the formula B-C, wherein B is a singledomain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10 and C is an IgG Fc domain derived from a short hinge variant of a human IgG 1 antibody.
  • said hCCR8 binder as detailed above comprises the amino acid sequences corresponding to any of SEQ ID NO: 27 to 29.
  • the present invention provides nucleic acid molecules encoding hCCR8 binders as defined herein.
  • such provided nucleic acid molecules may contain codon-optimized nucleic acid sequences.
  • the nucleic acid is included in an expression cassette within appropriate nucleic acid vectors for the expression in a host cell such as, for example, bacterial, yeast, insect, piscine, murine, simian, or human cells.
  • the present invention provides host cells comprising heterologous nucleic acid molecules (e.g. DNA vectors) that express the desired binder.
  • the binder of the invention is administered as a therapeutic nucleic acid.
  • therapeutic nucleic acid refers to any nucleic acid molecule that have a therapeutic effect when introduced into a eukaryotic organism (e.g., a mammal such as human) and includes DNA and RNA molecules encoding the binder of the invention.
  • the nucleic acid may comprise elements that induce transcription and/or translation of the nucleic acid or that increases ex and/or in vivo stability of the nucleic acid.
  • the present invention provides methods of preparing an isolated hCCR8 binder as defined above.
  • such methods may comprise culturing a host cell that comprises nucleic acids (e.g. heterologous nucleic acids that may comprise and/or be delivered to the host cell via vectors).
  • nucleic acids e.g. heterologous nucleic acids that may comprise and/or be delivered to the host cell via vectors.
  • the host cell (and/or the heterologous nucleic acid sequences) is/are arranged and constructed so that the binder is secreted from the host cell and isolated from cell culture supernatants.
  • a hCCR8 binder presenting the features as described herein represents a further object of the invention.
  • the hCCR8 binder can be used as a medicine.
  • the invention provides a method for treating a disease in a subject comprising administering a non-blocking hCCR8 binder having cytotoxic activity, in particular a hCCR8 binder having cytotoxic activity that does not inhibit the binding of hCCL1 to hCCR8 or signalling of hCCL1 via hCCR8.
  • the disease is a cancer, in particular a solid tumour.
  • the subject of the aspects of the invention as described herein is a mammal, preferably a cat, dog, horse, donkey, sheep, pig, goat, cow, hamster, mouse, rat, rabbit, or guinea pig, but most preferably the subject is a human.
  • the subject is preferably a human.
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • cancer cancer
  • tumour refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumours and secondary neoplasms.
  • cancer malignancy
  • neoplasm tumor cells
  • cancer cancer
  • cancer malignancy
  • neoplasm tumor cells
  • cancer cancer
  • carcinoma can also be used interchangeably herein to refer to tumours and tumour cells that exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation.
  • cells of interest for treatment include precancerous (e.g. benign), malignant, pre-metastatic, metastatic, and non-metastatic cells.
  • precancerous e.g. benign
  • malignant pre-metastatic
  • metastatic metastatic
  • non-metastatic cells non-metastatic cells.
  • tumours include but are not limited to, carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, hepatocellular carcinoma (HCC), hodgkin's lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), anaplastic large cell lymphoma (ALCL), cutaneous T-cell lymphoma (CTCL), Adult T-cell leukemia/lymphoma (ATLL), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer,
  • the tumour involves a solid tumour.
  • solid tumours are sarcomas (including cancers arising from transformed cells of mesenchymal origin in tissues such as cancellous bone, cartilage, fat, muscle, vascular, hematopoietic, or fibrous connective tissues), carcinomas (including tumours arising from epithelial cells), mesothelioma, neuroblastoma, retinoblastoma, etc.
  • Tumours involving solid tumours include, without limitations, brain cancer, lung cancer, stomach cancer, duodenal cancer, esophagus cancer, breast cancer, colon and rectal cancer, renal cancer, bladder cancer, kidney cancer, pancreatic cancer, prostate cancer, ovarian cancer, melanoma, mouth cancer, sarcoma, eye cancer, thyroid cancer, urethral cancer, vaginal cancer, neck cancer, lymphoma, and the like.
  • the tumour is selected from the group consisting of breast invasive carcinoma, colon adenocarcinoma, head and neck squamous carcinoma, stomach adenocarcinoma, lung adenocarcinoma (NSCLC), lung squamous cell carcinoma (NSCLC), kidney renal clear cell carcinoma, skin cutaneous melanoma, esophageal cancer, cervical cancer, hepatocellular carcinoma, merkel cell carcinoma, small Cell Lung Cancer (SCLC), classical Hodgkin Lymphoma (cHL), urothelial Carcinoma, Microsatellite Instability-High (MSI- H) Cancer and mismatch repair deficient (dMMR) cancer.
  • the tumour is selected from the group consisting of a breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck squamous cell carcinoma, skin cancer, colorectal cancer, and kidney cancer.
  • the tumour is selected from the group consisting of breast invasive carcinoma, colon adenocarcinoma, head and neck squamous carcinoma, stomach adenocarcinoma, lung adenocarcinoma (NSCLC), lung squamous cell carcinoma (NSCLC), kidney renal clear cell carcinoma, and skin cutaneous melanoma.
  • the cancers involve CCR8 expressing tumours, including but not limited to breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck squamous cell carcinoma, skin cancer, colorectal cancer, and kidney cancer.
  • the tumour is selected from the group consisting of breast cancer, colon adenocarcinoma, and lung carcinoma.
  • the tumour is a T-cell lymphoma, in particular a T-cell lymphoma expressing CCR8 including, but not limited to Adult T-cell leukemia/lymphoma (ATLL), cutaneous T-cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL).
  • TLL Adult T-cell leukemia/lymphoma
  • CCL cutaneous T-cell lymphoma
  • ACL anaplastic large cell lymphoma
  • the tumour is a tumour carrying recurrent chromosomal rearrangements involving the DUSP22-IRF4 locus on 6p25.3 (so-called DUSP22 rearrangements).
  • the tumour is a lymphoma carrying DUSP22 rearrangements.
  • the term “administration” refers to the act of giving a drug, prodrug, antibody, or other agent, or therapeutic treatment to a physiological system (e.g. a subject or in vivo, in vitro, or ex vivo cells, tissues, and organs).
  • a physiological system e.g. a subject or in vivo, in vitro, or ex vivo cells, tissues, and organs.
  • exemplary routes of administration to the human body can be through the mouth (oral), skin (transdermal), oral mucosa (buccal), ear, by injection (e.g. intravenously, subcutaneously, intratumourally, intraperitoneally, etc.) and the like.
  • administration of the binder of the invention includes direct administration of the binder as well as indirect administration by administering a nucleic acid encoding the binder such that the binder is produced from the nucleic acid in the subject.
  • Administration of the binder thus includes DNA and RNA therapy methods that result in in vivo production of the binder.
  • references to “treat” or “treating” a tumour as used herein defines the achievement of at least one therapeutic effect, such as for example, reduced number of tumour cells, reduced tumour size, reduced rate to cancer cell infiltration into peripheral organs, or reduced rate of tumour metastasis or tumour growth.
  • the term “modulate” refers to the activity of a compound to affect (e.g. to promote or treated) an aspect of the cellular function including, but not limited to, cell growth, proliferation, invasion, angiogenesis, apoptosis, and the like.
  • T/C ⁇ 42% is the minimum level of anti-tumour activity.
  • the treatment achieved by a therapeutically effective amount is any of progression free survival (PFS), disease free survival (DFS) or overall survival (OS).
  • PFS also referred to as “Time to Tumour Progression” indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
  • DFS refers to the length of time during and after treatment that the patient remains free of disease.
  • OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients.
  • prevention refers to delaying or preventing the onset of the symptoms of the cancer. Prevention may be absolute (such that no disease occurs) or may be effective only in some individuals or for a limited amount of time.
  • the subject has an established tumour, that is the subject already has a tumour, e.g. that is classified as a solid tumour.
  • the invention as described herein can be used when the subject already has a tumour, such as a solid tumour.
  • the invention provides a therapeutic option that can be used to treat an existing tumour.
  • the subject has an existing solid tumour.
  • the invention may be used as a prevention, or preferably as a treatment in subjects who already have a solid tumour.
  • the invention is not used as a preventative or prophylaxis.
  • tumour regression may be enhanced, tumour growth may be impaired or reduced, and/or survival time may be enhanced using the invention as described herein, for example compared with other cancer treatments (for example standard-of care treatments for the a given cancer).
  • the method of treatment or prevention of a tumour as described herein further comprises the step of identifying a subject who has tumour, preferably identifying a subject who has a solid tumour.
  • the dosage regimen of a therapy described herein that is effective to treat a patient having a tumour may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. Selection of an appropriate dosage will be within the capability of one skilled in the art. For example 0.01 , 0.1 , 0.3, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, or 50 mg/kg. In some embodiments, such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
  • the binder according to any aspect of the invention or the nucleic acid encoding it as described herein may be in the form of a pharmaceutical composition which additionally comprises a pharmaceutically acceptable carrier, diluent or excipient.
  • a pharmaceutically acceptable carrier or “pharmaceutically acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity.
  • Pharmaceutically acceptable carriers enhance or stabilize the composition or can be used to facilitate preparation of the composition.
  • Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, as is known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed.
  • Nonlimiting examples of said pharmaceutically acceptable carrier comprise any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents. Therefore, the present invention further provides the use of a binder of the invention in the manufacture of a medicament for the treatment of a tumour.
  • These compositions include, for example, liquid, semi-solid and solid dosage formulations, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, or liposomes.
  • compositions containing the binder or the nucleic acid of the invention can be administered by any appropriate method known in the art, including, without limitation, oral, mucosal, by-inhalation, topical, buccal, nasal, rectal, or parenteral (e.g. intravenous, infusion, intratumoural, intranodal, subcutaneous, intraperitoneal, intramuscular, intradermal, transdermal, or other kinds of administration involving physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue).
  • parenteral e.g. intravenous, infusion, intratumoural, intranodal, subcutaneous, intraperitoneal, intramuscular, intradermal, transdermal, or other kinds of administration involving physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue.
  • Such a formulation may, for example, be in a form of an injectable or infusible solution that is suitable for intradermal, intratumoural or subcutaneous administration, or for intravenous infusion.
  • the binder or nucleic acid is administered intravenously.
  • the administration may involve intermittent dosing.
  • administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time, simultaneously or between the administration of other compounds.
  • Formulations of the invention generally comprise therapeutically effective amounts of a binder of the invention.
  • “Therapeutic levels”, “therapeutically effective amount” or “therapeutic amount” means an amount or a concentration of an active agent that has been administered that is appropriate to safely treat the condition to reduce or prevent a symptom of the condition.
  • the binder can be prepared with carriers that protect it against rapid release and/or degradation, such as a controlled release formulation, such as implants, transdermal patches, and microencapsulated delivery systems.
  • a controlled release formulation such as implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • dose amount may impact route of delivery.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • dose amount may impact route of delivery.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • required dose amount may impact route of delivery.
  • route of delivery e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc
  • focused delivery e.g., in this example, intratumoural delivery
  • compositions typically should be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
  • Sterile injectable solutions can be prepared by incorporating the binder in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations as discussed herein.
  • Sterile injectable formulations may be prepared using a non-toxic parenterally acceptable diluent or solvent.
  • Each pharmaceutical composition for use in accordance with the present invention may include pharmaceutically acceptable dispersing agents, wetting agents, suspending agents, isotonic agents, coatings, antibacterial and antifungal agents, carriers, excipients, salts, or stabilizers are non-toxic to the subjects at the dosages and concentrations employed.
  • such a composition can further comprise a pharmaceutically acceptable carrier or excipient for use in the treatment of cancer that that is compatible with a given method and/or site of administration, for instance for parenteral (e.g. sub-cutaneous, intradermal, or intravenous injection), intratumoural, or peritumoural administration.
  • parenteral e.g. sub-cutaneous, intradermal, or intravenous injection
  • intratumoural e.g. sub-cutaneous, intradermal, or intravenous injection
  • peritumoural administration e.g. sub-cutaneous, intradermal, or intravenous injection
  • While an embodiment of the treatment method or compositions for use according to the present invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a using pharmaceutical compositions and dosing regimens that are consistently with good medical practice and statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the X 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra test and the Wilcoxon-test.
  • any statistical test known in the art such as the Student's t-test, the X 2 -test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra test and the Wilcoxon-test.
  • tumour a tumour disease, a carcinoma or a cancer
  • metastasis in the original organ or tissue and/or in any other location are implied alternatively or in addition, whatever the location of the tumour and/or metastasis is.
  • the present invention relates to depleting regulatory T cells (T regs).
  • T regs regulatory T cells
  • treatment with the non-blocking CCR8 binder having cytotoxic activity depletes or reduces regulatory T cells, especially tumour-infiltrating regulatory T cells.
  • the depletion is via ADCC.
  • the depletion is via CDC.
  • the depletion is via ADCP.
  • the invention provides a method for depleting regulatory T cells in a tumour in a subject, comprising administering to said subject a non-blocking CCR8 binder having cytotoxic activity.
  • Tregs are depleted in a solid tumour.
  • depleted it is meant that the number, ratio or percentage of Tregs is decreased relative to when the nonblocking CCR8 binder having cytotoxic activity, is not administered.
  • over about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 99% of the tumour-infiltrating regulatory T cells are depleted.
  • Treg regulatory T cells
  • Treg cells refer to a lineage of CD4+ T lymphocytes specialized in controlling autoimmunity, allergy and infection. Typically, they regulate the activities of T cell populations, but they can also influence certain innate immune system cell types. Tregs are usually identified by the expression of the biomarkers CD3, CD4, CD25, and CD127 or Foxp3. Naturally occurring T reg cells normally constitute about 5-10% of the peripheral CD4+ T lymphocytes. However, within a tumour microenvironment (i.e. tumourinfiltrating Treg cells), they can make up as much as 20-30% of the total CD4+ T lymphocyte population.
  • Treg cells may directly kill target cells such as effector T cells and APCs through perforin- or granzyme B-dependent pathways; cytotoxic T-lymphocyte-associated antigen 4 (CTLA4+) Treg cells induce indoleamine 2,3-dioxygenase (IDO) expression by APCs, and these in turn suppress T-cell activation by reducing tryptophan; Treg cells, may release interleukin-10 (IL-10) and transforming growth factor (TGFP) in vivo, and thus directly inhibit T-cell activation and suppress APC function by inhibiting expression of MHC molecules, CD80, CD86 and IL-12.
  • CTL4+ cytotoxic T-lymphocyte-associated antigen 4
  • IDO indoleamine 2,3-dioxygenase
  • Treg cells may release interleukin-10 (IL-10) and transforming growth factor (TGFP) in vivo, and thus directly inhibit T-cell activation and suppress APC function by inhibiting expression of MHC molecules, CD80
  • Treg cells can also suppress immunity by expressing high levels of CTLA4 which can bind to CD80 and CD86 on antigen presenting cells and prevent proper activation of effector T cells. It is furthermore known that Treg cells express high levels of CD25, thereby competing with IL2 binding to CD8 and reducing CD8-induced proliferation and survival.
  • the ratio of effector T cells to regulatory T cells in a solid tumour is increased after administration of the binder of the invention. In some embodiments, the ratio of effector T cells to regulatory T cells in a solid tumour is increased to over 5, 10, 15, 20, 40 or 80.
  • An immune effector cell refers to an immune cell which is involved in the effector phase of an immune response.
  • exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g., B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils.
  • lymphocytes e.g., B cells and T cells including cytolytic T cells (CTLs)
  • CTLs cytolytic T cells
  • Immune effector cells involved in the effector phase of an immune response express specific Fc receptors and carry out specific immune functions.
  • An effector cell can induce antibodydependent cell-mediated cytotoxicity (ADCC), e.g., a neutrophil capable of inducing ADCC.
  • ADCC antibodydependent cell-mediated cytotoxicity
  • monocytes, macrophages, neutrophils, eosinophils, and lymphocytes which express FcaR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens.
  • An effector cell can also phagocytose a target antigen, target cell, or microorganism.
  • antibodies according to the present invention may be optimised for ability to induce ADCC.
  • the methods and compositions for depleting Tregs are specific for Tregs with limited to no impact on other T cells.
  • the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than other Tregs.
  • the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than circulating Tregs.
  • the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than normal tissue-infiltrating Tregs, such as intestinal Tregs. Comparing the extent of depletion of cell populations is preferably performed by comparing the percentage decrease of the cell population without and with treatment, such as shown in the examples.
  • the methods and compositions of the invention decrease the ratio of Tregs over T-cells, in particular the ratio of Tregs over T-cells in a tumour. In a further embodiment, the methods and compositions of the invention decrease the ratio of T regs over T-cells in the tumour to a greater extent than the ratio of Tregs over T-cells outside of the tumour. In another embodiment, the methods and compositions of the invention decrease the ratio of Tregs over T-cells in the tumour to a greater extent than the ratio of Tregs over T-cells in normal tissue, in particular in intestinal tissue.
  • treatment with the hCCR8 binder having cytotoxic activity or the nucleic acid encoding the same as described herein depletes or reduces any type of cells expressing hCCR8.
  • the cells are tumour cells expressing hCCR8. Therefore, the invention provides a method for depleting cells, preferably tumour cells, in a subject, comprising administering to said subject a hCCR8 binder having cytotoxic activity or the nucleic acid encoding the same as described herein.
  • a different agent against cancer may be administered in combination with the binder of the invention via the same or different routes of delivery and/or according to different schedules.
  • one or more doses of a first active agent is administered substantially simultaneously with, and in some embodiments via a common route and/or as part of a single composition with, one or more other active agents.
  • combination therapies provided in accordance with the present invention achieve synergistic effects; in some such embodiments, dose of one or more agents utilized in the combination may be materially different (e.g., lower) and/or may be delivered by an alternative route, than is standard, preferred, or necessary when that agent is utilized in a different therapeutic regimen (e.g., as monotherapy and/or as part of a different combination therapy).
  • dose of one or more agents utilized in the combination may be materially different (e.g., lower) and/or may be delivered by an alternative route, than is standard, preferred, or necessary when that agent is utilized in a different therapeutic regimen (e.g., as monotherapy and/or as part of a different combination therapy).
  • agents can be administered simultaneously or sequentially.
  • administration of one agent is specifically timed relative to administration of another agent.
  • a first agent is administered so that a particular effect is observed (or expected to be observed, for example based on population studies showing a correlation between a given dosing regimen and the particular effect of interest).
  • desired relative dosing regimens for agents administered in combination may be assessed or determined empirically, for example using ex vivo, in vivo and/or in vitro models; in some embodiments, such assessment or empirical determination is made in vivo, in a patient population (e.g., so that a correlation is established), or alternatively in a particular patient of interest.
  • a non-blocking hCCR8 binder has improved therapeutic effects when combined with an immune checkpoint inhibitor.
  • a combination therapy with a nonblocking hCCR8 binder and an immune checkpoint inhibitor can have synergistic effects in the treatment of established tumours. As such, the interaction between the PD-1 receptor and the PD-L1 ligand may be blocked, resulting in “PD-1 blockade”.
  • the combination may lead to enhanced tumour regression, enhanced impairment or reduction of tumour growth, and/or survival time may be enhanced using the invention as described herein, for example compared with administration of the checkpoint inhibitor alone. Therefore, in a particular aspect of the invention, the present invention provides a hCCR8 binder of the invention for use in the treatment of a tumour, wherein the treatment further comprises administration of an immune checkpoint inhibitor.
  • immune checkpoint or “immune checkpoint protein” refer to proteins belonging to inhibitory pathways in the immune system, in particular for the modulation of T- cell responses. Under normal physiological conditions, immune checkpoints are crucial to preventing autoimmunity, especially during a response to a pathogen. Cancer cells can alter the regulation of the expression of immune checkpoint proteins in order to avoid immune surveillance.
  • immune checkpoint proteins include but are not limited to PD-1 , CTLA-4, BTLA, KIR, CD155, B7H4, VISTA and TIM3, and also 0X40, GITR, 4-1 BB and HVEM.
  • Immune checkpoint proteins may also refer to proteins which bind to other immune checkpoint proteins. Such proteins include PD-L1 , PD-L2, CD80, CD86, HVEM, LLT1 , and GAL9.
  • Immuno checkpoint protein inhibitor refers to any molecule that can interfere with the signalling and/or protein-protein interactions mediated by an immune checkpoint protein.
  • the immune checkpoint protein is PD-1 or PD-L1 .
  • the immune checkpoint inhibitor interferes with PD-1/PD-L1 interactions via anti-PD-1 or anti PD-L1 antibodies.
  • the immune checkpoint is CTLA-4 (also known as CTLA4, cytotoxic T-lymphocyte-associated protein 4 or CD152) and the immune checkpoint inhibitor is an inhibitor of CTLA-4.
  • the binder of the invention is used in the treatment of a tumour, wherein the treatment further comprises administration of a CTLA-4 inhibitor, in particular an anti-CTLA-4 antibody, particularly a blocking anti-CTLA-4 antibody.
  • Anti-CTLA-4 antibodies of the instant invention can bind to an epitope on human CTLA-4 so as to inhibit CTLA-4 from interacting with a human B7 counter-receptor.
  • Anti-CTLA-4 antibodies are described in U.S. Pat. Nos. 5,811 ,097; 5,855,887; 6,051 ,227; in PCT Application Publication Nos. WO 01/14424 and WO 00/37504; and in U.S. Patent Publication No. 2002/0039581. Each of these references is specifically incorporated herein by reference for purposes of description of anti-CTLA-4 antibodies.
  • An exemplary clinical anti-CTLA-4 antibody is human monoclonal antibody 10D1 as disclosed in WO 01/14424 and U.S. patent application Ser. No. 09/644,668.
  • Antibody 10D1 has been administered in single and multiple doses, alone or in combination with a vaccine, chemotherapy, or interleukin-2 to more than 500 patients diagnosed with metastatic melanoma, prostate cancer, lymphoma, renal cell cancer, breast cancer, ovarian cancer, and HIV.
  • Other anti-CTLA-4 antibodies encompassed by the methods of the present invention include, for example, those disclosed in: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al. (1998) Proc. Natl. Acad.
  • the methods of the instant invention comprise use of an anti-CTLA-4 antibody that is a human sequence antibody, preferably a monoclonal antibody and in another embodiment is monoclonal antibody 10D1.
  • the CTLA-4 inhibitor is ipilimumab or tremelimumab.
  • PD-1 Programmed cell Death protein 1
  • CD279 is a cell surface receptor expressed on activated T cells and B cells. Interaction with its ligands has been shown to attenuate T-cell responses both in vitro and in vivo.
  • PD-1 binds two ligands, PD-L1 and PD- L2.
  • PD-1 belongs to the immunoglobulin superfamily. PD-1 signaling requires binding to a PD- 1 ligand in close proximity to a peptide antigen presented by major histocompatibility complex (MHC) (Freeman, Proc Natl Acad Sci USA 105, 10275-6 (2008)). Therefore, proteins, antibodies or small molecules that prevent co-ligation of PD-1 and TCR on the T cell membrane are useful PD-1 antagonists.
  • MHC major histocompatibility complex
  • the PD-1 receptor antagonist is an anti-PD-1 antibody, or an antigen binding fragment thereof, which specifically binds to PD-1 and blocks the binding of PD-L1 to PD-1 .
  • the anti-PD-1 antibody may be a monoclonal antibody.
  • the anti-PD-1 antibody may be a human or humanised antibody.
  • An anti-PD-1 antibody is an antibody capable of specific binding to the PD-1 receptor.
  • Anti-PD-1 antibodies known in the art and suitable for the invention include nivolumab, pembrolizumab, pidilizumab, BMS-936559, and toripalimab.
  • PD-1 antagonists of the present invention also include compounds or agents that either bind to and/or block a ligand of PD-1 to interfere with or inhibit the binding of the ligand to the PD-1 receptor, or bind directly to and block the PD-1 receptor without inducing inhibitory signal transduction through the PD-1 receptor.
  • PD-1 antagonists include small molecules inhibitors of the PD-1/PD-L1 signalling pathway.
  • the PD-1 receptor antagonist can bind directly to the PD-1 receptor without triggering inhibitory signal transduction and also binds to a ligand of the PD-1 receptor to reduce or inhibit the ligand from triggering signal transduction through the PD-1 receptor.
  • the PD-1 receptor antagonist is an anti-PD-L1 antibody, or an antigen binding fragment thereof, which specifically binds to PD-L1 and blocks the binding of PD-L1 to PD-1.
  • the anti-PD-L1 antibody may be a monoclonal antibody.
  • the anti-PD-L1 antibody may be a human or humanized antibody, such as atezolizumab (MPDL3280A) or avelumab. Any aspect of the invention as described herein may be performed in combination with additional therapeutic agents, in particular additional cancer therapies.
  • the hCCR8 binder and, optionally, the immune checkpoint inhibitor according to the present invention may be administered in combination with co-stimulatory antibodies, chemotherapy and/or radiotherapy (by applying irradiation externally to the body or by administering radioconjugated compounds), cytokine-based therapy, targeted therapy, monoclonal antibody therapy, or any combination thereof.
  • a chemotherapeutic entity for combination therapy refers to an entity which is destructive to a cell, that is the entity reduces the viability of the cell.
  • the chemotherapeutic entity may be a cytotoxic drug.
  • a chemotherapeutic agent contemplated includes, without limitation, alkylating agents, anthracyclines, epothilones, nitrosoureas, ethylenimines/methylmelamine, alkyl sulfonates, alkylating agents, antimetabolites, pyrimidine analogs, epipodophylotoxins, enzymes such as L-asparaginase; biological response modifiers such asIFN-y, IL-2, IL-12, and G-CSF; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin, anthracenediones, substituted urea such as hydroxyurea, methylhydrazine derivatives including N-methylhydrazine (MIH) and procarba
  • the additional cancer therapy may be other antibodies or small molecule reagents that reduce immune regulation in the periphery and within the tumour microenvironment, for example molecules that target TGFbeta pathways, IDO (indoleamine deoxigenase), Arginase, and/or CSF1 R.
  • TGFbeta pathways for example molecules that target TGFbeta pathways, IDO (indoleamine deoxigenase), Arginase, and/or CSF1 R.
  • ‘In combination’ or treatments comprising administration of a further therapeutic may refer to administration of the additional therapy before, at the same time as or after administration of any aspect according to the present invention. Combination treatments can thus be administered simultaneous, separate or sequential.
  • the invention provides a kit comprising any of the binders as described above.
  • the kit further contains a pharmaceutically acceptable carrier or excipient.
  • any of the components of the above combinations in the kit are present in a unit dose, in particular the dosages as described herein.
  • the kit includes instructions for use in administering any of the components or the above combinations to a subject.
  • the kit comprises a hCCR8 binder as described herein and an immune checkpoint inhibitor, such as a PD-1 or PD-L1 inhibitor.
  • the hCCR8 binder and the immune checkpoint inhibitor can be present in the same or in a different composition.
  • the present invention provides a package comprising a binder as described herein, wherein the package further comprises a leaflet with instructions to administer the binder to a tumour patient that also receives treatment with an immune checkpoint inhibitor.
  • the hCCR8 binder as described herein can further be used for predicting, diagnosing, prognosticating and/or monitoring diseases or conditions in subjects.
  • the invention provides a method for monitoring a cellular population expressing hCCR8 comprising contacting the cellular population with a hCCR8 binder that does not inhibit the binding of hCCL1 to hCCR8 or signalling of hCCL1 via hCCR8, as disclosed herein.
  • the invention provides the use of a non-blocking hCCR8 binder as described herein as a companion diagnostic in a method for treating a disease in a subject comprising administering an hCCL1 to said subject.
  • diagnosis generally refer to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).
  • diagnosis of a disease in a subject may particularly mean that the subject has said disease, hence, is diagnosed as having said disease.
  • a subject may be diagnosed as taught herein as not having said disease despite displaying one or more conventional symptoms or signs pronounced thereof.
  • prognosticating generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery.
  • a good prognosis of a disease may generally encompass anticipation of a satisfactory partial or complete recovery from said disease, preferably within an acceptable time period.
  • a good prognosis of said disease may more commonly encompass anticipation of not further worsening or aggravating of the conditions, preferably within a given time period.
  • a poor prognosis of a disease may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of said disease.
  • the present invention concerns a non-blocking hCCR8 binder according to the invention for use in a method for diagnosing, predicating and/or prognosticating diseases associated with variations in the expression and/or activity of human CCR8.
  • the invention provides an (in vitro) method for diagnosing predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CCR8 in a subject, wherein the method comprises measuring the quantity of CCR8 in a sample from the subject.
  • the present invention concerns a non-blocking hCCR8 binder according to the invention for use in a method for diagnosing, predicating and/or prognosticating diseases associated with variations in the expression and/or activity of human CCL1 .
  • the invention provides an (in vitro) method for diagnosing predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CLL1 in a subject, wherein the method comprises measuring the quantity of CCR8 in a sample from the subject.
  • the invention concerns a kit for diagnosing, predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CCR8 and/or CCL1 comprising means for measuring the quantity of hCCR8 by using the nonblocking hCCR8 binder as described herein.
  • said kit comprises a reference control obtained from a subject not suffering from said disease or having a known diagnosis, prediction and/or prognosis of said disease.
  • the hCCR8 binder as described above may be advantageously immobilised on a solid phase or support.
  • Said kit can also comprise a known quantity or concentration of hCCR8 and/or a fragment thereof, e.g. for use as controls, standards and/or calibrators. It can also comprise means for collecting the sample from the subject.
  • binders of the invention are suitable for diagnostic in vivo use.
  • the binders of the invention can be administered to a subject without influencing therapeutic treatment.
  • the singledomain antibody moieties described herein such as the VHH molecules specified herein before and in the examples, can be administered e.g. for imaging purposes while the patient undergoes treatment, such as with an anti-cancer drug, such as Treg depletion therapy.
  • the non-blocking and non-cytotoxic binders can be used for imaging purposes, e.g. to monitor efficacious CCR8-expressing Treg depletion.
  • the present invention provides a CCR8 binder comprising a CCR8 binding moiety as described herein and a detectable label.
  • the detectable label may be detectable using e.g. radioactive, optical, magnetic resonance, and ultrasound approaches.
  • the detectable label is a fluorescent label.
  • the CCR8 binder of the invention preferably lacking a cytotoxic moiety, is used for monitoring therapy with a noncompeting CCR8 binder.
  • the CCR8 binder of the invention preferably lacking a cytotoxic moiety, is used for monitoring therapy with an anti-CCR8 antibody that is a blocking binder of hCCR8.
  • the anti-CCR8 antibody that is a blocking binder of hCCR8 is one of the antibodies disclosed in WO2020138489 A1 , more in particular an anti- CCR8 antibody comprising a light chain variable region comprising SEQ ID NO:59 and heavy chain variable region comprising SEQ ID NO: 41 of WQ2020138489 A1.
  • comprising the light chain constant region comprises SEQ ID NO: 52 and the heavy chain constant region comprises SEQ ID NO: 53 of WQ2020138489 A1 .
  • Phage display libraries derived from peripheral blood mononuclear cells were prepared and used as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media).
  • the VHH fragments were inserted into a M13 phagemid vector containing MYC and His6 tags.
  • the libraries were rescued by infecting exponentially-growing Escherichia coli TG [(F’ traD36 proAB lacIqZ AM15) supE thi-1 A(lac- proAB) A(mcrB-hsdSM)5(rK- mK-)] cells followed by surinfection with VCSM13 helper phage.
  • Phage display libraries were subjected to two consecutive selection rounds on HEK293T cells transiently transfected with mouse CCR8 inserted into pVAX1 followed by CHO-K1 cells transiently transfected with mouse CCR8 inserted into pVAX1 .
  • Polyclonal phagemid DNA was prepared from E. coli TG1 cells infected with the eluted phages from the second selection rounds.
  • the VHH fragments were amplified by means of PCR from these samples and subcloned into an E. coli expression vector, in frame with N-terminal PelB signal peptide and C-terminal FLAG3 and His6 tags. Electrocompetent E.
  • VHH-expression plasmid ligation mixture were transformed with the resulting VHH-expression plasmid ligation mixture and individual colonies were grown in 96-deep-well plates.
  • Monoclonal VHHs were expressed essentially as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
  • the crude periplasmic extracts containing the VHHs were prepared by freezing the bacterial pellets overnight followed by resuspension in PBS and centrifugation to remove cellular debris. Screening for mCCR8 selection outputs
  • Recombinant cells expressing mCCR8 were recovered using cell dissociated non-enzymatic solution (Sigma Aldrich, C5914-100mL) and resuspended to a final concentration of 1.0 x 10 6 cells/ml in FACS buffer. Dilutions (1 :5 in FACS buffer) of crude periplasmic extracts containing VHHs were incubated with mouse anti-FLAG biotinylated antibody (Sigma Aldrich, F9291 - 1 MG) at 5 ng/ml in FACS buffer for 30 min with shaking at room temperature. Cell suspensions were distributed into 96-well v-bottom plates and incubated with the VHH/antibody mixture with one hour with shaking on ice.
  • VHH clones resulting from the mouse CCR8 immunization and selection campaign were screened by means of flow cytometry for binding to HEK293 cells previously transfected with mCCR8 or with N-terminal deletion mouse CCR8 (delta16-3XHA) plasmid DNA, in comparison to mock-transfected control cells.
  • Comparison of the binding (median fluorescent intensity) signal of a given VHH clone across the three cell lines enabled classification of said clone as an N-terminal mouse CCR8 binder (i.e. binding on mCCR8 cells, but not on mouse CCR8 (delta16-3XHA) or control cells) or as an extracellular loop mCCR8 binder (i.e. binding on mCCR8 cells and on mouse CCR8 (delta16-3XHA), but not on control cells).
  • Synthetic DNA fragments encoding mCCR8-binding VHHs were subcloned into an E. coli expression vector under control of an IPTG-inducible lac promoter, infra me with N-terminal PelB signal peptide for periplasmic compartment-targeting and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG1 cells were transformed and the resulting clones were sequenced. VHH proteins were purified from these clones by IMAC chromatography followed by desalting, essentially as described in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
  • VHH-01 and VHH-06 Two purified VHHs (VHH-01 and VHH-06, herein after) obtained from the mouse CCR8 immunization campaign were selected and evaluated by flow cytometry for their binding to mCCR8 as compared with N-terminal deletion mCCR8.
  • the results of this assessment are summarized in Figure 1 .
  • VHH-01 binds to both full-length and N-terminal deletion mouse CCR8 whereas VHH-06 only binds to full-length mouse CCR8.
  • Example 4 Binding and functional characterization for monovalent VHHs cAMP Homogenous Time Resolved Fluorescence (HTRF) assay
  • the two selected monovalent VHHs (VHH-01 and VHH-06) were evaluated for their potential to functionally inhibit mouse CCL1 signalling on CHO-K1 cells displaying mouse CCR8 in cAMP accumulation experiments.
  • CHO-K1 cells stably expressing recombinant mouse CCR8 were grown prior to the test in media without antibiotic and detached by flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended in KHR buffer (5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Gluclose, 1.25 mM KH 2 PO 4 , 1.45 mM CaCI 2 , 0.5 g/l BSA, supplemented with 1 mM IBMX). Twelve microliters of cells were mixed with six microliters of VHH (final concentration: 1 pM) in triplicate and incubated for 30 minutes.
  • PBS-EDTA 5 mM EDTA
  • KHR buffer 5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Gluclose, 1.25
  • VHH-01 inhibited CCL1 action on cAMP levels, whereas VHH-06 did not alter cAMP levels over the control (PBS).
  • PBS control
  • VHH-01 to functionally inhibit mouse CCL1 signalling on CHO-K1 cells displaying mCCR8 was further evaluated in Ca 2+ release experiments.
  • Recombinant cells (CHO-K1 mt-aequorin stably expressing mouse CCR8) were grown 18 hours in media without antibiotics and detached gently by flushing with PBSEDTA (5 mM EDTA), recovered by centrifugation and resuspended in assay buffer (DMEM/HAM’s F12 with HEPES + 0.1% BSA protease free). Cells were then incubated at room temperature for at least 4 hours with Coelenterazine h (Molecular Probes).
  • VHH-01 indeed led to a strong inhibition of Ca 2+ release by 94%, confirming that VHH-01 is a blocking binder of mouse CCR8.
  • Example 5 Synthesis and purification of blocking and non-blocking VHH-Fc fusions
  • VHH-Fc-14 and VHH-Fc-25 were generated by combining anti-CCR8 VHHs to the mouse lgG2a Fc domain, separated by flexible GlySer linkers (10GS, which refers to two repeats of SEQ ID NO: 20 and, thus, having 10 amino acids in length).
  • Construct VHH-Fc-25 contains two VHH-06 binders
  • VHH-Fc-14 contains two VHH- 01 binders in addition to two VHH-06 binders.
  • a schematic representation of the VHH-Fc-14 and VHH-Fc-25 constructs is provided in Figure 2.
  • VHH-Fc-25 is a non-blocking CCR8 binder with cytotoxic activity (ADCC) derived from the Fc domain.
  • VHH-Fc-14 is identical to VHH-Fc-25, except for the additional blocking CCR8 domains.
  • constructs were cloned in a pcDNA3.4 mammalian expression vector, in frame with the mouse Ig heavy chain V region 102 signal peptide to direct the expressed recombinant proteins to the extracellular environment.
  • DNA synthesis and cloning, cell transfection, protein production in Expi293F cells and protein A purification were done by Genscript (GenScript Biotech B.V., Leiden, Netherlands).
  • the multivalent VHH-Fc fusions VHH-Fc-14 and VHH-Fc-25 were evaluated for their ability to bind to mouse CCR8 endogenously expressed on BW5147 cells by means of flow cytometry experiments.
  • Cells were incubated with different concentrations of the multivalent VHH-Fc fusions for 30 minutes at 4°C, followed by two washes with FACS buffer, followed by 30 minutes incubation at 4°C with AF488 goat anti-mouse IgG (Life Technologies, A1 1029) or AF488 donkey anti-rat IgG (Life Technologies, A21208), followed by two washing steps. Dead cells were stained using TOPRO3 (Thermo Fisher Scientific, T3605).
  • VHH-Fc-14 and VHH-Fc-25 fusions were compared in an apoptosis assay for their ability to functionally inhibit the action of the agonistic ligand mCCL1 .
  • Dexamethasone induces cell death in mouse lymphoma BW5147 cells that endogenously express CCR8.
  • the dexamethasone-induced cell death can be reversed by addition of the antagonist ligand CCL1 (Van Snick et aL, 1996, Journal of immunology, 157, 2570-2576; Louahed et aL, 2003, European Journal of Immunology, 33, 494-501 ; Spinetti et aL, 2003, Journal of Leukocyte Biology, 73, 201 -207; Denis et aL, 2012, PLOS One, 7, e34199).
  • CCL1 antagonist ligand CCL1
  • VHH-Fc fusion VHH-Fc-25 carrying two copies of building block VHH-06, does not impart functional inhibition.
  • VHH-Fc-14 was tested in the cAMP assay as described in example 4.
  • VHH-Fc-14 provides for a 100% inhibition of the cAMP signal at a concentration of 50 nM and higher, with a plC50 value of 8.54 M, again confirming that it is a blocking CCR8 binder. Blocking VHH-Fc fusions affect intestinal Treg levels
  • VHH-Fc-14 was modified to obtain VHH-Fc fusions with increased and abolished ADCC activity.
  • Increased ADCC activity was obtained through a-fucosylation of VHH-Fc-14 (VHH-Fc-43).
  • ADCC activity was abolished in VHH-Fc-14 through insertion of the LALAPG Fc mutations (VHH-Fc-41 ) (Lo et aL, 2017, Journal of Biological Chemistry, 292, 3900-3908).
  • Constructs were cloned in mammalian expression vector pQMCF vector in frame with a secretory signal peptide and transfected to CHOEBNALT85 1 E9 cells, followed by expression, protein A and gel filtration chromatography (Icosagen Cell Factory, Tartu, Estonia). Versions with a-fucosylated N-glycans in the CH2 domain of the Fc moiety were obtained from expressions in a CHOEBNALT85 cell line that carries GlymaxX technology (ProBioGen AG, Berlin, Germany) (Icosagen Cell Factory, Tartu, Estonia). Proteins were 0.22 mm sterile filtrated.
  • mice were sacrificed and tumour, blood and intestines were harvested from each mouse.
  • Tumour single cell suspensions were obtained by cutting the tissues in small pieces, followed by treatment with 10 U ml-1 collagenase I, 400 U ml-1 collagenase IV and 30 U ml-1 DNasel (Worthington) for 25 minutes at 37°C. The tissues were subsequently squashed and filtered (70pm). The obtained cell suspensions were removed of red blood cells using erythrocyte lysis buffer (155mM NH4CI, 10mM KHCO3, 500mM EDTA), followed by neutralization with RPML Blood was depleted of red blood cells through repeated rounds of incubation for 5 minutes in erythrocyte lysis buffer until only leukocytes remained. Intestinal single cell suspensions were prepared as previously described (C. C.
  • Tregs are depleted in the tumour by VHH-Fc-43, which is a mCCR8 blocking Fc fusion with ADCC activity, while no intratumoural Treg depletion is observed for VHH-Fc-41 , which lacks ADCC activity.
  • No depletion of circulating Tregs was observed for either construct (Fig. 5).
  • Reduced Treg levels were observed in the intestines with both VHH-Fc molecules (with ADCC and without ADCC- functionality), showing that this observed reduction in Treg levels in the intestines is due to functionally blocking mCCR8 rather than cytotoxic effects of the mCCR8 binder (Fig. 6). This indicates that a non-blocking mCCR8 binder with cytotoxic activity is preferred and avoids side effects on Treg populations outside of the tumour environment.
  • Example 9 Effects of cytotoxic non-blocking mCCR8 binders on tumour growth in syngeneic LLC-OVA mouse model
  • Tumour size in mm 3 , was calculated using the following formula:
  • mice MC38 model was used.
  • Tumours were calipered in two dimensions to monitor growth. Tumour size, in mm 3 , was calculated using the following formula:
  • the median tumour size (in mm 3 ) for all the different cohorts is described in Fig. 8.
  • the cohorts treated with a VHH-Fc-14 and VHH-Fc-25 showed from day 18 a significantly lower tumour size in comparison with the isotype control, leading to tumour stasis or regression in a part of the mice treated with the mCCR8 binders with ADCC activity.
  • the sequence of ONCC8 was obtained by cloning the sequences of a light chain variable region and a heavy chain variable region from W02020/0138489 A1 (corresponding respectively to SEQ ID NO: 59 and SEQ ID NO: 41 of W02020/0138489 A1 ) into a human IgG 1 backbone
  • the sequence of ONCC10 was obtained by cloning the heavy chain and light chain variable region sequences from mAb 433H of W02007/044756 A1 into a human lgG1 backbone.
  • Human L263G8 is a commercial mouse anti-hCCR8/CD198 lgG2a monoclonal antibody which was obtained from Biolegend (Biolegend, clone N° L263G8, 360603). Generation of hCCR8-targeting single-domain antibody moieties hCCR8 DNA Immunization
  • Phage display libraries derived from peripheral blood mononuclear cells were prepared and used as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media).
  • the VHH fragments were inserted into a M13 phagemid vector containing MYC and His6 tags.
  • the libraries were rescued by infecting exponentially-growing Escherichia coli TG [(F’ traD36 proAB lacIqZ AM15) supE thi-1 A(lac- proAB) A(mcrB-hsdSM)5(rK- mK-)] cells followed by surinfection with VCSM13 helper phage.
  • Phage display libraries were subjected to two consecutive selection rounds on HEK293T cells transiently transfected with human CCR8 inserted into pcDNA3.1 (ThermoFisher Scientific Inc., V79020) followed by CHO-K1 cells transiently transfected with human CCR8 inserted into pcDNA3.1.
  • Polyclonal phagemid DNA was prepared from E. coli TG cells infected with the eluted phages from the second selection rounds.
  • the VHH fragments were amplified by means of PCR from these samples and subcloned into an E. coli expression vector, in frame with N- terminal PelB signal peptide and C-terminal FLAG3 and His6 tags. Electrocompetent E.
  • VHH-expression plasmid ligation mixture were transformed with the resulting VHH-expression plasmid ligation mixture and individual colonies were grown in 96-deep-well plates.
  • Monoclonal VHHs were expressed essentially as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
  • the crude periplasmic extracts containing the VHHs were prepared by freezing the bacterial pellets overnight followed by resuspension in PBS and centrifugation to remove cellular debris.
  • HEK293 Culturing of human embryonic kidney cell line HEK293 (ATTC N° CRL-1573) was performed at 37°C and 5% CO2 in Dulbecco’s Modified Eagle Medium (DMDM, Gibco) supplemented with 10% heat-inactivated fetal bovine serum (FBS) and 100 U/ml penicillin and streptomycin (Gibco). Before transfection, cells were seeded at a density of 7.5 x 10 5 cells/well of 6-well plates (Greiner) and cultured overnight. Upon reaching an approximate confluence of 40%, cells were transfected with linearized pcDNA3.1 encoding human CCR8 using FUGENE HD transection reagent (Promega).
  • DMDM Modified Eagle Medium
  • FBS heat-inactivated fetal bovine serum
  • Gibco penicillin and streptomycin
  • hCCR8-expressing monoclonal lines were based on acquiring 10 4 cells in flow cytometry (Attune NxT, ThermoFisher Scientific Inc.) using a phycoerythrin-labelled mouse anti-hCCR8/CD198 lgG2a (Biolegend, clone N° L263G8, 360603).
  • Recombinant cells expressing hCCR8 were recovered using cell dissociated non-enzymatic solution (Sigma Aldrich, C5914-100mL) and resuspended to a final concentration of 1.0 x 10 6 cells/ml in FACS buffer. Dilutions (1 :5 in FACS buffer) of crude periplasmic extracts containing VHHs were incubated with mouse anti-FLAG biotinylated antibody (Sigma Aldrich, F9291 - 1 MG) at 5 pg/ml in FACS buffer for 30 min with shaking at room temperature. Cell suspensions were distributed into 96-well v-bottom plates and incubated with the VHH/antibody mixture with one hour with shaking on ice.
  • Binding of VHHs to cells was detected with streptavidin R-PE (Invitrogen, SA10044) at 1 :400 dilution (0.18 pg/ml) in FACS buffer, incubated for 30 minutes in the dark with shaking on ice.
  • streptavidin R-PE Invitrogen, SA10044
  • FACS buffer FACS buffer
  • Surface expression of human CCR8 on transiently transfected cell lines was confirmed by means of PE anti-human CCR8 (Biolegend, 360603) antibody at 2 Hg/ml.
  • Synthetic DNA fragments encoding hCCR8-binding VHHs were subcloned into an E. coli expression vector under control of an IPTG-inducible lac promoter, in frame with N-terminal PelB signal peptide for periplasmic compartment-targeting and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG1 cells were transformed and the resulting clones were sequenced. VHH proteins were purified from these clones by IMAC chromatography followed by desalting, essentially as described in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
  • VHH- 69 Eight purified VHHs obtained from the human CCR8 immunization campaign were selected and evaluated by flow cytometry for their binding to hCCR8.
  • One of the purified VHHs (VHH- 69, herein after) displayed potent binding to human CCR8 (Fig. 9), and this in spite of not blocking the action of CCL1 on the CCR8 receptor in a cAMP HTRF assay for Gi coupled receptor.
  • VHH clones resulting from the human CCR8 immunization and selection campaign were screened by means of flow cytometry for binding to human CCR8 (SEQ ID NO: 31 ) on stably transfected HEK293 cells or to HEK293 cells previously transfected with plasmid DNA encoding N-terminal deletion human CCR8 (substitution of the 18 amino acids after the N- terminal Met residue of hCCR8 by the amino acid sequence of three consecutive HA-tags, SEQ ID NO: 32, delta 18-3XHA herein after), in comparison to mock-transfected control cells.
  • Comparison of the binding (median fluorescent intensity) signal of a given VHH clone across the three cell lines enabled classification of said clone as an N-terminal human CCR8 binder (i.e. binding on hCCR8 cells, but not on human CCR8 (delta18-3XHA) or control cells) or as an extracellular loop hCCR8 binder (i.e. binding on hCCR8 cells and on human CCR8 (delta 18- 3XHA), but not on control cells).
  • the selected monovalent VHH-69 was evaluated for its potential to functionally inhibit human CCL1 signalling on CHO-K1 cells displaying human CCR8 in cAMP accumulation experiments.
  • CHO-K1 cells stably expressing recombinant human CCR8 were grown prior to the test in media without antibiotic and detached by flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended in KHR buffer (5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH 2 PO 4 , 1.45 mM CaCI 2 , 0.5 g/l BSA, supplemented with 1 mM IBMX). Twelve microliters of cells were mixed with six microliters of VHH (final concentration: 1 pM) in triplicate and incubated for 30 minutes.
  • PBS-EDTA 5 mM EDTA
  • KHR buffer 5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose
  • VHH-69 did not alter cAMP levels over the control (PBS) as shown in Figure 10. These data indicate that VHH-69 is a non-blocking binder of hCCR8. Synthesis and purification of blocking and non-blocking VHH-Fc fusions
  • VHH-Fc constructs VHH-Fc-201 , VHH-Fc-202, VHH-Fc-203, VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220
  • VHH-Fc constructs VHH-Fc-201 , VHH-Fc-202, VHH-Fc-203, VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220
  • SEQ ID NO: 30 human short hinge and lgG1 Fc domain
  • VHH-Fc-203 and VHH-Fc-218 or separated by flexible GlySer linkers 10GS (VHH-Fc-201 and VHH-Fc-219) or 20GS (VHH-Fc- 202 and VHH-Fc-220) (20GS referring to four repeats of SEQ ID NO: 20 and, thus, having 20 amino acids in length).
  • VHH-Fc-201 , VHH-Fc-202 and VHH-Fc-203 contain a blocking CCR8 binding moiety (VHH-blocking), whereas VHH-Fc-218, VHH-Fc-219 and VHH- Fc-220 contain a VHH-69 binding moiety.
  • VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 are non-blocking hCCR8 binders with cytotoxic activity (ADCC) derived from the Fc domain.
  • ADCC cytotoxic activity
  • constructs were cloned in a pQMCF mammalian expression vector, in frame with a secretory signal peptide to direct the expressed recombinant proteins to the extracellular environment.
  • Cloning, cell transfection protein production in CHOEBNALT854 1 E9 cells and protein A purification were performed by Icosagen (Icosagen Cell Factory, Tartu, Estonia).
  • Example 18 Confirmation of hCCR8 binding by VHH-Fc fusions
  • the six multivalent VHH-Fc fusions were evaluated for their ability to bind to human CCR8 on stably transfected HEK293 cells by means of flow cytometry experiments.
  • Cells were incubated with different concentrations of the multivalent VHH-Fc fusions for 30 minutes at 4°C, followed by two washes with FACS buffer, followed by 30 minutes incubation at 4°C with R- Phycoerythrin AffiniPure F(ab’) 2 Fragment Goat anti-human IgG (Jackson ImmnoResearch, cat # 109-1 16-098), followed by two washing steps. Dead cells were stained using TOPRO3 (Thermo Fisher Scientific, T3605).
  • FIG. 11 shows the binding curves of VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 in comparison with two control anti-hCCR8 mAbs (ONCC8 and ONCC10).
  • VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were found to display poor macaca cross-reactivity, as shown in Figure 12.
  • VHH-Fc-201 and VHH-Fc-219 fusions were compared in a cAMP HTRF assay for Gi coupled receptor for their ability to functionally inhibit the action of the agonistic ligand human CCL1 .
  • CHO-K1 cells stably expressing recombinant human CCR8 receptor were grown prior to the assay in media devoid of antibiotics and detached by gentle flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended is KRH buffer (5 mM KCI, 1.25 mM MgSO 4 , 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH 2 PO 4 , 1.45 CaCI 2 , 0.5 g/l BSA) supplemented with 1 mM IBMX.
  • KRH buffer 5 mM KCI, 1.25 mM MgSO 4 , 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH 2 PO 4 , 1.45 CaCI 2 , 0.5 g/l BSA
  • VHH-Fc-201 Twelve microliters of cells were mixed with 6 pl of VHH-Fc-201 , VHH-Fc-219 or control CCR8 binders at ten concentrations and in duplicate and incubated 30 minutes. Afterwards, 6 pl of a mixture of forskolin and human CCL1 (R&D Systems, 845-TC or 272- 1) was added at a final concentration corresponding to their EC80 values. The plates were then incubated for 30 minutes at room temperature. After addition of lysis buffer and incubation for one hour, fluorescence ratios were measured with the HTRF kit (Cisbio, 62AM9PE) according to the specifications of the manufacturer.
  • HTRF kit Cibio, 62AM9PE
  • VHH-Fc-201 results in a 100% inhibition of the cAMP signal at a concentration of 50 nM and higher, with a plC50 value of 8.81 M, confirming that it is a blocking CCR8 binder.
  • VHH-Fc-219 does not block the action of CCL1 on the receptor, and this in spite of its potent binding to human CCR8, contrary to the three control mAbs tested (Fig. 13).
  • VHH-Fc fusions VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were tested for their capacity to activate human FcyRllla in the ADCC reported assay (Promega, G7010, G7018) using human CCR8 HEK293 cell line as target cells.
  • Engineered Jurkat cells stably transfected with the V158 FcyRllla receptor and an NFAT (nuclear factor of activated T-cells) responsive firefly luciferase reporter gene as effector cells were used in this assay.
  • HEK293 cells overexpressing human CCR8 were used as target cells.
  • ADCC activity was quantified through the produced luciferase luminescence signal resulting from the NFAT pathway activation upon incubation of the VHH-Fc fusions with the target and effector cells at a 2.5 : 1 effector : target cell ratio, according to the recommendations of the manufacturer.
  • VHH-Fc fusions VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were tested along with control monoclonal antibody ONCC8 and an isotype control in the ADCC assay using human PBMC from three independent healthy donors in a 40 : 1 effector : target ratio.
  • HEK293 cells expressing human CCR8 were labelled with DiO and seeded in 96-well round bottom plates at 5 x 10 3 cells per well. Binders were subjected to an 8-point titration in duplicate. Labelled target cells were opsonized with titration of the binders followed by incubated with effector cells for 3 hours. Specific lysis on target cells was monitored by the PI live/dead stain. Samples were acquired on a NxT flow cytometer (Attune).
  • VHH-Fc fusions displayed potent ADCC activity with pEC50 values ranging from approximately 10.7 to 14.3 M, based on the average of three independent experiments using human PBMC from different healthy donors, in the same range as the ONCC8 control. Sequence optimization of monovalent VHHs
  • VHH-69 was subjected to sequence optimization in an attempt to maximally improve its sequence in terms of humanization towards human IGHV3 (SEQ ID NO: 35, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSVISSDGSSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR) and JH (SES ID NO: 36, WGQGTLVTVSS) germline consensus sequences, as well as in terms of chemical and biophysical stability.
  • IGHV3 SEQ ID NO: 35, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSVISSDGSSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
  • JH SES ID NO: 36, WGQGTLVTVSS
  • VHH-69 variants were subjected to thermal stability and aggregation assays to gain insights in their melting and aggregation temperatures.
  • Intrinsic tryptophan-fluorescence was monitored upon temperature-induced protein unfolding in an Uncle instrument (Unchained Labs, Pleasanton, CA, USA). Ten microliter samples were applied at 1 mg/ml to the sample cuvette, and a linear temperature ramp was initiated from 25 to 95 °C at a rate of 0.5 °C per minute, with a pre-run of 180 seconds.
  • the barycentric mean (BCM) and static light scattering (SLS at 266 nm and 473 nm) signals were plotted against temperature in order to obtain melting temperatures (T m ) and aggregation temperatures (T agg ), respectively.
  • T m melting temperatures
  • T agg aggregation temperatures
  • Dynamic light scattering was performed using the Uncle instrument by applying 10 pl of sample at 1 mg/ml to the sample cuvette. Laser and attenuator controls were set at Auto while 10 acquisitions were run per data point with an acquisition time of 10 seconds each.
  • Size-exclusion chromatography (SEC) coupled to multi-angle laser-light scattering (MALLS) was carried out by applying 120 pl of a 1 mg/ml sample to a Superdex 200 column (GE healthcare) on an Agilent HPLC system. The outlet of the column was coupled to a UV detector followed by refractive index (Rl) detection and finally MALLS detector.
  • SEC Size-exclusion chromatography
  • MALLS multi-angle laser-light scattering
  • Samples were stored at 40 °C for 4 weeks, whereas reference samples were stored at -80°C. Forced oxidized samples (at 1 mg/ml) were supplemented with hydrogen peroxide up to a final concentration of 10 mM, followed by incubation at 37 °C for three hours, with final buffer exchange to phosphate buffer saline (PBS) using PD MidiTrap G-25 columns (GE-Healthcare, Chicago, IL, USA) according to instructions of the manufacturer. Samples were stored at -80 °C until lass spectrometric peptide mapping (Research Institute for Chromatography, Kortrijk, Belgium).
  • Peptide mapping consisted in treating 100 pg of the sample proteins with trypsin (overnight at 25 °C) and injecting the samples onto an RPC-column (reversed phase chromatography; elution by applying an acetonitrile gradient) followed by the ESI-mass spectrometer where LC-MS and LC-MS/MS data were used for quantification and identification, respectively.
  • VHH-123 and VHH-124 displayed no deamidation upon storage at 40 °C for 4 weeks. It was also found that the N55K substitution present in VHH-124 resulted in a 2-fold more potent competition IC50 value (2.5 x 10 M) compared to the control VHH-69(E1 D) (4.9 x 10 M) and VHH-123 (7.1 x 10 M) in the competition flow cytometry vs. FLAG3-tagged VHH-69 on human CCR8 in stably transfected HEK293 cells (Fig. 15).
  • VHH-123 and VHH-124 did not show any substantial high temperature (40 °C) dependent issue after 4 weeks of storage, such as Asn/GIn-deamination, Met/Trp-oxidation, or Asp- isomerization when stored at 40 °C for 4 weeks. No other liabilities were noted.
  • VHH-123 was fused directly to an lgG1 short hinge domain (SEQ ID NO: 28) or through a 10GS linker (SEQ ID NO: 23) or 20GS linker (SEQ ID NO: 24).
  • VHH-124 was fused directly to an IgG 1 short hinge domain (SEQ ID NO: 29) or through a 10GS linker (SEQ ID NO: 25) or 20GS linker (SEQ ID NO: 26).
  • VHH-124 fused either directly to an IgG 1 short hinge domain ( SEQ ID NO: 29, referred to hereinafter as VHH- Fc-262) or through a 20GS linker (SEQ ID NO: 24, referred to hereinafter as VHH-Fc-264)) were tested along with an isotype control in the ADCC assay using human PBMC from three independent healthy donors in a 40 : 1 effector : target ratio.
  • the ADCC potency was assessed for both the afucosylated and non-afucosylated versions of the VHH-Fc fusions.
  • HEK293 cells expressing human CCR8 were labelled with DiO and seeded in 96-well round bottom plates at 5 x 10 3 cells per well. Binders were subjected to an 8-point titration in duplicate. Labelled target cells were opsonized with titration of the binders followed by incubated with effector cells for 3 hours. Specific lysis on target cells was monitored by the PI live/dead stain. Samples were acquired on a NxT flow cytometer (Attune).
  • Both the afucosylated and non-afucosylated versions of the VHH-Fc fusions displayed potent ADCC activity in comparison with the isotype control (see Fig. 16).
  • the observed ADCC activity of the afucosylated version of VHH-Fc fusions displayed the strongest ADCC activity.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present invention relates to human CCR8 (hCCR8) binders, wherein the hCCR8 binder is a non-blocking binder of hCCR8. Such binders are particularly useful for the depletion of intra-tumoural regulatory T-cells and immunotherapy in general tumour

Description

NON-BLOCKING HUMAN CCR8 BINDERS
FIELD OF THE INVENTION
The present invention relates to human CCR8 (hCCR8) binders, wherein the hCCR8 binder is a non-blocking binder of hCCR8. Such binders are particularly useful for the depletion of intra- tumoural regulatory T-cells and immunotherapy in general.
BACKGROUND OF THE INVENTION
Regulatory T (Treg) cells are one of the integral components of the adaptive immune system whereby they contribute to maintaining tolerance to self-antigens and preventing auto-immune diseases. However, Treg cells are also found to be highly enriched in the tumour microenvironment of many different cancers (Colombo and Piconese, 2007; Nishikawa and Sakaguchi, 2014; Roychoudhuri et al., 2015). In the tumour microenvironment, Treg cells contribute to immune escape by reducing tumour-associated antigen (TAA)-specific T-cell immunity, thereby preventing effective anti-tumour activity. High tumour infiltration by Tregs is hence often associated with an invasive phenotype and poor prognosis in cancer patients (Shang et aL, 2015; Plitas et aL, 2016).
Acknowledging the significance of tumour-infiltrating Treg cells and their potential role in inhibiting anti-tumour immunity, multiple strategies have been proposed to modulate Treg cells in the tumour microenvironment. Several studies have demonstrated that modulating Tregs has the potential to offer significant therapeutic benefit (Elpek et al, 2007).
However, one major challenge associated with Treg modulation is that systemic removal or inhibition of Treg cells may elicit autoimmunity. It is therefore critical to specifically deplete tumour-infiltrating Treg cells while preserving tumour-reactive effector T cells and peripheral Treg cells (e.g. circulating blood Treg cells) in order to prevent autoimmunity.
The G protein-coupled CC chemokine receptor protein CCR8 (CKRL1/CMKBR8/CMKBRL2) and its natural ligand CCL1 have been known to be implicated in cancer and specifically in T- cell modulation in the tumour environment. Eruslanov et al. (Clin Cancer Res 2013, 17:1670- 80) showed upregulation of CCR8 expression in human cancer tissues and demonstrated that primary human tumours produce substantial amounts of the natural CCR8 ligand CCL1 . This indicates that CCL1/CCR8 axis contributes to immune evasion and suggest that blockade of CCR8 signals is an attractive strategy for cancer treatment. Hoelzinger et al. (J Immunol 2010, 184:8633-42) similarly show that blockade of CCL1 inhibits Treg suppressive function and enhances tumour immunity without affecting Treg responses. Wang et al. (PloSONE 2012, e30793) reported increased expression of CCR8 on tumour-infiltrating FoxP3+ T-cells and suggested that blocking CCR8 may lead to the inhibition of migration of T regs into the tumours. Due to the high and relatively specific expression of CCR8 on tumour-infiltrating Tregs, neutralizing monoclonal antibodies against CCR8 have been used for the modulation and depletion of this Treg population in the treatment of cancer (EP3431105 A1 and WO2019/157098 A1 ). WO2018/181425 suggests that, in mice, a neutralizing anti-CCR8 mAb is able to deplete T reg cells in tumour tissues by antibody-dependent cell-mediated cytotoxicity (ADCC), and thereby enhance tumour immunity. Through their neutralizing activity, these antibodies inhibit Treg migration into the tumour, reverse the suppressive function of Tregs and deplete intratumoural Tregs (WO2019/157098 A1 ). Recently, Wang et al. (Cancer Immunol Immonother 2020, https://doi.org/10.1007/s00262-020-02583-y) showed that CCR8 blockade could destabilize intratumoural Tregs into a fragile phenotype accompanied with reactivation of the antitumour immunity and augment anti-PD-1 therapeutic benefits.
In line with the general teachings of the prior art, CCR8 therapeutics that have been disclosed up to now are invariably blocking human CCR8 binders. For example, W02013131010 A2 discloses methods for treating solid tumours by administering antagonists of CCR8 that reduce the binding of CCL1 to CCR8 and explicitly refers to the monoclonal antibodies described in W02007044756 A2. This patent application from ICOS Corporation discloses antibodies against human CCR8 that block CCL1 -induced chemotaxis, including the preferred antibody 433H that is currently commercially available. Similarly, W02020138489 A1 provides antibodies against CCR8 for cancer treatment. Its humanized antibodies bind to human CCR8 and neutralize CC1 -induced calcium influx. It is indicated that binding to the N-terminal region of human CCR8 is in important element for exerting neutralizing activity.
However, alternative strategies for intratumoural Treg modulation are still required, especially strategies that reduce the risks of side effects associated with existing therapies in human.
SUMMARY OF THE INVENTION
The inventors have now surprisingly found that a non-blocking binder of human CCR8 (hCCR8) as detailed in the claims fulfils the above-mentioned need. In particular, the inventors have found that a non-blocking binder of CCR8 having cytotoxic activity allows for the efficient depletion of tumour-infiltrating regulatory T-cells (Tregs). Surprisingly, the absence of functional CCR8 blockade, suggested in the prior art to reduce Treg infiltration into the tumour and to inhibit or revert the immunosuppressive function of intra-tumoural Tregs, does not reduce therapeutic efficacy. The non-blocking hCCR8 binders of the invention therefore provide potential for efficacious tumour therapy, while displaying an improved safety profile.
It is thus an object of the invention to provide non-blocking hCCR8 binders. Therefore in a first embodiment, the present invention provides an hCCR8 binder, wherein said hCCR8 binder is a non-blocking binder of hCCR8.
Preferably, the hCCR8 binder binds to the N-terminal extracellular region of hCCR8.
In a further embodiment, the hCCR8 binder comprises a single-domain antibody moiety that binds to hCCR8.
In still another embodiment, the single-domain antibody moiety comprises three complementary determining regions (CDRs), namely CDR1 , CDR2 and CDR3, wherein CDR3 is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3.
Preferably, CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO:
1 , and CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGXSA (SEQ ID NO: 2), wherein X Is selected from the group consisting of N, S, and K, (b) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO:
2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K.
In still another embodiment, the single-domain antibody moiety further comprises four framework regions (FRs) having at least 50%, preferably at least 60%, more preferably at least 70%, still more preferably at least 80%, more preferably at least 85% sequence identity to SEQ ID NO: 4 to 7. Preferably, wherein X in SEQ ID NO: 4 is selected from D and E and wherein X in SEQ ID NO: 6 is selected from D and G. In yet another embodiment, the single-domain antibody moiety comprises the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 9.
In still another embodiment, the hCCR8 binder inhibits signalling of human CCR8 by less than 90%, preferably less than 80%, more preferably less than 70%, still more preferably less than 60%, most preferably less than 50%.
In still another embodiment, the hCCR8 binder comprises a single-domain antibody moiety that binds to human CCR8 and further comprises at least one cytotoxic moiety.
Preferably, the cytotoxic moiety induces antibody-dependent cellular cytotoxicity (ADCC), induces antibody-dependent cellular phagocytosis (ADCP), induces complement-dependent cytotoxicity (CDC), binds to and activates T-cells, or comprises a cytotoxic payload.
Another object of the present invention is to provide nucleic acids encoding the hCCR8 binder.
Yet another object of the present invention is to provide non-blocking hCCR8 binders for use as a medicine.
A further object of the present invention is to provide non-blocking hCCR8 binders for use in the treatment of a tumour. Preferably, the tumour is selected from the group consisting of breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck cancer, squamous cell carcinoma, skin cancer, colorectal cancer, kidney cancer and T cell lymphoma.
Preferably, the administration of the hCCR8 binder leads to the depletion of tumour-infiltrating regulatory T-cells (Tregs).
In yet a further embodiment, the treatment further comprises administration of a checkpoint inhibitor. A checkpoint inhibitor is a compound that blocks checkpoint proteins from binding to their partner proteins thereby activating the immune system function. Preferably the checkpoint inhibitor blocks proteins selected from the group consisting of PD-1 , PD-L1 , CTLA-4, TIGIT, TIM-3, LAG-3, VISTA, B7-1 , and B7-2. More preferably the checkpoint inhibitor blocks PD-1 or PD-L1.
BRIEF DESCRIPTION OF FIGURES Figure 1 illustrates the evaluation by flow cytometry of two VHHs (VHH-01 and VHH-06) derived from llama immunization with mouse CCR8 for their binding to full-length mouse CCR8 versus N-terminal deletion mouse CCR8 overexpressed in Hek293 cells.
Figure 2 presents a schematic representation of the VHH-Fc fusions VHH-Fc-14, VHH-Fc-25, VHH-Fc-41 and VHH-Fc-43.
Figure 3 illustrates the evaluation of VHH-Fc-14 and VHH-Fc-25 for their potential to functionally inhibit the protective activity of ligand mCCL1 against dexamethasone-induced apoptosis in BW5147 cells.
Figure 4 shows the effects on intratumoural Treg depletion by VHH-Fc-43, which is a mCCR8 blocking Fc fusion with ADCC activity, and VHH-Fc-41 , which lacks ADCC activity, as well as isotype control.
Figure 5 shows the effects on circulating Tregs by VHH-Fc-43 and VHH-Fc-41 and isotype control.
Figure 6 illustrates the effects on intestinal Treg levels by VHH-Fc-43 and VHH-Fc-41 and isotype control.
Figure 7 shows the in vivo effects of VHH-Fc-25 on tumour growth in comparison to isotype and VHH-Fc-14 in LLC-OVA tumors.
Figure 8 shows the in vivo effects of VHH-Fc-25 on tumour growth in comparison to isotype and VHH-Fc-14 in MC38 tumors.
Figure 9 illustrates the evaluation by flow cytometry of one VHH (VHH-69) derived from llama immunization with human CCR8 for its binding to human CCR8 on stably transfected in HEK293 cells.
Figure 10 illustrates the evaluation of VHH-69 as well as a CCR8-blocking control VHH (VHH- blocking) for their potential to functionally inhibit the action of the human CCL1 ligand on cAMP accumulation in CHO-K1 cells stably expressing recombinant human CCR8.
Figure 11 shows the evaluation of the three VHH-Fc fusions VHH-Fc-218 (SEQ ID NO: 27), VHH-Fc-219 (SEQ ID NO: 21 ) and VHH-Fc-220 (SEQ ID NO: 22) for their binding to human CCR8 on stably transfected in HEK293 cells, in comparison with two control anti-CCR8 mAbs. Figure 12 illustrates the evaluation by flow cytometry of VHH-Fc fusions VHH-Fc-218, VHH- Fc-219 and VHH-Fc-220 for their binding to macaca CCR8 transiently expressed in HEK239T cells, in comparison with two control anti-CCR8 mAbs.
Figure 13 shows the effects on functional inhibition of the action of the human CCL1 ligand on cAMP accumulation in CHO-K1 cells stably expressing recombinant human CCR8 by VHH- Fc-219, as well as three control anti-CCR8 mAbs.
Figure 14 presents the amino acid sequence of VHH-69 (SEQ ID NO: 10), which is nonblocking hCCR8 binder. Complementarity determining regions (CDRs) identified using the IMGT method are underlined, whereas CDRs identified using the Kabat method are represented in bold. Asterisks indicate amino acids which are mutated in the humanized nonblocking hCCR8 binders VHH-123 (SEQ ID NO: 8) and VHH-124 (SEQ ID NO: 9).
Figure 15 illustrates the evaluation of VHH-Fc fusions VHH-123 (SEQ ID NO: 8) and VHH- 124 (SEQ ID NO: 9) for their capacity to compete with FLAG3-tagged VHH-69 (SEQ ID NO: 10) for binding to human CCR8 stably expressing in HEK293 cells, in comparison with a control (VHH-69 (E1 D)).
Figure 16 shows the evaluation of the PBMC mediated ADCC activity of both an afucosylated (AF) and a non-afucosylated version of VHH-Fc-262 (SEQ ID NO: 29) and VHH-Fc-264 (SEQ ID NO: 26) in comparison to isotype on hCCR8-expressing HEK292 cells.
DETAILED DESCRIPTION OF THE INVENTION
The present invention will be described in the following with respect to particular embodiments and with reference to certain drawings but the invention is not limited thereto.
Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclature used in connection with, and techniques of, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry described herein are those well-known and commonly used in the art. As described herein before, the present invention provides a human CCR8 (hCCR8) binder, wherein said hCCR8 binder is a non-blocking binder of human CCR8. Such compounds are particularly useful due to their ability to bind to human CCR8 expressed on a cell, such as a regulatory T-cell, particularly an intra-tumoural regulatory T-cell, and to deplete such cells through their cytotoxic activity. CCR8 is a member of the beta-chemokine receptor family which is predicted to be a seven transmembrane protein similar to G-coupled receptors. Identified ligands of CCR8 include its natural cognate ligand CCL1 (I-309). Human CCR8 received UniProt Knowledgebase entry number P51685.
CCR8 binders
As described herein, the term “binder” of a specific antigen denotes a molecule capable of specific binding to said antigen. Specifically, a human CCR8 binder as used herein refers to a molecule capable of specifically binding to hCCR8. Such a binder is also referred to herein as a ”hCCR8 binder”.
“Specific binding”, “bind specifically”, and “specifically bind” is particularly understood to mean that the binder has a dissociation constant (Kd) for the antigen of interest of less than about 10-6 M, 10-7 M, 10-8 M, 10-9 M, 10-1° M, 10-11 M, 10-12 M or 10-13 M. In a preferred embodiment, the dissociation constant is less than 10-8 M, for instance in the range of 10-9 M, 10-10 M, 10-11 M, 10-12 M or 10-13 M. Binder affinities towards membrane targets may be determined by a surface plasmon resonance based assay (such as the BIAcore assay as described in PCT Application Publication No. W02005/012359) using viral like particles; cellular enzyme- linked immunoabsorbent assay (ELISA); and fluorescent activated cell sorting (FACS) read outs for example. A preferred method for determining apparent Kd or EC50 values is by using FACS at 21 °C with cells overexpressing hCCR8.
As will be understood by the skilled person, in principle any type of binder that binds to hCCR8 can be used in the present invention and different types of binders are readily available to the skilled person or can be generated using the typical knowledge in the art. In a particular embodiment, the binding moiety of the hCCR8 binder is proteinaceous, more particularly a hCCR8 binding polypeptide. In a further embodiment, the binding moiety of the hCCR8 binder is antibody based or non-antibody based, preferably antibody based. Non-antibody based binders include, but are not limited to, affibodies, Kunitz domain peptides, monobodies (adnectins), anticalins, designed ankyrin repeat domains (DARPins), centyrins, fynomers, avimers; affilins; affitins, peptides and the like. In a particular embodiment, the hCCR8 binder of the invention binds to an extracellular part of hCCR8, in particular an extracellular part of hCCR8 expressed on regulatory T-cells, such as the N-terminal region or one of the extracellular loops of hCCR8. In a particular embodiment, the hCCR8 binder of the invention binds to the N-terminal region, especially the N-terminal amino acids 1 to 35, such as 1 to 30, or 1 to 25 of hCCR8.
As described herein, the terms “antibody”, “antibody fragment” and “active antibody fragment” refer to a protein comprising an immunoglobulin (Ig) domain or an antigen-binding domain capable of specifically binding the antigen, in this case the hCCR8 protein. “Antibodies” can further be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. Antibodies may be multimers, such as tetramers, of immunoglobulin molecules. In a preferred embodiment, the binder comprises a hCCR8 binding moiety that is an antibody or active antibody fragment. In a further aspect of the invention, the binder is an antibody. In a further aspect of the invention the antibody is monoclonal. The antibody may additionally or alternatively be humanised or human. In a further aspect, the antibody is human, or in any case an antibody that has a format and features allowing its use and administration in human subjects. Antibodies may be derived from any species, including but not limited to mouse, rat, chicken, rabbit, goat, bovine, nonhuman primate, human, dromedary, camel, llama, alpaca, and shark.
The term “antigen-binding fragment” is intended to refer to an antigen-binding portion of said intact polyclonal or monoclonal antibodies that retains the ability to specifically bind to a target antigen or a single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site. The antigen-binding fragment comprises, but not limited to Fab; Fab'; F(ab')s; a Fc fragment; a single domain antibody (sdAb or dAb) fragment. These fragments are derived from intact antibodies by using conventional methods in the art, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')s fragments). As used herein, antigen-binding fragment also refers to fusion proteins comprising heavy and/or light chain variable regions, such as single-chain variable fragments (scFv).
As used herein, the term “monoclonal antibody” refers to an antibody composition having a homogeneous antibody population. It is understood that monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to conventional antibody (polyclonal) preparations which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. The binders of the invention preferably comprise a monoclonal antibody moiety that binds to hCCR8. In one aspect of the invention, the binder comprises an active antibody fragment. The term “active antibody fragment” refers to a portion of any antibody or antibody-like structure that by itself has high affinity for an antigenic determinant, or epitope, and contains one or more antigen-binding sites, e.g. complementary-determining-regions (CDRs), accounting for such specificity. Non-limiting examples include immunoglobulin domains, Fab, F(ab)’2, scFv, heavylight chain dimers, immunoglobulin single variable domains, single domain antibodies (sdAb or dAb), Nanobodies®, and single chain structures, such as complete light chain or complete heavy chain, as well as antibody constant domains that have been engineered to bind to an antigen. An additional requirement for the “activity” of said fragments in the light of the present invention is that said fragments are capable of binding hCCR8. The term “immunoglobulin (Ig) domain” or more specifically “immunoglobulin variable domain” (abbreviated as “IVD”) means an immunoglobulin domain essentially consisting of framework regions interrupted by complementary determining regions. Typically, immunoglobulin domains consist essentially of four “framework regions” which are referred in the art and below as “framework region 1 ” or “FR1 as “framework region 2” or “FR2”; as “framework region 3” or “FR3”; and as “framework region 4” or “FR4”, respectively; which framework regions are interrupted by three “complementarity determining regions” or “CDRs”, which are referred in the art and herein below as “complementarity determining region 1 ” or “CDR1 as “complementarity determining region 2” or “CDR2”; and as “complementarity determining region 3” or “CDR3”, respectively. Thus the general structure or sequence of an immunoglobulin variable domain can be indicated as follows: FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. It is the immunoglobulin variable domain(s) (IVDs) that confer specificity to an antibody for the antigen by carrying the antigenbinding site. Typically, in conventional immunoglobulins, a heavy chain variable domain (VH) and a light chain variable domain (VL) interact to form an antigen binding site. In this case the complementary determining regions (CDRs) of both VH and VL will contribute to the antigen binding site, i.e. a total of 6 CDRs will be involved in antigen binding site formation. In view of the above definition, the antigen-binding domain of a conventional 4-chain antibody (such as IgG, IgM, IgA, Ig D or Ig E molecule; known in the art) or of a Fab fragment, a F(ab’)2 fragment, an Fv fragment such as a disulphide linked Fv or scFv fragment, or a diabody (all known in the art) derived from such conventional 4-chain antibody, with binding to the respective epitope of an antigen by a pair of (associated) immunoglobulin domains such as light and heavy chain variable domains, i.e., by a VH-VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective antigen. A single-domain antibody (sdAb) as used herein, refers to a protein with an amino acid sequence comprising 4 framework regions (FR) and 3 complementarity determining regions (CDRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4. Single-domain antibodies of this invention are equivalent to “immunoglobulin single variable domains” (abbreviated as “ISVD”) and refers to molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets single-domain antibodies apart from “conventional” antibodies or their fragments, wherein two immunoglobulin domains, in particular two variable domains interact to form an antigen binding site. The binding site of a single-domain antibody is formed by a single VH/VHH or VL domain. Hence, the antigen binding site of a single-domain antibody is formed by no more than 3 CDRs. As such a single domain may be a light chain variable domain sequence, (e.g. a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g. a VH-sequence or VHH sequence) or a suitable fragment thereof; as long as it is capable of forming a single antigen binding unit (i.e., a functional antigen binding unit that essentially consists of a single variable domain, such that the single antigen binding domain does not need to interact with another variable domain to form a functional antigen binding unit).
Thus, in one embodiment, the hCCR8 binder as detailed above, comprises a single-domain antibody moiety.
In particular, the single-domain antibody may be a Nanobody® (as defined herein) or a suitable fragment thereof (Note: Nanobody®, Nanobodies® and Nanoclone® are registered trademarks of Ablynx N.V., a Sanofi Company). For general description of Nanobodies® reference is made to the further description below, and described in the prior art such as e.g. W02008/020079. “VHH domains”, also known as VHHs, VHH antibody fragments and VHH antibodies, have originally been described as the antigen binding immunoglobulin (Ig) (variable) domain of “heavy chain antibodies” (i.e. of “antibodies devoid of light chains”; see e.g. Hamers- Casterman et aL, Nature 363:446-8 (1993)). The term “VHH domain” has been chosen to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VH domains”) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VL domains”). For a further description of VHHs and Nanobodies®, reference is made to the review article by Muyldermans (Reviews in Molecular Biotechnology 74: 277-302, 2001 ), as well as to the following patent applications, which are mentioned as general background art: WO 94/04678, WO 95/04079 and WO 96/34103 of the Vrije Universiteit Brussel; WO 94/25591 , WO 99/37681 , WO 00/40968, WO 00/43507, WO 00/65057, WO 01/40310, WO 01/44301 , EP 1134231 and WO 02/48193 of Unilever; WO 97/49805, WO 01/21817, WO 03/035694, WO 03/054016 and WO 03/055527 of the Vlaams Instituut voor Biotechnologie (VIB); WO 03/050531 of Algonomics N.V. and Ablynx N.V.; WO 01/90190 by the National Research Council of Canada; WO 03/025020 (= EP 1433793) by the Institute of Antibodies; as well as WO 04/041867, WO 04/041862, WO 04/041865, WO 04/041863, WO 04/062551 , WO 05/044858, WO 06/40153, WO 06/079372, WO 06/122786, WO 06/122787 and WO 06/122825, by Ablynx N.V. and the further published patent applications by Ablynx N.V. As described in these references, Nanobody® (in particular VHH sequences and partially humanized Nanobody®) can in particular be characterized by the presence of one or more “Hallmark residues” in one or more of the framework sequences. A further description of the Nanobody®, including humanization and/or camelization of Nanobody, as well as other modifications, parts or fragments, derivatives or “Nanobody fusions”, multivalent or multispecific constructs (including some non-limiting examples of linker sequences) and different modifications to increase the half-life of the Nanobody® and their preparations can be found e.g. in WO 08/101985 and WO 08/142164. VHHs and Nanobodies® are among the smallest antigen binding fragment that completely retains the binding affinity and specificity of a full-length antibody (see e.g. Greenberg et aL, Nature 374:168-73 (1995); Hassanzadeh-Ghassabeh et aL, Nanomedicine (Lond), 8:1013-26 (2013)).
The binders of the present invention may be monospecific, bispecific, or multispecific. “Multispecific binders” may be specific for different epitopes of one target antigen or polypeptide, or may contain antigen-binding domains specific for more than one target antigen or polypeptide (Kufer et al. Trends Biotechnol 22:238-44 (2004)).
In one aspect of the invention, the binder is a monospecific binder. As discussed further below, in an alternative aspect the binder is a bispecific binder.
As used herein, “bispecific binder” refers to a binder having the capacity to bind two distinct epitopes either on a single antigen or polypeptide, or on two different antigens or polypeptides.
Bispecific binders of the present invention as discussed herein can be produced via biological methods, such as somatic hybridization; or genetic methods, such as the expression of a nonnative DNA sequence encoding the desired binder structure in a cell line or in an organism; chemical methods (e.g. by chemical coupling, genetic fusion, noncovalent associated or otherwise to one or more molecular entities, such as another binder of fragment thereof); or combination thereof.
The technologies and products that allow producing monospecific or bispecific binders are known in the art, as extensively reviewed in the literature, also with respect to alternative formats, binder-drug conjugates, binder design methods, in vitro screening methods, constant regions, post-translational and chemical modifications, improved feature for triggering cancer cell death such as Fc domain engineering (Tiller K and Tessier P, Annu Rev Biomed Eng. 17:191 -216 (2015); Speiss C et aL, Molecular Immunology 67:95-106 (2015); Weiner G, Nat Rev Cancer, 15:361 -370 (2015); Fan G et aL, J Hematol Oncol 8:130 (2015)).
Non-blocking binders
As discussed above, blocking hCCR8 binders having cytotoxic activity and leading to the depletion of tumour-infiltrating regulatory T-cells (Tregs) have already been described in the prior art. However, using such binders as therapeutics could lead to systemic side-effects and autoimmunity. Benefits of the binders of the invention may include reduced side effects, such as reduced effects on T cell populations expressing CCR8 which are not tumour-infiltrating Tregs, in particular non-tumour-infiltrating Treg cell populations expressing CCR8, such as the intestinal and/or skin Treg populations. In addition, the non-blocking binders of the invention may include the absence of or a lowered inhibition of dendritic cell migration towards lymph nodes.
The inventors have surprisingly found that CCR8 binders having cytotoxic activity characterized in that the CCR8 binder is a non-blocking binder of CCR8 can nonetheless specifically deplete tumour-infiltrating regulatory T-cells (Tregs), obtaining the same and higher efficacies, while reducing unwanted systemic side effects, as evidenced by the examples below.
A “non-blocking” binder of hCCR8 means that it does not block or substantially block the binding of a hCCR8 ligand to hCCR8, in particular, the binder does not block the binding of at least one ligand selected from hCCL1 , hCCL8, hCCL16, and hCCL18 to hCCR8, in particular it does not block binding of hCCL1 or hCCL18 to hCCR8, preferably it does not block the binding of hCCL1 to hCCR8. Blockade of ligand binding to hCCR8 may be determined by methods known in the art. Examples thereof include, but are not limited to, the measurement of the binding of a ligand such as hCCL1 to hCCR8, the migration of hCCR8-expressing cells towards a ligand such as hCCL1 , increase in intracellular Ca2+ levels by a hCCR8 ligand such as hCCL1 , rescue from dexamethasone-induced apoptosis by a ligand such as hCCL1 , and variation in the expression of a gene sensitive to hCCR8 ligand stimulation, such as hCCL1 stimulation. References to “non-blocking”, “non-ligand blocking”, “does not block” or “without blocking” and the like (with respect to the non-blocking of hCCR8 ligand binding to hCCR8 in the presence of the hCCR8 binder) include embodiments wherein the hCCR8 binder of the invention does not block or does not substantially block the signalling of hCCR8 ligand via hCCR8, in particular the signalling of hCCL1 via hCCR8. That is, the hCCR8 binder inhibits less than 50% of ligand signalling compared to ligand signalling in the absence of the binders. In particular embodiments of the invention as described herein, the hCCR8 binder inhibits less than 40%, 35%, 30%, preferably less than about 25% of ligand signalling compared to ligand signalling in the absence of the binders. In a particular embodiment, the percentage of ligand signalling is measured at a hCCR8 binder molar concentration that is at least 10, in particular at least 50, more in particular at least 100 times the binding EC50 of the hCCR8 binder to hCCR8. In another embodiment, the percentage of ligand signalling is measured at a hCCR8 binder molar concentration that is at least 10, in particular at least 50, more in particular at least 100 times the molar concentration of the ligand. Non-blocking hCCR8 binders allow binding of hCCR8 without interfering with the binding of at least one ligand to hCCR8, or without substantially interfering with the binding of at least one ligand to hCCR8. Ligand signalling, such as hCCL1 signalling, via hCCR8 may be measured by methods as discussed in the Examples and as known in the art. Comparison of ligand signalling in the presence and absence of the hCCR8 binder can occur under the same or substantially the same conditions.
In some embodiments, hCCR8 signalling can be determined by measuring the cAMP release. Specifically, CHO-K1 cells stably expressing recombinant human CCR8 receptor (such as FAST-065C available from EuroscreenFAST) are suspended in an assay buffer of KRH: 5 mM KCI, 1.25 mM MgSO4, 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH2PO4, 1.45 mM CaCI2, 0.5 g/l BSA, supplemented with 1 mM IBMX. The CCR8 binder is added at a concentration of 100nM and incubated for 30 minutes at 21 °C. A mixture of 5|iM forskolin and human CCL1 in assay buffer is added to reach a final assay concentration of 5 nM hCCL1. The assay mixture is then incubated for 30 minutes at 21 °C. After addition of a lysis buffer and 1 hour incubation, the concentration of cAMP is measured. cAMP can be measured by e.g. determining fluorescence levels, such as with the HTRF kit from Cisbio using manufacturer assay conditions (catalogue #62AM9PE). A non-blocking binder leads to a change of less than 50% of the amount of cAMP compared to a control that lacks the binder. In particular less than 40%, more in particular less than 30%, such as less than 20%. Preferably, a non-blocking binder leads to a change of less than 10%, more preferably less than 5% of cAMP compared to control.
As used herein, “epitope” or “antigenic determinant” refers to a site on an antigen to which a binder, such as an antibody, binds. As is well known in the art, epitopes can be formed both from contiguous amino acids (linear epitope) or non-contiguous amino acids juxtaposed by tertiary folding of a protein (conformational epitopes). Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes are well known in the art and include, for example, x-ray crystallography and 2-D nuclear magnetic resonance. See, for example, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
As used herein, the term “sequence identity” means that two polypeptide or polynucleotide sequences are identical (i.e. on an amino acid-by-amino acid, or on a nucleotide-by-nucleotide basis, respectively) over a window of comparison. The term “ percentage of sequence identity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical amino acid or nucleic acid base, whichever relevant, occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e. the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
As used herein, the term “substantially identical” or “substantial identity” denotes a characteristic of a polypeptide or polynucleotide sequence, wherein the polypeptide or polynucleotide comprises a sequence that has at least 80% sequence identity, preferably at least 85% sequence identify, more preferably 90% sequence identity, still more preferably 95% sequence identity, yet more preferably 99% sequence identity as compared to a reference sequence, wherein the percentage of sequence identify is calculated by aligning the reference sequence to the polypeptide or polynucleotide sequence which may include deletions or additions which in total amount 20% or less of the reference sequence over the window of comparison. The reference sequence may be a subset of a larger sequence. Optimal alignment of sequences may be carried out by conventional software or methods known by those of ordinary skill in the art.
As used herein, the term “corresponds to” or “corresponding to” is intended to mean that a polypeptide or a polynucleotide sequence is identical or similar to all or a portion of a reference polypeptide or a polynucleotide sequence. In contradistinction, the term “complementary to” as used herein in the relation to a polypeptide or a polynucleotide sequence is intended to mean that the complementary sequence is homologous to all or a portion of a reference polypeptide or a polynucleotide sequence. For illustration, the nucleotide sequence “TATAC” corresponds to a reference sequence “TATAC” and is complementary to a reference sequence “GTATA”.
In one embodiment of the present invention, the hCC8 binder, as detailed above, comprises a single-domain antibody moiety which comprises at least one complementarity determining region (CDR) of a single-domain antibody moiety as described herein, or an amino acid sequence having at least 80% amino acid identity the said CDR sequences, or an amino acid sequence having 3, 2, or 1 amino acid sequence difference with said CDR sequences. It is understood that the CDRs and the locations thereof in the sequence of said single-domain antibody moiety can be readily identified by conventional methods known by those of ordinary skill in the art, such as but not limited to, KABAT system (Kabat), Chothia, AHo or international ImMunoGeneTics information system (IMGT). The preferred method for determining CDR sequences is the IMGT method (Lefranc, M.-P. et aL, 2009, Nucleic Acids Research, D1006- 1012, http://www.imgt.org).
As will be described in the examples below, a specific and preferred hCCR8 binder according to the invention comprises a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10. Figure 14 presents a schematic representation of the amino acid sequence of SEQ ID NO: 10, wherein CDRs are identified using the IMGT method (underlined) or the Kabat method (bold).
Accordingly, using the IMGT method, the CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 1 (GRTFTNYKSNYK)
SEQ ID NO: 2 (TDWTGXSA)
SEQ ID NO: 3 (AAGTTIGQYTY) wherein X is selected from the group consisting of N, S and K.
Furthermore, using the Kabat method (Kabat E.A. et aL, 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication, No. 91 -3242), the CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 33 (NYKSNYKMA)
SEQ ID NO: 12 (RTDWTGXSAIIANSVKX)
SEQ ID NO: 34 (GTTIGQYTY)
Wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
Therefore, in a particular embodiment, the single-domain antibody as referred-to herein comprises three CDRs comprising the sequence of SEQ ID NO: 33, 12, and 34, wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
Alternatively, CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 1 1 (GRTFTNYKSNYKMA)
SEQ ID NO: 12 (RTDWTGXSAIIANSVKX)
SEQ ID NO: 13 (AAGTTIGQYTY)
Wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
Therefore, in a particular embodiment, the single-domain antibody as referred-to herein comprises three CDRs comprising the sequence of SEQ ID NO: 11 , 12, and 13, wherein X at position 7 in SEQ ID NO: 12 is selected from the group consisting of N, S and K and wherein X at position 17 is selected from D and G.
Thus, the single-domain antibody moiety, as detailed above comprises at least one, preferably at least two and most preferably three CDR(s) selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 3, or at least one, preferably at least two and most preferably three amino acid sequence(s) having at least 80% amino acid identity to said CDR sequences, or at least one, preferably at least two and most preferably three amino acid sequence(s) having 3, 2, or 1 amino acid sequence difference with said CDR sequences.
Preferably, the single-domain antibody moiety, as detailed above comprises a CDR3 which is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3. More preferably, CDR3 corresponds to SEQ ID NO: 3.
In a preferred embodiment, CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 1 ; and/or the CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGXSA (SEQ ID NO: 2), wherein X is selected from the group consisting of N, S and K, (b) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 2, wherein X in SEQ ID NO: 2 is selected from the group consisting of N, S and K.
In another particular embodiment, the present invention provides a hCCR8 binder comprising a combination of CDR1 , CDR2, and CDR3 as described herein, including the allowable variation described for these CDR regions. In another particular embodiment, the binder of the invention comprises at least one CDR region of the single-domain antibody moieties as described herein. In a further embodiment, the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 10. In an even further embodiment, the binder of the invention comprises the three CDR regions of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 10.
In a more preferred embodiment, the single-domain antibody moiety, as detailed above comprises three CDRs having the sequence of SEQ ID NO: 1 , 2 and 3, wherein X is selected from the group consisting of N, S and K.
In another embodiment of the invention, the single-domain antibody moiety, as detailed above, further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to at least one framework region (FR) of a single-domain antibody moiety described herein. In another embodiment of the invention, the single-domain antibody moiety, as detailed above, further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to the four framework regions (FR) of a single-domain antibody moiety described herein. It is understood that the method used for determining the FRs of said single-domain antibody moiety is the same as that used for identifying the CDRs.
Accordingly, using the IMGT method, the FRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 4 (XVQLVESGGGLVQPGGSLRLSCTAS)
SEQ ID NO: 5 (MAWFRQAPGKARAFVGR)
SEQ ID NO: 6 (IIANSVKXRFTISRDNAKNTVYLQMNSLRPEDTAVYYC)
SEQ ID NO: 7 (WGQGTLVTVSS) wherein X in SEQ ID NO: 4 is selected from D and E and wherein X in SEQ ID NO: 6 is selected from D and G.
Thus, the single-domain antibody moiety, as detailed above comprises at least one, preferably at least two, more preferably at least three and most preferably four amino acid sequences having at least 85%, preferably 90%, more preferably 95% sequence identity to the sequences selected from the group consisting of SEQ ID NO: 4 to SEQ ID NO: 7, wherein X in SEQ ID NO: 4 is selected from D and E and wherein X in SEQ ID NO: 6 is selected from D and G.
Preferably, said single-domain antibody moiety, as detailed above comprises four framework regions (FRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, wherein FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 4, wherein X is selected from the group consisting of D and E, FR2 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 5, FR3 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 6, wherein X is selected from the group consisting of D and G, and FR4 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 7.
In another particular embodiment, the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 10 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto; wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 2 wherein X is N, S, or K, and a CDR3 of SEQ ID NO: 3. In a further embodiment, X in SEQ ID NO: 2 is N.
In a particular embodiment, the binder of the invention comprises the amino acid sequences corresponding to SEQ ID NO: 10.
Humanized and sequence optimized non-blocking CCR8 binders
As used herein, the term “humanized binder” refers to a binder produced by molecular modelling techniques to identify an optimal combination of human and non-human (such as mouse or rabbits) binder sequences, that is, a combination in which the human content of the binder is maximized while causing little or no loss of the binding affinity attributable to the variable region of the non-human antibody. For example, a humanized antibody, also known as a chimeric antibody comprises the amino acid sequence of a human framework region and of a constant region from a human antibody to "humanize" or render non-immunogenic the complementarity determining regions (CDRs) from a non-human antibody. As used herein, the term “human binder” means a binder having an amino acid sequence corresponding to that of a binder that can be produced by a human and/or which has been made using any of the techniques for making human antibodies known to a skilled person in the art or disclosed herein. It is also understood that the term “human antibody” encompasses antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide. One such example is an antibody comprising murine light chain and human heavy chain polypeptides.
As for full-size antibodies, single variable domains such as VHHs and Nanobodies® can be subjected to sequence optimization, such as humanization, i.e. increase the degree of sequence identity with the closest human germline sequence, and other optimization techniques, such as to improve physicochemical or other properties of the binders. In particular, humanized immunoglobulin single variable domains, such as VHHs and Nanobodies® may be single-domain antibodies in which at least one single amino acid residue is present (and in particular, at least one framework residue) that is and/or that corresponds to a humanizing substitution (as defined further herein).
Humanized single-domain antibodies, in particular VHHs and Nanobodies®, may have several advantages, such as a reduced immunogenicity, compared to the corresponding naturally occurring VHH domains. By humanized is meant mutated so that immunogenicity upon administration in human patients is minor or non-existent. The humanizing substitutions should be chosen such that the resulting humanized amino acid sequence and/or VHH still retains the favourable properties of the VHH, such as the antigen-binding capacity.
In one particular embodiment, the non-blocking hCCR8 binder, as described above, is an optimized non-blocking hCCR8 binder.
Preferably, the optimized non-blocking hCCR8 binder comprises a single-domain antibody moiety as described above. More preferably, the single-domain antibody has been humanized by introducing mutations, in particular substitutions, for example at any one of positions of 1 , 55 and/or 65 of SEQ ID NO: 10. These residues have also been highlighted by asterisks in Figure 14. Specifically, a mutation substituting a Glutamic acid residue (E) by an Aspartic acid (D) at position 1 of SEQ ID NO: 10 was found to increase chemical stability of the binders. Furthermore, it was found that substituting an Asparagine residue (N) by either a Serine (S) or a Lysine (K) at position 55 of SEQ ID NO: 10 avoided deamidation upon storage of the binders at 40 °C, as shown in the examples below. In addition, it was found that the N55K substitution present in VHH-124 resulted in a 2-fold more potent competition IC50 value (2.5 x 10-10 M) compared to the control VHH-69(E1 D). Therefore, in a particular embodiment, the present invention provides a binder comprising the amino acid sequence of SEQ ID NO: 10, optionally comprising one or more of the substitutions E1 D, N55S, N55K, and G65D. In a further embodiment, a binder comprising the amino acid sequence of SEQ ID NO: 10 comprising the substitutions E1 D, G65D, and N55S or N55K. In an even further embodiment, a binder comprising the amino acid sequence of SEQ ID NO: 10 comprising the substitution N55K.
In another embodiment, the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 8. In an even further embodiment, the binder of the invention comprises the three CDR regions of a singledomain antibody moiety having the amino acid sequence of SEQ ID NO: 8. In yet another embodiment, the binder of the invention comprises at least one CDR region of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 9. In an even further embodiment, the binder of the invention comprises the three CDR regions of a single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 9.
However, the amino acid sequences and/or single-domain antibody of the invention may be suitably humanized at any position and in particular at any framework residue(s), such as at one or more Hallmark residues (as defined above) or at one or more other framework residues (i.e. non-Hallmark residues) or any suitable combination thereof. Depending on the host organism used to express the amino acid sequence, single-domain antibody or polypeptide of the invention, such deletions and/or substitutions may also be designed in such a way that one or more sites for posttranslational modification (such as one or more glycosylation sites) are removed, as will be within the ability of the person skilled in the art. Alternatively, substitutions or insertions may be designed so as to introduce one or more sites for attachment of functional groups (as described herein), for example to allow site-specific pegylation.
In one embodiment of the present invention, the humanized non-blocking hCC8 binder, as detailed above, comprises a single-domain antibody moiety which comprises at least one complementarity determining region (CDR) of a single-domain antibody moiety as described herein, or an amino acid sequence having at least 80% amino acid identity the said CDR sequences, or an amino acid sequence having 3, 2, or 1 amino acid sequence difference with said CDR sequences. It is understood that the CDRs and the locations thereof in the sequence of said single-domain antibody moiety can be readily identified by conventional methods known by those of ordinary skill in the art, such as but not limited to, KABAT system (Kabat), Chothia, AHo or international ImMunoGeneTics information system (IMGT). The preferred method for determining CDR sequences is the IMGT method (Lefranc, M.-P. et al., 2009, Nucleic Acids Research, D1006-1012, http://www.imgt.org). As will be described in the examples below, two specific humanized hCCR8 binders according to the invention comprise a single-domain antibody moiety corresponding to SEQ ID NO: 8 or 9.
Accordingly, using the IMGT method, the CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 1 (GRTFTNYKSNYK)
SEQ ID NO: 14 (TDWTGSSA) or SEQ ID NO: 15 (TDWTGKSA)
SEQ ID NO: 3 (AAGTTIGQYTY)
Furthermore, using the Kabat method, the CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 33 (NYKSNYKMA)
SEQ ID NO: 16 (RTDWTGSSAIIANSVKD) or SEQ ID NO: 17 (RTDWTGKSAIIANSVKD)
SEQ ID NO: 34 (GTTIGQYTY).
Alternatively, the CDRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 1 1 (GRTFTNYKSNYKMA)
SEQ ID NO: 16 (RTDWTGSSAIIANSVKD) or SEQ ID NO: 17 (RTDWTGKSAIIANSVKD)
SEQ ID NO: 13 (AAGTTIGQYTY)
Thus, the single-domain antibody moiety, as detailed above comprises at least one, preferably at least two and most preferably three CDR(s) selected from the group consisting of SEQ ID NO: 1 , 14, 15 and 3, or at least one, preferably at least two and most preferably three amino acid sequence(s) having at least 80% amino acid identity the said CDR sequences, or at least one, preferably at least two and most preferably three amino acid sequence(s) having 3, 2, or 1 amino acid sequence difference with said CDR sequences. Preferably, the single-domain antibody moiety, as detailed above comprises a CDR3 which is selected from the group consisting of (a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 3, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3. More preferably, CDR3 corresponds to SEQ ID NO: 3.
In a preferred embodiment, CDR1 is selected from the group consisting of (a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1 ), (b) amino acid sequences having at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 , and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with the sequence of SEQ ID NO: 1 , and the CDR2 is selected from the group consisting of (a) the amino acid sequence of TDWTGSSA (SEQ ID NO: 14), (b) the amino acid sequence of TDWTGSSA (SEQ ID NO : 15), (c) amino acid sequences having at least 80% amino acid sequence identity with SEQ ID NO: 14 or 15, and (c) amino acid sequences having 3, 2, or 1 amino acid sequence difference with SEQ ID NO: 14 or 15.
In a more preferred embodiment, the single-domain antibody moiety, as detailed above comprises three CDRs having the sequence of SEQ ID NO: 1 , 14 and 3, or having the sequence of SEQ ID NO: 1 , 15 and 3.
In another embodiment of the invention, the single-domain antibody moiety, as detailed above, further comprises a sequence having at least 85, 90, 95, 98 or 99% sequence identify to at least one framework region (FR) of a single-domain antibody moiety described herein. It is understood that the method used for determining the FRs of said single-domain antibody moiety is the same as that used for identifying the CDRs.
Accordingly, using the IMGT method, the FRs as identified within the single-domain antibody moiety, as defined above, correspond to:
SEQ ID NO: 18 (DVQLVESGGGLVQPGGSLRLSCTAS)
SEQ ID NO: 5 (MAWFRQAPGKARAFVGR)
SEQ ID NO: 19 (IIANSVKGRFTISRDNAKNTVYLQMNSLRPEDTAVYYC)
SEQ ID NO: 7 (WGQGTLVTVSS) Thus, the single-domain antibody moiety, as detailed above comprises at least one, preferably at least two, more preferably at least three and most preferably four amino acid sequences having at least 85%, preferably 90%, more preferably 95% sequence identity to the sequences selected from the group consisting of SEQ ID NO: 18, 5, 19 and 7.
Preferably, said single-domain antibody moiety, as detailed above four framework regions (FRs) according to the format FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, wherein FR1 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 18, FR2 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 5, FR3 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 19, and FR4 has at least 85%, preferably 90%, more preferably 95% sequence identity to the sequence of SEQ ID NO: 7.
More preferably, said single-domain antibody moiety, as detailed above comprises the amino acid sequences corresponding to SEQ ID NO: 8 or 9. In a particular embodiment, the binder of the invention comprises the amino acid sequence of SEQ ID NO: 8. In another particular embodiment, the binder of the invention comprises the amino acid sequence of SEQ ID NO: 9.
In another particular embodiment, the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto, wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 14, and a CDR3 of SEQ ID NO: 3.
In yet another particular embodiment, the binder of the present invention comprises an antibody or antigen-binding fragment thereof that comprises an amino acid sequence of SEQ ID NO: 9 or an amino acid sequence having 85%, 90% or 95% sequence identity thereto, wherein the binder comprises a CDR1 of SEQ ID NO: 1 , a CDR2 of SEQ ID NO: 15, and a CDR3 of SEQ ID NO: 3.
In another aspect, the invention provides a binder, such as an antibody or antigen-binding fragment thereof, that competes for specific binding to hCCR8 with a binder as described herein. In particular with a hCCR8 single-domain antibody moiety having the amino acid sequence of SEQ ID NO: 8, 9, or 10. Therefore, in a particular embodiment, the present invention provides non-blocking hCCR8 binder that competes for specific binding to hCCR8 with a single-domain antibody having the amino acid sequence of SEQ ID NO: 8, 9, or 10. It can easily be determined if a binder competes for specific binding to hCCR8 with a binder as described herein using routine methods known in the art. For example, to determine whether a test binder competes, the binder of the invention is allowed to bind to a hCCR8 protein under saturation conditions. Next, the ability of the test binder is evaluated. If the test binder cannot bind to the hCCR8 protein, it can be concluded that the test antibody competes with the binder of the invention for specific binding to hCCR8.
Cytotoxicity
Another aspect of the present invention is to provide a human CCR8 binder having cytotoxic activity. “Cytotoxicity” or “cytotoxic activity” as used herein refers to the ability of a binder to be toxic to a cell that it is bound to. As is clear to the skilled person from the description of the invention, any type of cytotoxicity can be used in the context of the invention. Of importance is the ability of the binder of the invention to bind hCCR8 in a non-blocking manner and to cause toxicity to the cell that it is bound to. Cytotoxicity can be direct cytotoxicity, wherein the binder itself directly damages the cell (e.g. because it comprises a chemotherapeutic payload) or it can be indirect, wherein the binder induces extracellular mechanisms that cause damage to the cell (e.g. an antibody that induces antibody-dependent cellular activity). More in particular, the binder of the invention can signal the immune system to destroy or eliminate the cell it is bound to or the binder can carry a cytotoxic payload to destroy the cell it is bound to. In particular, the cytotoxic activity is caused by the presence of cytotoxic moiety. Examples of such cytotoxic moieties includes moieties which induce antibody-dependent cellular activity (ADCC), induce antibody-dependent cellular phagocytosis (ADCP), induce complementdependent cytotoxicity (CDC), bind to and activate T-cells, or comprise a cytotoxic payload. Most preferably, said cytotoxic moiety induces antibody-dependent cellular activity (ADCC).
Antibody-dependent cellular cytotoxicity (ADCC) refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors recognize binders on a target cell and subsequently cause lysis of the target cell. Examples of non-specific cytotoxic cells that express Fc receptors include natural killer cells, neutrophils, monocytes and macrophages.
Complement-dependent cytotoxicity (CDC) refers to the lysis of a target in the presence of complement. The complement activation pathway is initiated by the binding of the first component of the complement system (C1q) to a binder complexed with a cognate antigen.
Antibody-dependent cellular phagocytosis (ADCP) refers to a cell-mediated reaction in which phagocytes (such as macrophages) that express Fc receptors recognize binders on a target cell and thereby lead to phagocytosis of the target cell. CDC, ADCC and ADCP can be measured using assays that are known in the art (Vafa et al. Methods 2014 Jan 1 ;65(1 ):1 14-26 (2013)).
Binding to and activation of T-cells refers to the binding of a T-cell marker that is distinct from hCCR8 and the resulting activation of said T-cell. Activation of the T-cell induces the cytotoxic activity of the T-cell against the cell on which the binder of the invention is bound. Therefore, in a particular embodiment, the binder of the invention binds to hCCR8 and binds to and activates T-cells. For example, the cytotoxic moiety may bind to hCD3. In a further embodiment, the cytotoxic moiety comprises an antibody or antigen-binding fragment thereof that binds to hCD3. Thus, the binder of the invention may bind to hCCR8 and hCD3. Such a binder binds to intratumoural Tregs and directs the cytotoxic activity of T-cells to these Tregs, thereby depleting them from the tumour environment. In a particular embodiment, the binder of the invention comprises a moiety that binds to hCCR8 and a moiety that binds to hCD3, wherein at least one moiety is antibody based, particularly wherein both moieties are antibody based. Therefore, in a particular embodiment, the present invention provides a bispecific construct comprising an antibody or antigen-binding fragment thereof that specifically binds to hCCR8 and an antibody or antigen-binding fragment thereof that specifically binds to hCD3.
A cytotoxic payload refers to any molecular entity that causes a direct damaging effect on the cell that is contacted with the cytotoxic payload. Cytotoxic payloads are known to the persons skilled in the art. In a particular embodiment, the cytotoxic payload is a chemical entity. Particular examples of such cytotoxic payloads include toxins, chemotherapeutic agents and radioisotopes or radionuclides. In a further embodiment, the cytotoxic payload comprises an agent selected from the group consisting of alkylating agents, anthracyclines, cytoskeletal disruptors, epothilones, histone deacetylase inhibitors, inhibitors of topoisomerase I, inhibitors of topoisomerase II, kinase inhibitors, nucleotide analogues and precursor analogues, peptide antibiotics, platinum-based agents, retinoids, vinca alkaloids and derivatives, peptide or small molecule toxins, and radioisotopes. Chemical entities can be coupled to proteinaceous inhibitors, e.g. antibodies or antigen-binding fragments, using techniques known in the art. Such coupling can be covalent or non-covalent and the coupling can be labile or reversible.
As is well known in the field, the Fc region of IgG antibodies interacts with several cellular Fey receptors (FcyR) to stimulate and regulate downstream effector mechanisms. There are five activating receptors, namely FcyRI (CD64), FcyRlla (CD32a), FcyRllc (CD32c), FcyRllla (CD16a) and FcyRlllb (CD16b), and one inhibitory receptor FcyRllb (CD32b). The communication of IgG antibodies with the immune system is controlled and mediated by FcyRs, which relay the information sensed and gathered by antibodies to the immune system, providing a link between the innate and adaptive immune systems, and particularly in the context of biotherapeutics (Hayes J et aL, 2016. J Inflamm Res 9: 209-219).
IgG subclasses vary in their ability to bind to FcyR and this differential binding determines their ability to elicit a range of functional responses. For example, in humans, FcyRllla is the major receptor involved in the activation of antibody-dependent cell-mediated cytotoxicity (ADCC) and lgG3 followed closely by IgG 1 display the highest affinities for this receptor, reflecting their ability to potently induce ADCC. Whilst lgG2 have been shown to have weaker binding for this receptor binders having the human lgG2 isotype have also been found to efficiently deplete Tregs.
In a preferred embodiment of the invention, the binder of the invention induces antibody effector function, in particular antibody effector function in human. In a particular embodiment, the binder of the invention binds FcyR with high affinity, preferably an activating receptor with high affinity. Preferably the binder binds FcyRI and/or FcyRlla and/or FcyRllla with high affinity. Particularly preferably, the binder binds to FcyRllla. In a particular embodiment, the binder binds to at least one activating Fey receptor with a dissociation constant of less than about 10-6 M, 10-7 M, 10-8 M, 10-9 M, 10-1° M, 10-11 M, 10-12 M or 10-13 M. FcyR binding can be obtained through several means. For example, the cytotoxic moiety may comprise a fragment crystallisable (Fc) region moiety or it may comprise a binding part, such as an antibody or antigen-binding part thereof that specifically binds to an FcyR.
In one particular embodiment, the cytotoxic moiety comprises a fragment crystallisable (Fc) region moiety. Preferably, the Fc region moiety is an IgG Fc domain derived from IgG 1 , lgG2, lgG3 and lgG4 antibody. More preferably, the Fc region moiety is an IgG Fc domain derived from a human lgG1 antibody. More preferably, the Fc region moiety is an IgG Fc domain derived from a short hinge variant of a human lgG1 antibody. In a particular embodiment, the Fc region moiety comprises the amino acid sequence of SEQ ID NO: 30 or an amino acid sequence having at least 80% sequence identity, such as at least 85% sequence identity or 90% sequence identity. In a further embodiment, an amino acid sequence of SEQ ID NO: 30 or an amino acid sequence having at least 95%, 96%, 97% sequence identity, in particular at least 98% sequence identity, more in particular at least 99% sequence identity.
In one embodiment, the Fc region moiety has been engineered to increase ADCC, CDC and/or ADCP activity.
ADCC may be increased by methods that reduce or eliminate the fucose moiety from the Fc moiety glycan and/or through introduction of specific mutations on the Fc region of an immunoglobulin, such as lgG1 (e.g. S298A/E333/K334A, S239D/I332E/A330L or G236A/S239D/A330L/I332E) (Lazar et al. Proc Natl Acad Sci USA 103:2005-2010 (2006); Smith et al. Proc Natl Acad Sci USA 209:6181 -6 (2012)). ADCP may also be increased by the introduction of specific mutations on the Fc portion of human IgG (Richards et al. Mol Cancer Ther 7:2517-27 (2008)). Methods for engineering binders for increased ADCC, CDC and ADCP activity have been described in Saunders (Frontiers in Immunology 2019, 1296) and Wang et al. (Protein Cell 2019, 9:63-73).
In a particular embodiment of the present invention, the binder comprising an Fc region moiety is optimized to elicit an ADCC response, that is to say the ADCC response is enhanced, increased or improved relative to other hCCR8 binders comprising an Fc region moiety, including those that do not inhibit the binding of CCL1 to CCR8 and, for example, unmodified anti-CCR8 monoclonal antibodies. In a preferred embodiment, the hCCR8 binder has been engineered to elicit an enhanced ADCC response.
In a preferred embodiment of the present invention, the binder comprising an Fc region moiety is optimized to elicit an ADCP response, that is to say the ADCP response is enhanced, increased or improved relative to other hCCR8 binders comprising an Fc region moiety, including those that do not inhibit the binding of hCCL1 to hCCR8 and, for example, unmodified anti-hCCR8 monoclonal antibodies.
In another embodiment, the cytotoxic moiety comprises a moiety that binds to an Fc gamma receptor. More in particular binds to and activates an FcyR, in particular an activating receptor, such as FcyRI and/or FcyRlla and/or FcyRllla, especially FcyRllla. The moiety that binds to an FcyR may be antibody based or non-antibody based as described herein before. If antibody based, the moiety may bind the FcyR through its variable region.
In a further embodiment of the present invention, the hCCR8 binder, as detailed above comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, as detailed above.
In one embodiment of the present invention, the hCCR8 binder is a genetically engineered polypeptide that comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, joined together by a direct bond.
In another embodiment, the hCCR8 binder is a genetically engineered polypeptide that comprises at least one Fc region moiety and a single-domain antibody moiety that binds to hCCR8, joined together by a direct bond or a linker. Preferably, the linker is a peptide linker. Preferably, the linker is a flexible linker having an amino acid sequence consisting primarily of stretches of Glycine (G) and Serine (S) residues (a so-called “GS” or “GlySer” linker). In a further embodiment, at least 80%, in particular at least 85%, more in particular at least 90% of amino acid residues in the peptide linker are selected from glycine and serine. In a preferred embodiment comprising at least 95% of amino acid residues in the peptide linker are selected from glycine and serine. In another particular embodiment, the peptide linker comprises from 1 to 50 amino acids, such as from 1 to 40, in particular from 1 to 30. In a particular embodiment from 5 to 25 amino acids, preferably from 8 to 22 amino acids, such as from 10 to 20 amino acids. A preferred example of such a GS linker comprises the sequence of GGGGS (SEQ ID NO: 20). In such a linker, the sequence of SEQ ID NO: 20 can be repeated “n” times to optimize the length of the GS linker to achieve appropriate properties of the binder, so that the sequence of the linker will be that of (SEQ ID NO: 20)n. Typically the copy number “n” ranges from 1 to 10, or from 2 to 4. The amino acid sequence of the Fc region moiety and/or the single domain antibody moiety region(s) may be humanized to reduce immunogenicity for humans.
Therefore, in a particular embodiment, the hCCR8 binder of the invention has the formula B- L-C; wherein B refers to a hCCR8 binding moiety as described herein, L refers to a linker as described herein, and C refers to a cytotoxic moiety as described herein. As will be understood from the disclosures herein, preferably B comprises a single-domain antibody moiety that binds to hCCR8, L is either a direct bond or has the sequence (SEQ ID NO: 20)n wherein n is an integer from 1 to 10, and C is an Fc region moiety.
In one embodiment, the hCCR8 binder of the invention has the formula B-L-C, wherein B is a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, L is a linker corresponding to (SEQ ID NO: 20)n, wherein “n” ranges from 1 to 10, and C is an Fc region moiety.
Preferably, the hCCR8 binder of the invention has the formula B-L-C, wherein B is a singledomain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, L is a linker corresponding to (SEQ ID NO: 20)n, wherein “n” is 2 or 4, and C is an IgG Fc domain derived from a short hinge variant of a human IgG 1 antibody.
More preferably, said hCCR8 binder, as detailed above comprises the amino acid sequences corresponding to any of SEQ ID NO: 21 to 26.
In a further embodiment, the hCCR8 binder of the invention has the formula B-C, wherein B is a single-domain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10, and C is an Fc region moiety. Preferably, the hCCR8 binder of the invention has the formula B-C, wherein B is a singledomain antibody moiety corresponding to SEQ ID NO: 8, 9, or 10 and C is an IgG Fc domain derived from a short hinge variant of a human IgG 1 antibody.
More preferably, said hCCR8 binder, as detailed above comprises the amino acid sequences corresponding to any of SEQ ID NO: 27 to 29.
In a further embodiment, the present invention provides nucleic acid molecules encoding hCCR8 binders as defined herein. In some embodiments, such provided nucleic acid molecules may contain codon-optimized nucleic acid sequences. In another embodiment, the nucleic acid is included in an expression cassette within appropriate nucleic acid vectors for the expression in a host cell such as, for example, bacterial, yeast, insect, piscine, murine, simian, or human cells. In some embodiments, the present invention provides host cells comprising heterologous nucleic acid molecules (e.g. DNA vectors) that express the desired binder.
In a particular embodiment, the binder of the invention is administered as a therapeutic nucleic acid. The term “therapeutic nucleic acid” used herein refers to any nucleic acid molecule that have a therapeutic effect when introduced into a eukaryotic organism (e.g., a mammal such as human) and includes DNA and RNA molecules encoding the binder of the invention. As is known to the skilled person, the nucleic acid may comprise elements that induce transcription and/or translation of the nucleic acid or that increases ex and/or in vivo stability of the nucleic acid.
In some embodiments, the present invention provides methods of preparing an isolated hCCR8 binder as defined above. In some embodiments, such methods may comprise culturing a host cell that comprises nucleic acids (e.g. heterologous nucleic acids that may comprise and/or be delivered to the host cell via vectors). Preferably, the host cell (and/or the heterologous nucleic acid sequences) is/are arranged and constructed so that the binder is secreted from the host cell and isolated from cell culture supernatants.
Treatment
A hCCR8 binder presenting the features as described herein represents a further object of the invention. The hCCR8 binder can be used as a medicine. In a further embodiment the invention provides a method for treating a disease in a subject comprising administering a non-blocking hCCR8 binder having cytotoxic activity, in particular a hCCR8 binder having cytotoxic activity that does not inhibit the binding of hCCL1 to hCCR8 or signalling of hCCL1 via hCCR8. Preferably the disease is a cancer, in particular a solid tumour.
In a preferred embodiment of the present invention, the subject of the aspects of the invention as described herein, is a mammal, preferably a cat, dog, horse, donkey, sheep, pig, goat, cow, hamster, mouse, rat, rabbit, or guinea pig, but most preferably the subject is a human. Thus in all aspects of the invention as described herein the subject is preferably a human.
As used herein, the terms “cancer”, “cancerous”, or “malignant” refer to or describe the physiological condition on mammals that is typically characterized by unregulated cell growth.
As used herein, the term “tumour” as it applies to a subject diagnosed with, or suspected of having, a cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumours and secondary neoplasms. The terms “cancer”, “malignancy”, “neoplasm”, “tumour” and “carcinoma” can also be used interchangeably herein to refer to tumours and tumour cells that exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation. In general, cells of interest for treatment include precancerous (e.g. benign), malignant, pre-metastatic, metastatic, and non-metastatic cells. The teachings of the present disclosure may be relevant to any and all tumours.
Examples of tumours include but are not limited to, carcinoma, lymphoma, leukemia, blastoma, and sarcoma. More particular examples of such cancers include squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, hepatocellular carcinoma (HCC), hodgkin's lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), anaplastic large cell lymphoma (ALCL), cutaneous T-cell lymphoma (CTCL), Adult T-cell leukemia/lymphoma (ATLL), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma and head and neck cancer.
In one aspect, the tumour involves a solid tumour. Examples of solid tumours are sarcomas (including cancers arising from transformed cells of mesenchymal origin in tissues such as cancellous bone, cartilage, fat, muscle, vascular, hematopoietic, or fibrous connective tissues), carcinomas (including tumours arising from epithelial cells), mesothelioma, neuroblastoma, retinoblastoma, etc. Tumours involving solid tumours include, without limitations, brain cancer, lung cancer, stomach cancer, duodenal cancer, esophagus cancer, breast cancer, colon and rectal cancer, renal cancer, bladder cancer, kidney cancer, pancreatic cancer, prostate cancer, ovarian cancer, melanoma, mouth cancer, sarcoma, eye cancer, thyroid cancer, urethral cancer, vaginal cancer, neck cancer, lymphoma, and the like.
In another particular embodiment, the tumour is selected from the group consisting of breast invasive carcinoma, colon adenocarcinoma, head and neck squamous carcinoma, stomach adenocarcinoma, lung adenocarcinoma (NSCLC), lung squamous cell carcinoma (NSCLC), kidney renal clear cell carcinoma, skin cutaneous melanoma, esophageal cancer, cervical cancer, hepatocellular carcinoma, merkel cell carcinoma, small Cell Lung Cancer (SCLC), classical Hodgkin Lymphoma (cHL), urothelial Carcinoma, Microsatellite Instability-High (MSI- H) Cancer and mismatch repair deficient (dMMR) cancer.
In a further embodiment, the tumour is selected from the group consisting of a breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck squamous cell carcinoma, skin cancer, colorectal cancer, and kidney cancer. In an even further embodiment, the tumour is selected from the group consisting of breast invasive carcinoma, colon adenocarcinoma, head and neck squamous carcinoma, stomach adenocarcinoma, lung adenocarcinoma (NSCLC), lung squamous cell carcinoma (NSCLC), kidney renal clear cell carcinoma, and skin cutaneous melanoma. In one aspect, the cancers involve CCR8 expressing tumours, including but not limited to breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck squamous cell carcinoma, skin cancer, colorectal cancer, and kidney cancer. In one particular embodiment, the tumour is selected from the group consisting of breast cancer, colon adenocarcinoma, and lung carcinoma.
In a particular embodiment, the tumour is a T-cell lymphoma, in particular a T-cell lymphoma expressing CCR8 including, but not limited to Adult T-cell leukemia/lymphoma (ATLL), cutaneous T-cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL).
In a further embodiment, the tumour is a tumour carrying recurrent chromosomal rearrangements involving the DUSP22-IRF4 locus on 6p25.3 (so-called DUSP22 rearrangements). Preferably, the tumour is a lymphoma carrying DUSP22 rearrangements.
As used herein, the term “administration” refers to the act of giving a drug, prodrug, antibody, or other agent, or therapeutic treatment to a physiological system (e.g. a subject or in vivo, in vitro, or ex vivo cells, tissues, and organs). Exemplary routes of administration to the human body can be through the mouth (oral), skin (transdermal), oral mucosa (buccal), ear, by injection (e.g. intravenously, subcutaneously, intratumourally, intraperitoneally, etc.) and the like. The term administration of the binder of the invention includes direct administration of the binder as well as indirect administration by administering a nucleic acid encoding the binder such that the binder is produced from the nucleic acid in the subject. Administration of the binder thus includes DNA and RNA therapy methods that result in in vivo production of the binder.
Reference to “treat” or “treating” a tumour as used herein defines the achievement of at least one therapeutic effect, such as for example, reduced number of tumour cells, reduced tumour size, reduced rate to cancer cell infiltration into peripheral organs, or reduced rate of tumour metastasis or tumour growth. As used herein, the term “modulate” refers to the activity of a compound to affect (e.g. to promote or treated) an aspect of the cellular function including, but not limited to, cell growth, proliferation, invasion, angiogenesis, apoptosis, and the like.
Positive therapeutic effects in cancer can be measured in a number of ways (e.g. Weber (2009) J Nucl Med 50, 1 S-10S). By way of example, with respect to tumour growth inhibition, according to National Cancer Institute (NCI) standards, a T/C<42% is the minimum level of anti-tumour activity. A T/C<10% is considered a high anti-tumour activity level, with T/C (%) = Median tumour volume of the treated/Median tumour volume of the controlx100. In some embodiments, the treatment achieved by a therapeutically effective amount is any of progression free survival (PFS), disease free survival (DFS) or overall survival (OS). PFS, also referred to as “Time to Tumour Progression” indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease. DFS refers to the length of time during and after treatment that the patient remains free of disease. OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients.
Reference to “prevention” (or prophylaxis) as used herein refers to delaying or preventing the onset of the symptoms of the cancer. Prevention may be absolute (such that no disease occurs) or may be effective only in some individuals or for a limited amount of time.
In a preferred aspect of the invention the subject has an established tumour, that is the subject already has a tumour, e.g. that is classified as a solid tumour. As such, the invention as described herein can be used when the subject already has a tumour, such as a solid tumour. As such, the invention provides a therapeutic option that can be used to treat an existing tumour. In one aspect of the invention the subject has an existing solid tumour. The invention may be used as a prevention, or preferably as a treatment in subjects who already have a solid tumour. In one aspect the invention is not used as a preventative or prophylaxis. In one aspect, tumour regression may be enhanced, tumour growth may be impaired or reduced, and/or survival time may be enhanced using the invention as described herein, for example compared with other cancer treatments (for example standard-of care treatments for the a given cancer).
In one aspect of the invention the method of treatment or prevention of a tumour as described herein further comprises the step of identifying a subject who has tumour, preferably identifying a subject who has a solid tumour.
The dosage regimen of a therapy described herein that is effective to treat a patient having a tumour may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the therapy to elicit an anti-cancer response in the subject. Selection of an appropriate dosage will be within the capability of one skilled in the art. For example 0.01 , 0.1 , 0.3, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, or 50 mg/kg. In some embodiments, such quantity is a unit dosage amount (or a whole fraction thereof) appropriate for administration in accordance with a dosing regimen that has been determined to correlate with a desired or beneficial outcome when administered to a relevant population (i.e., with a therapeutic dosing regimen).
The binder according to any aspect of the invention or the nucleic acid encoding it as described herein may be in the form of a pharmaceutical composition which additionally comprises a pharmaceutically acceptable carrier, diluent or excipient. As used herein, the term “pharmaceutically acceptable carrier” or “pharmaceutically acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity. Pharmaceutically acceptable carriers enhance or stabilize the composition or can be used to facilitate preparation of the composition. Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible, as is known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289- 1329; Remington: The Science and Practice of Pharmacy, 21 st Ed. Pharmaceutical Press 2011 ; and subsequent versions thereof). Nonlimiting examples of said pharmaceutically acceptable carrier comprise any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents. Therefore, the present invention further provides the use of a binder of the invention in the manufacture of a medicament for the treatment of a tumour. These compositions include, for example, liquid, semi-solid and solid dosage formulations, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, tablets, pills, or liposomes. In some embodiments, a preferred form may depend on the intended mode of administration and/or therapeutic application. Pharmaceutical compositions containing the binder or the nucleic acid of the invention can be administered by any appropriate method known in the art, including, without limitation, oral, mucosal, by-inhalation, topical, buccal, nasal, rectal, or parenteral (e.g. intravenous, infusion, intratumoural, intranodal, subcutaneous, intraperitoneal, intramuscular, intradermal, transdermal, or other kinds of administration involving physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue). Such a formulation may, for example, be in a form of an injectable or infusible solution that is suitable for intradermal, intratumoural or subcutaneous administration, or for intravenous infusion. In a particular embodiment, the binder or nucleic acid is administered intravenously. The administration may involve intermittent dosing. Alternatively, administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time, simultaneously or between the administration of other compounds.
Formulations of the invention generally comprise therapeutically effective amounts of a binder of the invention. “Therapeutic levels”, “therapeutically effective amount” or “therapeutic amount” means an amount or a concentration of an active agent that has been administered that is appropriate to safely treat the condition to reduce or prevent a symptom of the condition.
In some embodiments, the binder can be prepared with carriers that protect it against rapid release and/or degradation, such as a controlled release formulation, such as implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used.
Those skilled in the art will appreciate, for example, that route of delivery (e.g., oral vs intravenous vs subcutaneous vs intratumoural, etc) may impact dose amount and/or required dose amount may impact route of delivery. For example, where particularly high concentrations of an agent within a particular site or location (e.g., within a tumour) are of interest, focused delivery (e.g., in this example, intratumoural delivery) may be desired and/or useful. Other factors to be considered when optimizing routes and/or dosing schedule for a given therapeutic regimen may include, for example, the particular cancer being treated (e.g., type, stage, location, etc.), the clinical condition of a subject (e.g., age, overall health, etc.), the presence or absence of combination therapy, and other factors known to medical practitioners. The pharmaceutical compositions typically should be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. Sterile injectable solutions can be prepared by incorporating the binder in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations as discussed herein. Sterile injectable formulations may be prepared using a non-toxic parenterally acceptable diluent or solvent. Each pharmaceutical composition for use in accordance with the present invention may include pharmaceutically acceptable dispersing agents, wetting agents, suspending agents, isotonic agents, coatings, antibacterial and antifungal agents, carriers, excipients, salts, or stabilizers are non-toxic to the subjects at the dosages and concentrations employed. Preferably, such a composition can further comprise a pharmaceutically acceptable carrier or excipient for use in the treatment of cancer that that is compatible with a given method and/or site of administration, for instance for parenteral (e.g. sub-cutaneous, intradermal, or intravenous injection), intratumoural, or peritumoural administration.
While an embodiment of the treatment method or compositions for use according to the present invention may not be effective in achieving a positive therapeutic effect in every subject, it should do so in a using pharmaceutical compositions and dosing regimens that are consistently with good medical practice and statistically significant number of subjects as determined by any statistical test known in the art such as the Student's t-test, the X2-test, the U-test according to Mann and Whitney, the Kruskal-Wallis test (H-test), Jonckheere-Terpstra test and the Wilcoxon-test.
Where hereinbefore and subsequently a tumour, a tumour disease, a carcinoma or a cancer is mentioned, also metastasis in the original organ or tissue and/or in any other location are implied alternatively or in addition, whatever the location of the tumour and/or metastasis is.
As discussed herein, the present invention relates to depleting regulatory T cells (T regs). Thus, in one aspect of the invention, treatment with the non-blocking CCR8 binder having cytotoxic activity depletes or reduces regulatory T cells, especially tumour-infiltrating regulatory T cells. In one aspect, the depletion is via ADCC. In another aspect, the depletion is via CDC. In a further aspect, the depletion is via ADCP.
As such, the invention provides a method for depleting regulatory T cells in a tumour in a subject, comprising administering to said subject a non-blocking CCR8 binder having cytotoxic activity. In a preferred embodiment Tregs are depleted in a solid tumour. By “depleted” it is meant that the number, ratio or percentage of Tregs is decreased relative to when the nonblocking CCR8 binder having cytotoxic activity, is not administered. In particular embodiments of the invention as described herein, over about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 99% of the tumour-infiltrating regulatory T cells are depleted.
As used herein, “regulatory T cells” (“Treg”, “Treg cells”, or “Tregs”) refer to a lineage of CD4+ T lymphocytes specialized in controlling autoimmunity, allergy and infection. Typically, they regulate the activities of T cell populations, but they can also influence certain innate immune system cell types. Tregs are usually identified by the expression of the biomarkers CD3, CD4, CD25, and CD127 or Foxp3. Naturally occurring T reg cells normally constitute about 5-10% of the peripheral CD4+ T lymphocytes. However, within a tumour microenvironment (i.e. tumourinfiltrating Treg cells), they can make up as much as 20-30% of the total CD4+ T lymphocyte population.
Activated human Treg cells may directly kill target cells such as effector T cells and APCs through perforin- or granzyme B-dependent pathways; cytotoxic T-lymphocyte-associated antigen 4 (CTLA4+) Treg cells induce indoleamine 2,3-dioxygenase (IDO) expression by APCs, and these in turn suppress T-cell activation by reducing tryptophan; Treg cells, may release interleukin-10 (IL-10) and transforming growth factor (TGFP) in vivo, and thus directly inhibit T-cell activation and suppress APC function by inhibiting expression of MHC molecules, CD80, CD86 and IL-12. Treg cells can also suppress immunity by expressing high levels of CTLA4 which can bind to CD80 and CD86 on antigen presenting cells and prevent proper activation of effector T cells. It is furthermore known that Treg cells express high levels of CD25, thereby competing with IL2 binding to CD8 and reducing CD8-induced proliferation and survival.
In a preferred embodiment of the present invention the ratio of effector T cells to regulatory T cells in a solid tumour is increased after administration of the binder of the invention. In some embodiments, the ratio of effector T cells to regulatory T cells in a solid tumour is increased to over 5, 10, 15, 20, 40 or 80.
An immune effector cell refers to an immune cell which is involved in the effector phase of an immune response. Exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g., B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils. Immune effector cells involved in the effector phase of an immune response express specific Fc receptors and carry out specific immune functions. An effector cell can induce antibodydependent cell-mediated cytotoxicity (ADCC), e.g., a neutrophil capable of inducing ADCC. For example, monocytes, macrophages, neutrophils, eosinophils, and lymphocytes which express FcaR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens. An effector cell can also phagocytose a target antigen, target cell, or microorganism. As discussed herein, antibodies according to the present invention may be optimised for ability to induce ADCC.
In preferred embodiments, the methods and compositions for depleting Tregs are specific for Tregs with limited to no impact on other T cells. In further embodiments, the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than other Tregs. In a further embodiment, the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than circulating Tregs. In yet another embodiment, the methods and compositions of the present invention deplete tumour-infiltrating Tregs to a greater extent than normal tissue-infiltrating Tregs, such as intestinal Tregs. Comparing the extent of depletion of cell populations is preferably performed by comparing the percentage decrease of the cell population without and with treatment, such as shown in the examples.
In a further particular embodiment, the methods and compositions of the invention decrease the ratio of Tregs over T-cells, in particular the ratio of Tregs over T-cells in a tumour. In a further embodiment, the methods and compositions of the invention decrease the ratio of T regs over T-cells in the tumour to a greater extent than the ratio of Tregs over T-cells outside of the tumour. In another embodiment, the methods and compositions of the invention decrease the ratio of Tregs over T-cells in the tumour to a greater extent than the ratio of Tregs over T-cells in normal tissue, in particular in intestinal tissue.
In yet a further aspect of the present invention, treatment with the hCCR8 binder having cytotoxic activity or the nucleic acid encoding the same as described herein depletes or reduces any type of cells expressing hCCR8. Preferably, the cells are tumour cells expressing hCCR8. Therefore, the invention provides a method for depleting cells, preferably tumour cells, in a subject, comprising administering to said subject a hCCR8 binder having cytotoxic activity or the nucleic acid encoding the same as described herein.
In some embodiments, a different agent against cancer may be administered in combination with the binder of the invention via the same or different routes of delivery and/or according to different schedules. Alternatively or additionally, in some embodiments, one or more doses of a first active agent is administered substantially simultaneously with, and in some embodiments via a common route and/or as part of a single composition with, one or more other active agents. Those skilled in the art will further appreciate that some embodiments of combination therapies provided in accordance with the present invention achieve synergistic effects; in some such embodiments, dose of one or more agents utilized in the combination may be materially different (e.g., lower) and/or may be delivered by an alternative route, than is standard, preferred, or necessary when that agent is utilized in a different therapeutic regimen (e.g., as monotherapy and/or as part of a different combination therapy).
In some embodiments, where two or more active agents are utilized in accordance with the present invention, such agents can be administered simultaneously or sequentially. In some embodiments, administration of one agent is specifically timed relative to administration of another agent. For example, in some embodiments, a first agent is administered so that a particular effect is observed (or expected to be observed, for example based on population studies showing a correlation between a given dosing regimen and the particular effect of interest). In some embodiments, desired relative dosing regimens for agents administered in combination may be assessed or determined empirically, for example using ex vivo, in vivo and/or in vitro models; in some embodiments, such assessment or empirical determination is made in vivo, in a patient population (e.g., so that a correlation is established), or alternatively in a particular patient of interest.
In another aspect of the invention, a non-blocking hCCR8 binder has improved therapeutic effects when combined with an immune checkpoint inhibitor. A combination therapy with a nonblocking hCCR8 binder and an immune checkpoint inhibitor can have synergistic effects in the treatment of established tumours. As such, the interaction between the PD-1 receptor and the PD-L1 ligand may be blocked, resulting in “PD-1 blockade”. In one aspect, the combination may lead to enhanced tumour regression, enhanced impairment or reduction of tumour growth, and/or survival time may be enhanced using the invention as described herein, for example compared with administration of the checkpoint inhibitor alone. Therefore, in a particular aspect of the invention, the present invention provides a hCCR8 binder of the invention for use in the treatment of a tumour, wherein the treatment further comprises administration of an immune checkpoint inhibitor.
As used herein, “immune checkpoint” or “immune checkpoint protein” refer to proteins belonging to inhibitory pathways in the immune system, in particular for the modulation of T- cell responses. Under normal physiological conditions, immune checkpoints are crucial to preventing autoimmunity, especially during a response to a pathogen. Cancer cells can alter the regulation of the expression of immune checkpoint proteins in order to avoid immune surveillance.
Examples of immune checkpoint proteins include but are not limited to PD-1 , CTLA-4, BTLA, KIR, CD155, B7H4, VISTA and TIM3, and also 0X40, GITR, 4-1 BB and HVEM. Immune checkpoint proteins may also refer to proteins which bind to other immune checkpoint proteins. Such proteins include PD-L1 , PD-L2, CD80, CD86, HVEM, LLT1 , and GAL9.
“Immune checkpoint protein inhibitor”, “immune checkpoint inhibitor”, or “checkpoint inhibitor” refers to any molecule that can interfere with the signalling and/or protein-protein interactions mediated by an immune checkpoint protein. In one aspect of the invention the immune checkpoint protein is PD-1 or PD-L1 . In a preferred aspect of the invention as described herein the immune checkpoint inhibitor interferes with PD-1/PD-L1 interactions via anti-PD-1 or anti PD-L1 antibodies.
In another particular embodiment, the immune checkpoint is CTLA-4 (also known as CTLA4, cytotoxic T-lymphocyte-associated protein 4 or CD152) and the immune checkpoint inhibitor is an inhibitor of CTLA-4. In a particular embodiment, the binder of the invention is used in the treatment of a tumour, wherein the treatment further comprises administration of a CTLA-4 inhibitor, in particular an anti-CTLA-4 antibody, particularly a blocking anti-CTLA-4 antibody. Anti-CTLA-4 antibodies of the instant invention can bind to an epitope on human CTLA-4 so as to inhibit CTLA-4 from interacting with a human B7 counter-receptor. Because interaction of human CTLA-4 with human B7 transduces a signal leading to inactivation of T-cells bearing the human CTLA-4 receptor, antagonism of the interaction effectively induces, augments or prolongs the activation of T cells bearing the human CTLA-4 receptor, thereby prolonging or augmenting an immune response. Anti-CTLA-4 antibodies are described in U.S. Pat. Nos. 5,811 ,097; 5,855,887; 6,051 ,227; in PCT Application Publication Nos. WO 01/14424 and WO 00/37504; and in U.S. Patent Publication No. 2002/0039581. Each of these references is specifically incorporated herein by reference for purposes of description of anti-CTLA-4 antibodies. An exemplary clinical anti-CTLA-4 antibody is human monoclonal antibody 10D1 as disclosed in WO 01/14424 and U.S. patent application Ser. No. 09/644,668. Antibody 10D1 has been administered in single and multiple doses, alone or in combination with a vaccine, chemotherapy, or interleukin-2 to more than 500 patients diagnosed with metastatic melanoma, prostate cancer, lymphoma, renal cell cancer, breast cancer, ovarian cancer, and HIV. Other anti-CTLA-4 antibodies encompassed by the methods of the present invention include, for example, those disclosed in: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al. (1998) Proc. Natl. Acad. Sci. USA 95(17):10067-10071 ; Camacho et al. (2004) J. Clin. Oncology 22(145): Abstract No. 2505 (antibody CP-675206); and Mokyr et al. (1998) Cancer Res. 58:5301 -5304. In certain embodiments, the methods of the instant invention comprise use of an anti-CTLA-4 antibody that is a human sequence antibody, preferably a monoclonal antibody and in another embodiment is monoclonal antibody 10D1. In another particular embodiment, the CTLA-4 inhibitor is ipilimumab or tremelimumab.
PD-1 (Programmed cell Death protein 1 ), also known as CD279, is a cell surface receptor expressed on activated T cells and B cells. Interaction with its ligands has been shown to attenuate T-cell responses both in vitro and in vivo. PD-1 binds two ligands, PD-L1 and PD- L2. PD-1 belongs to the immunoglobulin superfamily. PD-1 signaling requires binding to a PD- 1 ligand in close proximity to a peptide antigen presented by major histocompatibility complex (MHC) (Freeman, Proc Natl Acad Sci USA 105, 10275-6 (2008)). Therefore, proteins, antibodies or small molecules that prevent co-ligation of PD-1 and TCR on the T cell membrane are useful PD-1 antagonists.
In one embodiment, the PD-1 receptor antagonist is an anti-PD-1 antibody, or an antigen binding fragment thereof, which specifically binds to PD-1 and blocks the binding of PD-L1 to PD-1 . The anti-PD-1 antibody may be a monoclonal antibody. The anti-PD-1 antibody may be a human or humanised antibody. An anti-PD-1 antibody is an antibody capable of specific binding to the PD-1 receptor. Anti-PD-1 antibodies known in the art and suitable for the invention include nivolumab, pembrolizumab, pidilizumab, BMS-936559, and toripalimab.
PD-1 antagonists of the present invention also include compounds or agents that either bind to and/or block a ligand of PD-1 to interfere with or inhibit the binding of the ligand to the PD-1 receptor, or bind directly to and block the PD-1 receptor without inducing inhibitory signal transduction through the PD-1 receptor. In particular PD-1 antagonists include small molecules inhibitors of the PD-1/PD-L1 signalling pathway. Alternatively, the PD-1 receptor antagonist can bind directly to the PD-1 receptor without triggering inhibitory signal transduction and also binds to a ligand of the PD-1 receptor to reduce or inhibit the ligand from triggering signal transduction through the PD-1 receptor. By reducing the number and/or amount of ligands that bind to PD-1 receptor and trigger the transduction of an inhibitory signal, fewer cells are attenuated by the negative signal delivered by PD-1 signal transduction and a more robust immune response can be achieved.
In one embodiment, the PD-1 receptor antagonist is an anti-PD-L1 antibody, or an antigen binding fragment thereof, which specifically binds to PD-L1 and blocks the binding of PD-L1 to PD-1. The anti-PD-L1 antibody may be a monoclonal antibody. The anti-PD-L1 antibody may be a human or humanized antibody, such as atezolizumab (MPDL3280A) or avelumab. Any aspect of the invention as described herein may be performed in combination with additional therapeutic agents, in particular additional cancer therapies. In particular, the hCCR8 binder and, optionally, the immune checkpoint inhibitor according to the present invention may be administered in combination with co-stimulatory antibodies, chemotherapy and/or radiotherapy (by applying irradiation externally to the body or by administering radioconjugated compounds), cytokine-based therapy, targeted therapy, monoclonal antibody therapy, or any combination thereof.
A chemotherapeutic entity for combination therapy as used herein refers to an entity which is destructive to a cell, that is the entity reduces the viability of the cell. The chemotherapeutic entity may be a cytotoxic drug. A chemotherapeutic agent contemplated includes, without limitation, alkylating agents, anthracyclines, epothilones, nitrosoureas, ethylenimines/methylmelamine, alkyl sulfonates, alkylating agents, antimetabolites, pyrimidine analogs, epipodophylotoxins, enzymes such as L-asparaginase; biological response modifiers such asIFN-y, IL-2, IL-12, and G-CSF; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin, anthracenediones, substituted urea such as hydroxyurea, methylhydrazine derivatives including N-methylhydrazine (MIH) and procarbazine, adrenocortical suppressants such as mitotane (o,p'-DDD) and aminoglutethimide; hormones and antagonists including adrenocorticosteroid antagonists such as prednisone and equivalents, dexamethasone and aminoglutethimide; progestin such as hydroxyprogesterone caproate, medroxyprogesterone acetate and megestrol acetate; estrogen such as diethylstilbestrol and ethinyl estradiol equivalents; antiestrogen such as tamoxifen; androgens including testosterone propionate and fluoxymesterone/equivalents; antiandrogens such as flutamide, gonadotropin-releasing hormone analogs and leuprolide; and non-steroidal antiandrogens such as flutamide.
The additional cancer therapy may be other antibodies or small molecule reagents that reduce immune regulation in the periphery and within the tumour microenvironment, for example molecules that target TGFbeta pathways, IDO (indoleamine deoxigenase), Arginase, and/or CSF1 R.
‘In combination’ or treatments comprising administration of a further therapeutic may refer to administration of the additional therapy before, at the same time as or after administration of any aspect according to the present invention. Combination treatments can thus be administered simultaneous, separate or sequential.
In another embodiment, the invention provides a kit comprising any of the binders as described above. In some embodiments, the kit further contains a pharmaceutically acceptable carrier or excipient. In other related embodiments, any of the components of the above combinations in the kit are present in a unit dose, in particular the dosages as described herein. In a yet further embodiment, the kit includes instructions for use in administering any of the components or the above combinations to a subject. In one particular embodiment, the kit comprises a hCCR8 binder as described herein and an immune checkpoint inhibitor, such as a PD-1 or PD-L1 inhibitor. The hCCR8 binder and the immune checkpoint inhibitor can be present in the same or in a different composition.
In one particular embodiment, the present invention provides a package comprising a binder as described herein, wherein the package further comprises a leaflet with instructions to administer the binder to a tumour patient that also receives treatment with an immune checkpoint inhibitor.
Diagnosis
The hCCR8 binder as described herein can further be used for predicting, diagnosing, prognosticating and/or monitoring diseases or conditions in subjects. In a particular embodiment, the invention provides a method for monitoring a cellular population expressing hCCR8 comprising contacting the cellular population with a hCCR8 binder that does not inhibit the binding of hCCL1 to hCCR8 or signalling of hCCL1 via hCCR8, as disclosed herein. In a further embodiment, the invention provides the use of a non-blocking hCCR8 binder as described herein as a companion diagnostic in a method for treating a disease in a subject comprising administering an hCCL1 to said subject.
As used herein, the terms “diagnosing” or “diagnosis” generally refer to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition). As used herein, “diagnosis of a disease” in a subject may particularly mean that the subject has said disease, hence, is diagnosed as having said disease. A subject may be diagnosed as taught herein as not having said disease despite displaying one or more conventional symptoms or signs reminiscent thereof.
As used herein, the terms “prognosticating” or “prognosis” generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of a disease may generally encompass anticipation of a satisfactory partial or complete recovery from said disease, preferably within an acceptable time period. A good prognosis of said disease may more commonly encompass anticipation of not further worsening or aggravating of the conditions, preferably within a given time period. A poor prognosis of a disease may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of said disease.
In one aspect, the present invention concerns a non-blocking hCCR8 binder according to the invention for use in a method for diagnosing, predicating and/or prognosticating diseases associated with variations in the expression and/or activity of human CCR8. In other words, the invention provides an (in vitro) method for diagnosing predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CCR8 in a subject, wherein the method comprises measuring the quantity of CCR8 in a sample from the subject.
In a further aspect, the present invention concerns a non-blocking hCCR8 binder according to the invention for use in a method for diagnosing, predicating and/or prognosticating diseases associated with variations in the expression and/or activity of human CCL1 . In other words, the invention provides an (in vitro) method for diagnosing predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CLL1 in a subject, wherein the method comprises measuring the quantity of CCR8 in a sample from the subject.
According to another aspect, the invention concerns a kit for diagnosing, predicating and/or prognosticating a disease associated with variations of the expression and/or the activity of CCR8 and/or CCL1 comprising means for measuring the quantity of hCCR8 by using the nonblocking hCCR8 binder as described herein. According to a preferred embodiment, said kit comprises a reference control obtained from a subject not suffering from said disease or having a known diagnosis, prediction and/or prognosis of said disease.
In an embodiment, the hCCR8 binder as described above may be advantageously immobilised on a solid phase or support.
Said kit can also comprise a known quantity or concentration of hCCR8 and/or a fragment thereof, e.g. for use as controls, standards and/or calibrators. It can also comprise means for collecting the sample from the subject.
An advantage of the binders of the invention, and in particular to the binders described herein that lack cytotoxic activity, is that they are suitable for diagnostic in vivo use. As they are nonblocking and in the absence of a cytotoxic moiety, the binders of the invention can be administered to a subject without influencing therapeutic treatment. For example, the singledomain antibody moieties described herein, such as the VHH molecules specified herein before and in the examples, can be administered e.g. for imaging purposes while the patient undergoes treatment, such as with an anti-cancer drug, such as Treg depletion therapy. The non-blocking and non-cytotoxic binders can be used for imaging purposes, e.g. to monitor efficacious CCR8-expressing Treg depletion. Therefore, in a particular embodiment, the present invention provides a CCR8 binder comprising a CCR8 binding moiety as described herein and a detectable label. The detectable label may be detectable using e.g. radioactive, optical, magnetic resonance, and ultrasound approaches. In a particular embodiment, the detectable label is a fluorescent label. In a particular embodiment, the CCR8 binder of the invention, preferably lacking a cytotoxic moiety, is used for monitoring therapy with a noncompeting CCR8 binder. In another embodiment, the CCR8 binder of the invention, preferably lacking a cytotoxic moiety, is used for monitoring therapy with an anti-CCR8 antibody that is a blocking binder of hCCR8. In particular, the anti-CCR8 antibody that is a blocking binder of hCCR8 is one of the antibodies disclosed in WO2020138489 A1 , more in particular an anti- CCR8 antibody comprising a light chain variable region comprising SEQ ID NO:59 and heavy chain variable region comprising SEQ ID NO: 41 of WQ2020138489 A1. In another embodiment, comprising the light chain constant region comprises SEQ ID NO: 52 and the heavy chain constant region comprises SEQ ID NO: 53 of WQ2020138489 A1 .
EXAMPLES
The following examples are provided in order to demonstrate and further illustrate certain preferred embodiments and aspects of the present invention and are not construed as limiting the scope thereof.
I. GENERATION AND FUNCTIONAL CHARACTERIZATION OF BLOCKING AND NONBLOCKING BINDERS OF MOUSE CCR8 (mCCR8)
Example 1. Generation of mCCR8-targeting single-domain antibody moieties mCCR8 DNA Immunization
Immunization of llamas and alpacas with mouse CCR8 DNA was performed essentially as disclosed in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media). Briefly, animals were immunized four times at two week intervals with 2 mg of DNA encoding mouse CCR8 inserted into the expression vector pVAX1 (ThermoFisher Scientific Inc., V26020), after which blood samples were taken. Three months later, all animals received a single administration of 2 mg the same DNA, after which blood samples were taken.
Phaoe display library preparation
Phage display libraries derived from peripheral blood mononuclear cells (PBMCs) were prepared and used as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media). The VHH fragments were inserted into a M13 phagemid vector containing MYC and His6 tags. The libraries were rescued by infecting exponentially-growing Escherichia coli TG [(F’ traD36 proAB lacIqZ AM15) supE thi-1 A(lac- proAB) A(mcrB-hsdSM)5(rK- mK-)] cells followed by surinfection with VCSM13 helper phage.
Phage display libraries were subjected to two consecutive selection rounds on HEK293T cells transiently transfected with mouse CCR8 inserted into pVAX1 followed by CHO-K1 cells transiently transfected with mouse CCR8 inserted into pVAX1 . Polyclonal phagemid DNA was prepared from E. coli TG1 cells infected with the eluted phages from the second selection rounds. The VHH fragments were amplified by means of PCR from these samples and subcloned into an E. coli expression vector, in frame with N-terminal PelB signal peptide and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG cells were transformed with the resulting VHH-expression plasmid ligation mixture and individual colonies were grown in 96-deep-well plates. Monoclonal VHHs were expressed essentially as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693). The crude periplasmic extracts containing the VHHs were prepared by freezing the bacterial pellets overnight followed by resuspension in PBS and centrifugation to remove cellular debris.
Figure imgf000046_0001
Screening for mCCR8 selection outputs
Recombinant cells expressing mCCR8 were recovered using cell dissociated non-enzymatic solution (Sigma Aldrich, C5914-100mL) and resuspended to a final concentration of 1.0 x 106 cells/ml in FACS buffer. Dilutions (1 :5 in FACS buffer) of crude periplasmic extracts containing VHHs were incubated with mouse anti-FLAG biotinylated antibody (Sigma Aldrich, F9291 - 1 MG) at 5 ng/ml in FACS buffer for 30 min with shaking at room temperature. Cell suspensions were distributed into 96-well v-bottom plates and incubated with the VHH/antibody mixture with one hour with shaking on ice. Binding of VHHs to cells was detected with streptavidin R-PE (Invitrogen, SA10044) at 1 :400 dilution (0.18 pg/ml) in FACS buffer, incubated for 30 minutes in the dark with shaking on ice. Surface expression of mCCR8 on transiently transfected cell lines was confirmed by means of PE anti-mouse CCR8 (Biolegend, 150311 ) antibody at 2 pg/ml.
VHH clones resulting from the mouse CCR8 immunization and selection campaign were screened by means of flow cytometry for binding to HEK293 cells previously transfected with mCCR8 or with N-terminal deletion mouse CCR8 (delta16-3XHA) plasmid DNA, in comparison to mock-transfected control cells. Comparison of the binding (median fluorescent intensity) signal of a given VHH clone across the three cell lines enabled classification of said clone as an N-terminal mouse CCR8 binder (i.e. binding on mCCR8 cells, but not on mouse CCR8 (delta16-3XHA) or control cells) or as an extracellular loop mCCR8 binder (i.e. binding on mCCR8 cells and on mouse CCR8 (delta16-3XHA), but not on control cells).
Example 3. Purification and evaluation of monovalent VHHs
Synthetic DNA fragments encoding mCCR8-binding VHHs were subcloned into an E. coli expression vector under control of an IPTG-inducible lac promoter, infra me with N-terminal PelB signal peptide for periplasmic compartment-targeting and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG1 cells were transformed and the resulting clones were sequenced. VHH proteins were purified from these clones by IMAC chromatography followed by desalting, essentially as described in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
Two purified VHHs (VHH-01 and VHH-06, herein after) obtained from the mouse CCR8 immunization campaign were selected and evaluated by flow cytometry for their binding to mCCR8 as compared with N-terminal deletion mCCR8. The results of this assessment are summarized in Figure 1 . VHH-01 binds to both full-length and N-terminal deletion mouse CCR8 whereas VHH-06 only binds to full-length mouse CCR8.
Example 4. Binding and functional characterization for monovalent VHHs cAMP Homogenous Time Resolved Fluorescence (HTRF) assay The two selected monovalent VHHs (VHH-01 and VHH-06) were evaluated for their potential to functionally inhibit mouse CCL1 signalling on CHO-K1 cells displaying mouse CCR8 in cAMP accumulation experiments.
CHO-K1 cells stably expressing recombinant mouse CCR8 were grown prior to the test in media without antibiotic and detached by flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended in KHR buffer (5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Gluclose, 1.25 mM KH2PO4, 1.45 mM CaCI2, 0.5 g/l BSA, supplemented with 1 mM IBMX). Twelve microliters of cells were mixed with six microliters of VHH (final concentration: 1 pM) in triplicate and incubated for 30 minutes. Thereafter, six microliters of a mixture of forskolin and mouse CCL1 (R&D Systems, 845-TC) was added at a final concentration corresponding to its EC80 value. The plates were then incubated for 30 min at room temperature. After addition of the lysis buffer and 1 hour incubation, fluorescence ratios were measured with the HTRF kit (Cisbio, 62AM9PE) according to the manufacturer’s specification.
At 1 pM, VHH-01 inhibited CCL1 action on cAMP levels, whereas VHH-06 did not alter cAMP levels over the control (PBS). These data indicate that VHH-01 is a blocking binder of CCR8, while VHH-06 is a non-blocking binder.
Ca2+ release assay
The potential of VHH-01 to functionally inhibit mouse CCL1 signalling on CHO-K1 cells displaying mCCR8 was further evaluated in Ca2+ release experiments.
Recombinant cells (CHO-K1 mt-aequorin stably expressing mouse CCR8) were grown 18 hours in media without antibiotics and detached gently by flushing with PBSEDTA (5 mM EDTA), recovered by centrifugation and resuspended in assay buffer (DMEM/HAM’s F12 with HEPES + 0.1% BSA protease free). Cells were then incubated at room temperature for at least 4 hours with Coelenterazine h (Molecular Probes). Thirty minutes after the first injection of 100 pl of a mixture e of cells and VHHs (final concentration: 1 pM), 100 pl of mouse CCL1 (R&D Systems, 845-TC) was added at a final concentration corresponding to its EC80 value and injected into the mixture. The resulting spectral emission was recorded using a Functional Drug Screening System 6000 (FDSS 6000, Hamamatsu).
VHH-01 indeed led to a strong inhibition of Ca2+ release by 94%, confirming that VHH-01 is a blocking binder of mouse CCR8. Example 5. Synthesis and purification of blocking and non-blocking VHH-Fc fusions
In order to compare the effects of a non-blocking mCCR8 binder with a blocking mCCR8 binder, two VHH-Fc constructs (VHH-Fc-14 and VHH-Fc-25) were generated by combining anti-CCR8 VHHs to the mouse lgG2a Fc domain, separated by flexible GlySer linkers (10GS, which refers to two repeats of SEQ ID NO: 20 and, thus, having 10 amino acids in length). Construct VHH-Fc-25 contains two VHH-06 binders, whereas VHH-Fc-14 contains two VHH- 01 binders in addition to two VHH-06 binders. A schematic representation of the VHH-Fc-14 and VHH-Fc-25 constructs is provided in Figure 2. Thus, VHH-Fc-25 is a non-blocking CCR8 binder with cytotoxic activity (ADCC) derived from the Fc domain. VHH-Fc-14 is identical to VHH-Fc-25, except for the additional blocking CCR8 domains.
The constructs were cloned in a pcDNA3.4 mammalian expression vector, in frame with the mouse Ig heavy chain V region 102 signal peptide to direct the expressed recombinant proteins to the extracellular environment. DNA synthesis and cloning, cell transfection, protein production in Expi293F cells and protein A purification were done by Genscript (GenScript Biotech B.V., Leiden, Netherlands).
Example 6. Confirmation of mCCR8 binding by VHH-Fc fusions
The multivalent VHH-Fc fusions VHH-Fc-14 and VHH-Fc-25 were evaluated for their ability to bind to mouse CCR8 endogenously expressed on BW5147 cells by means of flow cytometry experiments. Cells were incubated with different concentrations of the multivalent VHH-Fc fusions for 30 minutes at 4°C, followed by two washes with FACS buffer, followed by 30 minutes incubation at 4°C with AF488 goat anti-mouse IgG (Life Technologies, A1 1029) or AF488 donkey anti-rat IgG (Life Technologies, A21208), followed by two washing steps. Dead cells were stained using TOPRO3 (Thermo Fisher Scientific, T3605).
The binding of VHH-Fc-14 and VHH-Fc-25 to mouse CCR8 are highly comparable, with pEC50 values of respectively 9.14 ± 0.39 M (n=6) and9.49 ± 0.17 M (n=3) (mean ± standard deviation).
Example 7. Functional inhibition by blocking and non-blocking VHH-Fc fusions
Apoptosis assay
VHH-Fc-14 and VHH-Fc-25 fusions were compared in an apoptosis assay for their ability to functionally inhibit the action of the agonistic ligand mCCL1 . Dexamethasone induces cell death in mouse lymphoma BW5147 cells that endogenously express CCR8. The dexamethasone-induced cell death can be reversed by addition of the antagonist ligand CCL1 (Van Snick et aL, 1996, Journal of immunology, 157, 2570-2576; Louahed et aL, 2003, European Journal of Immunology, 33, 494-501 ; Spinetti et aL, 2003, Journal of Leukocyte Biology, 73, 201 -207; Denis et aL, 2012, PLOS One, 7, e34199). 50 pl of cells (seeded at 2.75 x 104 cells/ml in Iscove-Dulbecco’s medium + 10% FBS, 50 pM 2-ME, 1.25 mM l-glutamine) were incubated with 30 pl of serial dilutions of the VHH-Fc fusions and incubated for 30 minutes at 37°C. Next, a 20 pl mixture of dexamethasone (Sigma-Aldrich, D4902) and human CCL1 (Biolegend, 582706) was added to a final concentration of 10 nM each. After 48 hours incubation at 37°C, cell viability was quantified using the ATPIite 1 -step lit according to the manufacturer’s instructions (Perkin Elmer, 6016736). These results of this assessment are depicted in Figure 3.
The VHH-Fc fusion VHH-Fc-14 that carries both building blocks VHH-01 (blocking) and VHH- 06 (non-blocking) provides strong functional inhibition in the assay with a plC50 value of 9.29 ± 0.22 M (n=9) (mean ± standard deviation). By contrast, the VHH-Fc fusion VHH-Fc-25, carrying two copies of building block VHH-06, does not impart functional inhibition. These data confirm that VHH-Fc-25 is a non-blocking CCR8 binder, while the addition of blocking VHH-01 domains in VHH-Fc-14 introduces blocking activity. cAMP assay
VHH-Fc-14 was tested in the cAMP assay as described in example 4. VHH-Fc-14 provides for a 100% inhibition of the cAMP signal at a concentration of 50 nM and higher, with a plC50 value of 8.54 M, again confirming that it is a blocking CCR8 binder.
Figure imgf000050_0001
Blocking VHH-Fc fusions affect intestinal Treg levels
In order to study the effects of cytotoxic blocking mouse CCR8 binders on intratumoural and other Treg levels, VHH-Fc-14 was modified to obtain VHH-Fc fusions with increased and abolished ADCC activity. Increased ADCC activity was obtained through a-fucosylation of VHH-Fc-14 (VHH-Fc-43). Alternatively, ADCC activity was abolished in VHH-Fc-14 through insertion of the LALAPG Fc mutations (VHH-Fc-41 ) (Lo et aL, 2017, Journal of Biological Chemistry, 292, 3900-3908). Constructs were cloned in mammalian expression vector pQMCF vector in frame with a secretory signal peptide and transfected to CHOEBNALT85 1 E9 cells, followed by expression, protein A and gel filtration chromatography (Icosagen Cell Factory, Tartu, Estonia). Versions with a-fucosylated N-glycans in the CH2 domain of the Fc moiety were obtained from expressions in a CHOEBNALT85 cell line that carries GlymaxX technology (ProBioGen AG, Berlin, Germany) (Icosagen Cell Factory, Tartu, Estonia). Proteins were 0.22 mm sterile filtrated. Protein concentration was determined by measurement of absorbance at 280 nm and purity was determined by SDS-PAGE and size exclusion chromatography. Endotoxin levels were assessed by LAL test (Charles-River Endochrome). The control, mlgG2a isotype, was purchased from BioXCell. VHH-Fc-41 (pEC50 value of 9.33 M (n=1 )) and VHH-Fc-43 (pEC50 value of 9.23 ± 0.17 M (n=2)) bind comparably to CCR8 on BW5147 cells. In addition, both VHH-Fc-41 (plC50 value of 9.51 ± 0.02 M (n=2)) and VHH- Fc-43 (plC50 value of 9.39 ± 0.11 M (n=4)) (mean ± standard deviation) potently inhibit the action of CCL1 in the BW147 apoptosis assay. All values are show as mean ± standard deviation.
To test the effects of these blocking mCCR8 VHH-Fc fusions with and without ADCC activity, 3 x 106 cells LLC-OVA cells (200pl) were subcutaneously injected in female C57BL/6 mice (6- 12 weeks). At day 4, mice were treated with 200pg of anti-CCR8 VHH-Fc (VHH-Fc-41 or VHH- Fc-43) or mouse lgG2a (control) once weekly (i.e. day 4, 11 ) (nmiCe/group=5).
At day16 mice were sacrificed and tumour, blood and intestines were harvested from each mouse.
Tumour single cell suspensions were obtained by cutting the tissues in small pieces, followed by treatment with 10 U ml-1 collagenase I, 400 U ml-1 collagenase IV and 30 U ml-1 DNasel (Worthington) for 25 minutes at 37°C. The tissues were subsequently squashed and filtered (70pm). The obtained cell suspensions were removed of red blood cells using erythrocyte lysis buffer (155mM NH4CI, 10mM KHCO3, 500mM EDTA), followed by neutralization with RPML Blood was depleted of red blood cells through repeated rounds of incubation for 5 minutes in erythrocyte lysis buffer until only leukocytes remained. Intestinal single cell suspensions were prepared as previously described (C. C. Bain, A. McL Mowat, CD200 receptor and macrophage function in the intestine, Immunobiology 217, 643-651 (2012) ). After erythrocyte lysis, the obtained single cell suspensions were resuspended in FACS buffer (PBS enriched with 2% FCS and 2mM EDTA) and counted. All single cell suspensions were pre-incubated with rat anti-mouse CD16/CD32 (2.4G2; BD Biosciences) or anti-human Fc block reagent (Miltenyi) for 15 minutes prior to staining. After washing, the samples were stained with fixable viability dye eFluor506 (eBioscience) (1 :200) for 30 minutes at 4°C and in the dark. Subsequently, the samples were washed and stained for 30 minutes at 4°C and in the dark. The intracellular staining of cytokines/chemokines and transcription factors was done according to the manufacturers protocol (Cat N° 554715; BD Biosciences) and (Cat N° 00- 5523; Invitrogen), respectively. FACS data were acquired using the BD FACSCantoll (BD Biosciences) and analyzed using FlowJo (TreeStar, Inc.).
As is shown in Fig. 4, Tregs are depleted in the tumour by VHH-Fc-43, which is a mCCR8 blocking Fc fusion with ADCC activity, while no intratumoural Treg depletion is observed for VHH-Fc-41 , which lacks ADCC activity. No depletion of circulating Tregs was observed for either construct (Fig. 5). Reduced Treg levels, however, were observed in the intestines with both VHH-Fc molecules (with ADCC and without ADCC- functionality), showing that this observed reduction in Treg levels in the intestines is due to functionally blocking mCCR8 rather than cytotoxic effects of the mCCR8 binder (Fig. 6). This indicates that a non-blocking mCCR8 binder with cytotoxic activity is preferred and avoids side effects on Treg populations outside of the tumour environment.
Example 9. Effects of cytotoxic non-blocking mCCR8 binders on tumour growth in syngeneic LLC-OVA mouse model
To confirm the efficacy of cytotoxic non-blocking mCCR8 binders for tumour treatment, the syngeneic mouse LLC-OVA model was used.
3 x 106 cells LLC-OVA cells (200pl) were subcutaneously injected in female C57BL/6 mice (6- 12 weeks). At day 4, mice were treated with 200pg of anti-CCR8 VHH-Fc (VHH-Fc-14 or VHH- Fc-25) or mouse lgG2a (control) once weekly (i.e. day 4, 11 ) (nmiCe /grouP=5). Tumours were calipered in two dimensions to monitor growth.
Tumour size, in mm3, was calculated using the following formula:
Tumor Volume = n(w2x 0/6 where w= width and l=length, in mm, of the tumour.
The median tumour size (in mm3) for all the different cohorts is described in Fig. 7.
The cohorts treated with a VHH-Fc-14 and VHH-Fc-25 showed from day 11 a lower tumour size in comparison with the isotype control. The non-blocking mCCR8 binder VHH-Fc-25 shows the same efficacy in comparison to blocking mCCR8 binder VHH-Fc-14. These data show that cytotoxic non-blocking mCCR8 binders are efficacious for tumour treatment, while having a safer profile than blocking mCCR8 Treg depleters. Example 10. Effects of cytotoxic non-blocking mCCR8 binders on tumour growth in MC38 syngeneic mouse model
To confirm the efficacy of cytotoxic non-blocking mCCR8 binders for tumour treatment, the mouse MC38 model was used.
5x105 MC38 cells (100pl) were subcutaneously injected in female C57BL/6J mice (7-9 weeks). At day 7 (tumours average size =118 mm3) mice were sorted into different groups. The different cohorts consist of 10 mice for each condition, and each group of mice was intraperitoneal injected with 200pg of mouse lgG2a (control), VHH-Fc-14 or VHH-Fc-25 biweekly for 3 weeks. Bodyweight and tumour size were measured biweekly.
Tumours were calipered in two dimensions to monitor growth. Tumour size, in mm3, was calculated using the following formula:
Tumor Volume = (w2x l)x 0.52 where w= width and l=length, in mm, of the tumour.
The median tumour size (in mm3) for all the different cohorts is described in Fig. 8. The cohorts treated with a VHH-Fc-14 and VHH-Fc-25 showed from day 18 a significantly lower tumour size in comparison with the isotype control, leading to tumour stasis or regression in a part of the mice treated with the mCCR8 binders with ADCC activity.
Surprisingly, despite the indications in the prior art that mCCR8 blockade is important for tumour treatment, the non-blocking mCCR8 binder VHH-Fc-25 shows the same and even slightly higher efficacy in comparison to blocking mCCR8 binder VHH-Fc-14. These data show that cytotoxic non-blocking mCCR8 binders are efficacious for tumour treatment, while having a safer profile than blocking mCCR8 Treg depleters.
II. GENERATION AND FUNCTIONAL CHARACTERIZATION OF BLOCKING AND NONBLOCKING BINDERS OF HUMAN CCR8 (hCCR8)
Three anti-human CCR8 blocking monoclonal antibodies, Human L263G8, ONCC8 and ONCC10 were used as control for the experiments described below. The sequence of ONCC8 was obtained by cloning the sequences of a light chain variable region and a heavy chain variable region from W02020/0138489 A1 (corresponding respectively to SEQ ID NO: 59 and SEQ ID NO: 41 of W02020/0138489 A1 ) into a human IgG 1 backbone, whereas the sequence of ONCC10 was obtained by cloning the heavy chain and light chain variable region sequences from mAb 433H of W02007/044756 A1 into a human lgG1 backbone. Production of these antibodies was performed in HEK293 cells by Icosagen (Icosagen, Tartu, Estonia) or in CHO cells by Evitria (Evitria, Zurich, Switzeland). Finally, Human L263G8 is a commercial mouse anti-hCCR8/CD198 lgG2a monoclonal antibody which was obtained from Biolegend (Biolegend, clone N° L263G8, 360603).
Figure imgf000054_0001
Generation of hCCR8-targeting single-domain antibody moieties hCCR8 DNA Immunization
Immunization of llamas and alpacas with human CCR8 DNA was performed essentially as disclosed in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media). Briefly, animals were immunized four times at two-week intervals with 2 mg of DNA encoding human CCR8 inserted into the expression vector pVAX1 (ThermoFisher Scientific Inc., V26020), after which blood samples were taken. Three months later, all animals received three injections of 2 mg of the same DNA, after which blood samples were taken.
Phage display library preparation
Phage display libraries derived from peripheral blood mononuclear cells (PBMCs) were prepared and used as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693) and Henry K.A. and MacKenzie C.R. eds. (Single-Domain Antibodies: Biology, Engineering and Emerging Applications. Lausanne: Frontiers Media). The VHH fragments were inserted into a M13 phagemid vector containing MYC and His6 tags. The libraries were rescued by infecting exponentially-growing Escherichia coli TG [(F’ traD36 proAB lacIqZ AM15) supE thi-1 A(lac- proAB) A(mcrB-hsdSM)5(rK- mK-)] cells followed by surinfection with VCSM13 helper phage.
Phage display libraries were subjected to two consecutive selection rounds on HEK293T cells transiently transfected with human CCR8 inserted into pcDNA3.1 (ThermoFisher Scientific Inc., V79020) followed by CHO-K1 cells transiently transfected with human CCR8 inserted into pcDNA3.1. Polyclonal phagemid DNA was prepared from E. coli TG cells infected with the eluted phages from the second selection rounds. The VHH fragments were amplified by means of PCR from these samples and subcloned into an E. coli expression vector, in frame with N- terminal PelB signal peptide and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG1 cells were transformed with the resulting VHH-expression plasmid ligation mixture and individual colonies were grown in 96-deep-well plates. Monoclonal VHHs were expressed essentially as described in Pardon E., et al. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693). The crude periplasmic extracts containing the VHHs were prepared by freezing the bacterial pellets overnight followed by resuspension in PBS and centrifugation to remove cellular debris.
Example 12. Generation of stable hCCR8 cell lines
Culturing of human embryonic kidney cell line HEK293 (ATTC N° CRL-1573) was performed at 37°C and 5% CO2 in Dulbecco’s Modified Eagle Medium (DMDM, Gibco) supplemented with 10% heat-inactivated fetal bovine serum (FBS) and 100 U/ml penicillin and streptomycin (Gibco). Before transfection, cells were seeded at a density of 7.5 x 105 cells/well of 6-well plates (Greiner) and cultured overnight. Upon reaching an approximate confluence of 40%, cells were transfected with linearized pcDNA3.1 encoding human CCR8 using FUGENE HD transection reagent (Promega). After 6 hours, cellular supernatants were carefully removed and replaced by fresh complete DMEM. After 48 hours, culture medium was replaced to include 500 pg/ml G-418 (ThermoFisher Scientific Inc.) to select for gentamycin-resistant transfectants harbouring the expression cassette. Medium was changed every 2-3 days. After 3 weeks, limiting 1 :2 dilutions were made starting from 103 cells per well to obtain monoclonal lines. Identification of hCCR8-expressing monoclonal lines was based on acquiring 104 cells in flow cytometry (Attune NxT, ThermoFisher Scientific Inc.) using a phycoerythrin-labelled mouse anti-hCCR8/CD198 lgG2a (Biolegend, clone N° L263G8, 360603).
Example 13. Screening for hCCR8 selection outputs
Recombinant cells expressing hCCR8 were recovered using cell dissociated non-enzymatic solution (Sigma Aldrich, C5914-100mL) and resuspended to a final concentration of 1.0 x 106 cells/ml in FACS buffer. Dilutions (1 :5 in FACS buffer) of crude periplasmic extracts containing VHHs were incubated with mouse anti-FLAG biotinylated antibody (Sigma Aldrich, F9291 - 1 MG) at 5 pg/ml in FACS buffer for 30 min with shaking at room temperature. Cell suspensions were distributed into 96-well v-bottom plates and incubated with the VHH/antibody mixture with one hour with shaking on ice. Binding of VHHs to cells was detected with streptavidin R-PE (Invitrogen, SA10044) at 1 :400 dilution (0.18 pg/ml) in FACS buffer, incubated for 30 minutes in the dark with shaking on ice. Surface expression of human CCR8 on transiently transfected cell lines was confirmed by means of PE anti-human CCR8 (Biolegend, 360603) antibody at 2 Hg/ml.
Example 14. Purification and evaluation of monovalent VHHs
Synthetic DNA fragments encoding hCCR8-binding VHHs were subcloned into an E. coli expression vector under control of an IPTG-inducible lac promoter, in frame with N-terminal PelB signal peptide for periplasmic compartment-targeting and C-terminal FLAG3 and His6 tags. Electrocompetent E. coli TG1 cells were transformed and the resulting clones were sequenced. VHH proteins were purified from these clones by IMAC chromatography followed by desalting, essentially as described in Pardon E., etal. (A general protocol for the generation of Nanobodies for structural biology, Nature Protocols, 2014, 9(3), 674-693).
Eight purified VHHs obtained from the human CCR8 immunization campaign were selected and evaluated by flow cytometry for their binding to hCCR8. One of the purified VHHs (VHH- 69, herein after) displayed potent binding to human CCR8 (Fig. 9), and this in spite of not blocking the action of CCL1 on the CCR8 receptor in a cAMP HTRF assay for Gi coupled receptor.
15. Epitope mapping
VHH clones resulting from the human CCR8 immunization and selection campaign were screened by means of flow cytometry for binding to human CCR8 (SEQ ID NO: 31 ) on stably transfected HEK293 cells or to HEK293 cells previously transfected with plasmid DNA encoding N-terminal deletion human CCR8 (substitution of the 18 amino acids after the N- terminal Met residue of hCCR8 by the amino acid sequence of three consecutive HA-tags, SEQ ID NO: 32, delta 18-3XHA herein after), in comparison to mock-transfected control cells. Comparison of the binding (median fluorescent intensity) signal of a given VHH clone across the three cell lines enabled classification of said clone as an N-terminal human CCR8 binder (i.e. binding on hCCR8 cells, but not on human CCR8 (delta18-3XHA) or control cells) or as an extracellular loop hCCR8 binder (i.e. binding on hCCR8 cells and on human CCR8 (delta 18- 3XHA), but not on control cells).
These experiments classified VHH-69 as an N-terminal human CCR8 binder.
16. Binding and functional characterization for monovalent VHHs The selected monovalent VHH-69 was evaluated for its potential to functionally inhibit human CCL1 signalling on CHO-K1 cells displaying human CCR8 in cAMP accumulation experiments.
CHO-K1 cells stably expressing recombinant human CCR8 were grown prior to the test in media without antibiotic and detached by flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended in KHR buffer (5 mM KCI, 1 .25 mM MgSC , 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH2PO4, 1.45 mM CaCI2, 0.5 g/l BSA, supplemented with 1 mM IBMX). Twelve microliters of cells were mixed with six microliters of VHH (final concentration: 1 pM) in triplicate and incubated for 30 minutes. Thereafter, six microliters of a mixture of forskolin and human CCL1 (R&D Systems, 845-TC or 272-I) was added at a final concentration corresponding to its EC80 value. The plates were then incubated for 30 min at room temperature. After addition of the lysis buffer and 1 hour incubation, fluorescence ratios were measured with the HTRF kit (Cisbio, 62AM9PE) according to the manufacturer’s specification.
At 1 pM, VHH-69 did not alter cAMP levels over the control (PBS) as shown in Figure 10. These data indicate that VHH-69 is a non-blocking binder of hCCR8.
Figure imgf000057_0001
Synthesis and purification of blocking and non-blocking VHH-Fc fusions
In order to compare the effects of a non-blocking hCCR8 binder with a blocking hCCR8 binder, six VHH-Fc constructs (VHH-Fc-201 , VHH-Fc-202, VHH-Fc-203, VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220) were generated by combining anti-CCR8 VHHs to a human short hinge and lgG1 Fc domain (SEQ ID NO: 30), either by direct fusion (VHH-Fc-203 and VHH-Fc-218), or separated by flexible GlySer linkers 10GS (VHH-Fc-201 and VHH-Fc-219) or 20GS (VHH-Fc- 202 and VHH-Fc-220) (20GS referring to four repeats of SEQ ID NO: 20 and, thus, having 20 amino acids in length). Constructs VHH-Fc-201 , VHH-Fc-202 and VHH-Fc-203 contain a blocking CCR8 binding moiety (VHH-blocking), whereas VHH-Fc-218, VHH-Fc-219 and VHH- Fc-220 contain a VHH-69 binding moiety. Thus, VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 are non-blocking hCCR8 binders with cytotoxic activity (ADCC) derived from the Fc domain.
The constructs were cloned in a pQMCF mammalian expression vector, in frame with a secretory signal peptide to direct the expressed recombinant proteins to the extracellular environment. Cloning, cell transfection protein production in CHOEBNALT854 1 E9 cells and protein A purification were performed by Icosagen (Icosagen Cell Factory, Tartu, Estonia). Example 18. Confirmation of hCCR8 binding by VHH-Fc fusions
The six multivalent VHH-Fc fusions were evaluated for their ability to bind to human CCR8 on stably transfected HEK293 cells by means of flow cytometry experiments. Cells were incubated with different concentrations of the multivalent VHH-Fc fusions for 30 minutes at 4°C, followed by two washes with FACS buffer, followed by 30 minutes incubation at 4°C with R- Phycoerythrin AffiniPure F(ab’)2 Fragment Goat anti-human IgG (Jackson ImmnoResearch, cat # 109-1 16-098), followed by two washing steps. Dead cells were stained using TOPRO3 (Thermo Fisher Scientific, T3605).
The binding of all six VHH-Fc fusions to human CCR8 was highly comparable, with pEC50 values ranging from 8.95 to 10.26 M. Figure 11 shows the binding curves of VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 in comparison with two control anti-hCCR8 mAbs (ONCC8 and ONCC10).
On the other hand, VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were found to display poor macaca cross-reactivity, as shown in Figure 12.
Example 19. Functional inhibition by blocking and non-blocking VHH-Fc fusions
VHH-Fc-201 and VHH-Fc-219 fusions were compared in a cAMP HTRF assay for Gi coupled receptor for their ability to functionally inhibit the action of the agonistic ligand human CCL1 .
CHO-K1 cells stably expressing recombinant human CCR8 receptor were grown prior to the assay in media devoid of antibiotics and detached by gentle flushing with PBS-EDTA (5 mM EDTA), recovered by centrifugation and resuspended is KRH buffer (5 mM KCI, 1.25 mM MgSO4, 124 mM NaCI, 25 mM HEPES, 13.3 mM Glucose, 1.25 mM KH2PO4, 1.45 CaCI2, 0.5 g/l BSA) supplemented with 1 mM IBMX. Twelve microliters of cells were mixed with 6 pl of VHH-Fc-201 , VHH-Fc-219 or control CCR8 binders at ten concentrations and in duplicate and incubated 30 minutes. Afterwards, 6 pl of a mixture of forskolin and human CCL1 (R&D Systems, 845-TC or 272- 1) was added at a final concentration corresponding to their EC80 values. The plates were then incubated for 30 minutes at room temperature. After addition of lysis buffer and incubation for one hour, fluorescence ratios were measured with the HTRF kit (Cisbio, 62AM9PE) according to the specifications of the manufacturer.
VHH-Fc-201 results in a 100% inhibition of the cAMP signal at a concentration of 50 nM and higher, with a plC50 value of 8.81 M, confirming that it is a blocking CCR8 binder. On the other hand, like its monovalent counterpart, VHH-Fc-219 does not block the action of CCL1 on the receptor, and this in spite of its potent binding to human CCR8, contrary to the three control mAbs tested (Fig. 13).
Example 20. ADCC potency of VHH-Fc fusions
ADCC reporter gene assay
VHH-Fc fusions VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were tested for their capacity to activate human FcyRllla in the ADCC reported assay (Promega, G7010, G7018) using human CCR8 HEK293 cell line as target cells.
Engineered Jurkat cells stably transfected with the V158 FcyRllla receptor and an NFAT (nuclear factor of activated T-cells) responsive firefly luciferase reporter gene as effector cells were used in this assay. HEK293 cells overexpressing human CCR8 were used as target cells. ADCC activity was quantified through the produced luciferase luminescence signal resulting from the NFAT pathway activation upon incubation of the VHH-Fc fusions with the target and effector cells at a 2.5 : 1 effector : target cell ratio, according to the recommendations of the manufacturer.
All three VHH-Fc fusions were found to activate the human FcvRHIa with pEC50 values ranging from approximately 8.51 to 9.84 M, based on four dilutions, in the same range as the two control anti-human CCR8 antibodies ONCC8 and ONCC10.
ADCC assay using human PBMC
VHH-Fc fusions VHH-Fc-218, VHH-Fc-219 and VHH-Fc-220 were tested along with control monoclonal antibody ONCC8 and an isotype control in the ADCC assay using human PBMC from three independent healthy donors in a 40 : 1 effector : target ratio. Briefly, HEK293 cells expressing human CCR8 were labelled with DiO and seeded in 96-well round bottom plates at 5 x 103 cells per well. Binders were subjected to an 8-point titration in duplicate. Labelled target cells were opsonized with titration of the binders followed by incubated with effector cells for 3 hours. Specific lysis on target cells was monitored by the PI live/dead stain. Samples were acquired on a NxT flow cytometer (Attune).
All three VHH-Fc fusions displayed potent ADCC activity with pEC50 values ranging from approximately 10.7 to 14.3 M, based on the average of three independent experiments using human PBMC from different healthy donors, in the same range as the ONCC8 control.
Figure imgf000060_0001
Sequence optimization of monovalent VHHs
VHH-69 was subjected to sequence optimization in an attempt to maximally improve its sequence in terms of humanization towards human IGHV3 (SEQ ID NO: 35, EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVSVISSDGSSTYY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR) and JH (SES ID NO: 36, WGQGTLVTVSS) germline consensus sequences, as well as in terms of chemical and biophysical stability.
Production, purification and assessment of the bindinq
Figure imgf000060_0002
Cloning into an E. coli expression vector with a C-terminal His6 (but no LFAG3) tag, standard E. coli expression and immobilized metal-affinity chromatography (IMAC) steps were carried out as described in Example 14.
Multiple His6 tagged VHH-69 variants were thus generated and evaluated by flow cytometry for their ability to compete for binding to hCCR8 with FLAG3-His6 tagged VHH-69. Cells were first incubated with different concentrations of monovalent sequence optimization variants that do not carry a FLAG3 tag for 30 minutes at 4°C, followed by a 30 minutes incubation at 4°C of a fixed concentration of FLAG3-tagged VHH-69, followed by washing and anti-FLAG detection by means of mouse M2 anti-Flag mAb (Sigma Aldrich, cat. # F-1804) followed by R- Phycoerythrin AffiniPure F(ab')2 Fragment Goat Anti-Mouse IgG (Jackson ImmunoResearch, cat. # 1 15-1 16-071 ). Variants that retained binding capacity where selected for further biophysical and chemical stability analysis.
Figure imgf000060_0003
All VHH-69 variants were subjected to thermal stability and aggregation assays to gain insights in their melting and aggregation temperatures.
Intrinsic tryptophan-fluorescence was monitored upon temperature-induced protein unfolding in an Uncle instrument (Unchained Labs, Pleasanton, CA, USA). Ten microliter samples were applied at 1 mg/ml to the sample cuvette, and a linear temperature ramp was initiated from 25 to 95 °C at a rate of 0.5 °C per minute, with a pre-run of 180 seconds. The barycentric mean (BCM) and static light scattering (SLS at 266 nm and 473 nm) signals were plotted against temperature in order to obtain melting temperatures (Tm) and aggregation temperatures (Tagg), respectively.
When subjecting the VHH samples to temperature-induced unfolding, clear differences in melting temperatures (Tm) could be noted which were well corroborated by aggregation temperatures (Tagg) determined by static light scattering at 266 nm (smaller aggregates) and 473 nm (larger aggregates).
Dynamic light scattering was performed using the Uncle instrument by applying 10 pl of sample at 1 mg/ml to the sample cuvette. Laser and attenuator controls were set at Auto while 10 acquisitions were run per data point with an acquisition time of 10 seconds each.
Size-exclusion chromatography (SEC) coupled to multi-angle laser-light scattering (MALLS) was carried out by applying 120 pl of a 1 mg/ml sample to a Superdex 200 column (GE healthcare) on an Agilent HPLC system. The outlet of the column was coupled to a UV detector followed by refractive index (Rl) detection and finally MALLS detector.
SEC-MALLS data for the VHH variants and their Fc-fused counterparts nicely correlated. For the majority of the VHH-Fc fusions containing the VHH-69 entity, storage at 40°C for one week did not lead to any observable liabilities in terms of (in)soluble (SEC-MALLS) aggregates being present.
Chemical stability
Two purified VHHs (VHH-123 = VHH-69(E1 D, N55S, D65G) and VHH-124 = VHH-69(E1 D, N55K, D65G), herein after) obtained from the sequence optimization campaign were selected for chemical stability assessment.
Samples were stored at 40 °C for 4 weeks, whereas reference samples were stored at -80°C. Forced oxidized samples (at 1 mg/ml) were supplemented with hydrogen peroxide up to a final concentration of 10 mM, followed by incubation at 37 °C for three hours, with final buffer exchange to phosphate buffer saline (PBS) using PD MidiTrap G-25 columns (GE-Healthcare, Chicago, IL, USA) according to instructions of the manufacturer. Samples were stored at -80 °C until lass spectrometric peptide mapping (Research Institute for Chromatography, Kortrijk, Belgium). Peptide mapping consisted in treating 100 pg of the sample proteins with trypsin (overnight at 25 °C) and injecting the samples onto an RPC-column (reversed phase chromatography; elution by applying an acetonitrile gradient) followed by the ESI-mass spectrometer where LC-MS and LC-MS/MS data were used for quantification and identification, respectively.
As compared with reference VHH-69(E1 D) (19% deamidation of N55), VHH-123 and VHH-124 displayed no deamidation upon storage at 40 °C for 4 weeks. It was also found that the N55K substitution present in VHH-124 resulted in a 2-fold more potent competition IC50 value (2.5 x 10 M) compared to the control VHH-69(E1 D) (4.9 x 10 M) and VHH-123 (7.1 x 10 M) in the competition flow cytometry vs. FLAG3-tagged VHH-69 on human CCR8 in stably transfected HEK293 cells (Fig. 15).
VHH-123 and VHH-124 did not show any substantial high temperature (40 °C) dependent issue after 4 weeks of storage, such as Asn/GIn-deamination, Met/Trp-oxidation, or Asp- isomerization when stored at 40 °C for 4 weeks. No other liabilities were noted.
Example 22. Synthesis and purification of non-blocking optimized VHH-Fc fusions
Fc-fusions of the optimized VHH sequences were generated as in example 17. Consequently, VHH-123 was fused directly to an lgG1 short hinge domain (SEQ ID NO: 28) or through a 10GS linker (SEQ ID NO: 23) or 20GS linker (SEQ ID NO: 24). Similarly, VHH-124 was fused directly to an IgG 1 short hinge domain (SEQ ID NO: 29) or through a 10GS linker (SEQ ID NO: 25) or 20GS linker (SEQ ID NO: 26). These constructs retained binding capacity are optimally suited for treatment of the diseases mentioned herein.
Example 23. ADCC potency of optimized VHH-Fc fusions
Two of the Fc-fusions of the optimized sequences obtained in Example 22 (VHH-124 fused either directly to an IgG 1 short hinge domain ( SEQ ID NO: 29, referred to hereinafter as VHH- Fc-262) or through a 20GS linker (SEQ ID NO: 24, referred to hereinafter as VHH-Fc-264)) were tested along with an isotype control in the ADCC assay using human PBMC from three independent healthy donors in a 40 : 1 effector : target ratio. The ADCC potency was assessed for both the afucosylated and non-afucosylated versions of the VHH-Fc fusions.
Briefly, HEK293 cells expressing human CCR8 were labelled with DiO and seeded in 96-well round bottom plates at 5 x 103 cells per well. Binders were subjected to an 8-point titration in duplicate. Labelled target cells were opsonized with titration of the binders followed by incubated with effector cells for 3 hours. Specific lysis on target cells was monitored by the PI live/dead stain. Samples were acquired on a NxT flow cytometer (Attune).
Both the afucosylated and non-afucosylated versions of the VHH-Fc fusions displayed potent ADCC activity in comparison with the isotype control (see Fig. 16). The observed ADCC activity of the afucosylated version of VHH-Fc fusions displayed the strongest ADCC activity. These data show that the Fc-fusions of the optimized VHH sequences show potent ADCC activity, while the afucosylated version of said Fc-fusions performs even better.

Claims

62 CLAIMS
1 . A human CCR8 (hCCR8) binder, wherein said binder is a non-blocking hCCR8 binder.
2. The binder according to claim 1 , wherein said binder binds to the N-terminal extracellular region of hCCR8.
3. The binder according to claim 1 or 2, comprising a single-domain antibody moiety that binds to hCCR8.
4. The binder according to claim 3, wherein the single-domain antibody moiety comprises three complementarity determining regions (CDRs), namely CDR1 , CDR2 and CDR3, wherein CDR3 is selected from the group consisting of a) the amino acid sequence of AAGTTIGQYTY (SEQ ID NO: 3); b) amino acid sequences having at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 3; and c) amino acid sequences having 3, 2 or 1 amino acid sequence difference with the sequence of SEQ ID NO: 3.
5. The binder according to claim 4, wherein
CDR1 is selected from the group consisting of a) the amino acid sequence of GRTFTNYKSNYK (SEQ ID NO: 1); b) amino acid sequences having at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 1 ; and c) amino acid sequences having 3, 2, 1 amino acid difference with the amino acid sequence of SEQ ID NO: 1 ; and
CDR2 is selected from the group consisting of d) the amino acid sequence of TDWTGXSA (SEQ ID NO: 2), wherein X is selected from the group consisting of N, S and K; e) amino acid sequences having at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 2, wherein X is selected from the group consisting of N, S and K; f) amino acid sequences having 3, 2, 1 amino acid difference with the amino acid sequence of SEQ ID NO: 2, wherein X is selected from the group consisting of N, S and K. 63
6. The binder according to claim 4 or claim 5, wherein the single-domain antibody moiety further comprises four framework regions (FRs) having at least 85% sequence identity to SEQ ID NO: 4 to 7.
7. The binder according to claims 3 to 6, wherein the single-domain antibody moiety comprises the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 9.
8. The binder according to any one of the preceding claims, wherein the binder inhibits signalling of human CCR8 by less than 50%.
9. The binder according to any one of the preceding claims, wherein the binder comprises a single-domain antibody moiety that binds to human CCR8 and comprises at least one cytotoxic moiety.
10. The binder according to claim 9, wherein the cytotoxic moiety
- induces antibody-dependent cellular cytotoxicity (ADCC),
- induces complement-dependent cytotoxicity (CDC),
- induces antibody-dependent cellular phagocytosis (ADCP),
- binds to and activates T-cells, or
- comprises a cytotoxic payload.
11. A nucleic acid encoding the binder according to any one of the previous claims.
12. The binder according to any one of claims 1 to 10, or the nucleic acid according to claim 1 1 , for use as a medicine.
13. The binder according to any one of claims 1 to 10, or the nucleic acid according to claim 1 1 , for use in the treatment of a tumour.
14. The binder or the nucleic acid for use according to claim 13, wherein the tumour is selected from the group consisting of a breast cancer, uterine corpus cancer, lung cancer, stomach cancer, head and neck squamous cell carcinoma, skin cancer, colorectal cancer, kidney cancer and T cell lymphoma. 64 The binder or the nucleic acid for use according to any one of claims 13 or 14, wherein the treatment further comprises administration of a checkpoint inhibitor, such as a checkpoint inhibitor that blocks PD-1 or PD-L1 .
PCT/EP2021/087508 2020-12-24 2021-12-23 Non-blocking human ccr8 binders Ceased WO2022136649A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CA3206124A CA3206124A1 (en) 2020-12-24 2021-12-23 Non-blocking human ccr8 binders
US18/259,141 US20240052044A1 (en) 2020-12-24 2021-12-23 Non-blocking human ccr8 binders
EP21835339.9A EP4267618A1 (en) 2020-12-24 2021-12-23 Non-blocking human ccr8 binders
CN202180094418.1A CN116888156A (en) 2020-12-24 2021-12-23 Non-blocking human CCR8 binder

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP20217313.4 2020-12-24
EP20217313 2020-12-24
EP21167245.6 2021-04-07
EP21167245 2021-04-07

Publications (1)

Publication Number Publication Date
WO2022136649A1 true WO2022136649A1 (en) 2022-06-30

Family

ID=79170844

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2021/087508 Ceased WO2022136649A1 (en) 2020-12-24 2021-12-23 Non-blocking human ccr8 binders

Country Status (4)

Country Link
US (1) US20240052044A1 (en)
EP (1) EP4267618A1 (en)
CA (1) CA3206124A1 (en)
WO (1) WO2022136649A1 (en)

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3858860A1 (en) * 2017-03-29 2021-08-04 Shionogi & Co., Ltd Pharmaceutical composition for cancer treatment
US11639393B2 (en) 2021-07-27 2023-05-02 Abbvie Inc. Anti-CCR8 antibodies
US11692038B2 (en) 2020-02-14 2023-07-04 Gilead Sciences, Inc. Antibodies that bind chemokine (C-C motif) receptor 8 (CCR8)
WO2023230473A1 (en) 2022-05-24 2023-11-30 Bristol-Myers Squibb Company Antibodies that bind to human ccr8
WO2024059909A1 (en) * 2022-09-21 2024-03-28 Monash University Anti-ccr8 antibodies
WO2024248037A1 (en) 2023-05-30 2024-12-05 塩野義製薬株式会社 Bispecific antibody that recognizes ccr8 as antigen
US12258411B2 (en) 2021-06-04 2025-03-25 Amgen Inc. Anti-CCR8 antibodies and uses thereof
WO2025076288A1 (en) 2023-10-06 2025-04-10 Amgen Inc. Combination therapy for cancer treatment
WO2025113643A1 (en) 2023-12-01 2025-06-05 Gilead Sciences Inc. Anti-fap-light fusion protein and use thereof
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025172588A1 (en) 2024-02-16 2025-08-21 Mestag Therapeutics Ltd Bispecific constructs directed against fap and ltbr
WO2025172587A1 (en) 2024-02-16 2025-08-21 Mestag Therapeutics Ltd Binding constructs
WO2025240847A1 (en) 2024-05-17 2025-11-20 Revolution Medicines, Inc. Ras inhibitors
WO2025255438A1 (en) 2024-06-07 2025-12-11 Revolution Medicines, Inc. Methods of treating a ras protein-related disease or disorder
WO2025259871A1 (en) 2024-06-14 2025-12-18 Gilead Sciences, Inc. Anti-ccr8 antibodies and uses thereof
WO2025265060A1 (en) 2024-06-21 2025-12-26 Revolution Medicines, Inc. Therapeutic compositions and methods for managing treatment-related effects
WO2026006747A1 (en) 2024-06-28 2026-01-02 Revolution Medicines, Inc. Ras inhibitors
WO2026015790A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015796A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015801A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015825A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Use of ras inhibitor for treating pancreatic cancer
WO2026050446A1 (en) 2024-08-29 2026-03-05 Revolution Medicines, Inc. Ras inhibitors

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024077239A1 (en) * 2022-10-07 2024-04-11 Genentech, Inc. Methods of treating cancer with anti-c-c motif chemokine receptor 8 (ccr8) antibodies

Citations (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
WO1995004079A1 (en) 1993-08-02 1995-02-09 Raymond Hamers Recombinant vector containing a lipoprotein gene sequence for expressing nucleotide sequences
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1997049805A2 (en) 1996-06-27 1997-12-31 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Recognition molecules interacting specifically with the active site or cleft of a target molecule
US5811097A (en) 1995-07-25 1998-09-22 The Regents Of The University Of California Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO1998042752A1 (en) 1997-03-21 1998-10-01 Brigham And Women's Hospital Inc. Immunotherapeutic ctla-4 binding peptides
US5855887A (en) 1995-07-25 1999-01-05 The Regents Of The University Of California Blockade of lymphocyte down-regulation associated with CTLA-4 signaling
WO1999037681A2 (en) 1998-01-26 1999-07-29 Unilever Plc Method for producing antibody fragments
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
WO2000040968A1 (en) 1999-01-05 2000-07-13 Unilever Plc Binding of antibody fragments to solid supports
WO2000043507A1 (en) 1999-01-19 2000-07-27 Unilever Plc Method for producing antibody fragments
WO2000065057A1 (en) 1999-04-22 2000-11-02 Unilever Plc Inhibition of viral infection using monovalent antigen-binding proteins
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
WO2001021817A1 (en) 1999-09-24 2001-03-29 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Recombinant phages capable of entering host cells via specific interaction with an artificial receptor
WO2001040310A2 (en) 1999-11-29 2001-06-07 Unilever Plc Immobilisation of proteins using a polypeptide segment
WO2001044301A1 (en) 1999-11-29 2001-06-21 Unilever Plc Immobilized single domain antigen-binding molecules
EP1134231A1 (en) 2000-03-14 2001-09-19 Unilever N.V. Antibody heavy chain variable domains against human dietary enzymes, and their uses
WO2001090190A2 (en) 2000-05-26 2001-11-29 National Research Council Of Canada Single-domain antigen-binding antibody fragments derived from llama antibodies
US20020039581A1 (en) 2000-01-27 2002-04-04 Carreno Beatriz M. Antibodies against CTLA4 and uses therefor
WO2002048193A2 (en) 2000-12-13 2002-06-20 Unilever N.V. Camelidae antibody arrays
WO2003025020A1 (en) 2001-09-13 2003-03-27 Institute For Antibodies Co., Ltd. Method of constructing camel antibody library
WO2003035694A2 (en) 2001-10-24 2003-05-01 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof
WO2003050531A2 (en) 2001-12-11 2003-06-19 Algonomics N.V. Method for displaying loops from immunoglobulin domains in different contexts
WO2003054016A2 (en) 2001-12-21 2003-07-03 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Method for cloning of variable domain sequences
WO2003055527A2 (en) 2002-01-03 2003-07-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Immunoconjugates useful for treatment of tumours
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
WO2004062551A2 (en) 2003-01-10 2004-07-29 Ablynx N.V. RECOMBINANT VHH SINGLE DOMAIN ANTIBODY FROM CAMELIDAE AGAINST VON WILLEBRAND FACTOR (vWF) OR AGAINST COLLAGEN
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
WO2005044858A1 (en) 2003-11-07 2005-05-19 Ablynx N.V. Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
WO2006040153A2 (en) 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006122825A2 (en) 2005-05-20 2006-11-23 Ablynx Nv Single domain vhh antibodies against von willebrand factor
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
WO2007044756A2 (en) 2005-10-11 2007-04-19 Icos Corporation Monoclonal antibodies recognizing human ccr8
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008101985A2 (en) 2007-02-21 2008-08-28 Ablynx N.V. Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization
WO2008142164A2 (en) 2007-05-24 2008-11-27 Ablynx N.V. Amino acid sequences directed against rank-l and polypeptides comprising the same for the treatment of bone diseases and disorders
WO2013131010A2 (en) 2012-03-02 2013-09-06 Icahn School Of Medicine At Mount Sinai Function of chemokine receptor ccr8 in melanoma metastasis
WO2018181425A1 (en) 2017-03-29 2018-10-04 塩野義製薬株式会社 Medicinal composition for treating cancer
WO2019157098A1 (en) 2018-02-06 2019-08-15 Advaxis, Inc. Compositions comprising a recombinant listeria strain and an anti-ccr8 antibody and methods of use
WO2020138489A1 (en) 2018-12-27 2020-07-02 塩野義製薬株式会社 Novel anti-ccr8 antibody

Patent Citations (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
WO1995004079A1 (en) 1993-08-02 1995-02-09 Raymond Hamers Recombinant vector containing a lipoprotein gene sequence for expressing nucleotide sequences
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
US5811097A (en) 1995-07-25 1998-09-22 The Regents Of The University Of California Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
US5855887A (en) 1995-07-25 1999-01-05 The Regents Of The University Of California Blockade of lymphocyte down-regulation associated with CTLA-4 signaling
US6051227A (en) 1995-07-25 2000-04-18 The Regents Of The University Of California, Office Of Technology Transfer Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling
WO1997049805A2 (en) 1996-06-27 1997-12-31 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Recognition molecules interacting specifically with the active site or cleft of a target molecule
WO1998042752A1 (en) 1997-03-21 1998-10-01 Brigham And Women's Hospital Inc. Immunotherapeutic ctla-4 binding peptides
US6207156B1 (en) 1997-03-21 2001-03-27 Brigham And Women's Hospital, Inc. Specific antibodies and antibody fragments
WO1999037681A2 (en) 1998-01-26 1999-07-29 Unilever Plc Method for producing antibody fragments
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
WO2000040968A1 (en) 1999-01-05 2000-07-13 Unilever Plc Binding of antibody fragments to solid supports
WO2000043507A1 (en) 1999-01-19 2000-07-27 Unilever Plc Method for producing antibody fragments
WO2000065057A1 (en) 1999-04-22 2000-11-02 Unilever Plc Inhibition of viral infection using monovalent antigen-binding proteins
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
WO2001021817A1 (en) 1999-09-24 2001-03-29 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Recombinant phages capable of entering host cells via specific interaction with an artificial receptor
WO2001040310A2 (en) 1999-11-29 2001-06-07 Unilever Plc Immobilisation of proteins using a polypeptide segment
WO2001044301A1 (en) 1999-11-29 2001-06-21 Unilever Plc Immobilized single domain antigen-binding molecules
US20020039581A1 (en) 2000-01-27 2002-04-04 Carreno Beatriz M. Antibodies against CTLA4 and uses therefor
EP1134231A1 (en) 2000-03-14 2001-09-19 Unilever N.V. Antibody heavy chain variable domains against human dietary enzymes, and their uses
WO2001090190A2 (en) 2000-05-26 2001-11-29 National Research Council Of Canada Single-domain antigen-binding antibody fragments derived from llama antibodies
WO2002048193A2 (en) 2000-12-13 2002-06-20 Unilever N.V. Camelidae antibody arrays
WO2003025020A1 (en) 2001-09-13 2003-03-27 Institute For Antibodies Co., Ltd. Method of constructing camel antibody library
EP1433793A1 (en) 2001-09-13 2004-06-30 Institute for Antibodies Co., Ltd. Method of constructing camel antibody library
WO2003035694A2 (en) 2001-10-24 2003-05-01 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof
WO2003050531A2 (en) 2001-12-11 2003-06-19 Algonomics N.V. Method for displaying loops from immunoglobulin domains in different contexts
WO2003054016A2 (en) 2001-12-21 2003-07-03 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Method for cloning of variable domain sequences
WO2003055527A2 (en) 2002-01-03 2003-07-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Immunoconjugates useful for treatment of tumours
WO2004041862A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
WO2004041863A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against interferon- gamma and uses therefor
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
WO2004062551A2 (en) 2003-01-10 2004-07-29 Ablynx N.V. RECOMBINANT VHH SINGLE DOMAIN ANTIBODY FROM CAMELIDAE AGAINST VON WILLEBRAND FACTOR (vWF) OR AGAINST COLLAGEN
WO2005012359A2 (en) 2003-08-01 2005-02-10 Genentech, Inc. Anti-vegf antibodies
WO2005044858A1 (en) 2003-11-07 2005-05-19 Ablynx N.V. Camelidae single domain antibodies vhh directed against epidermal growth factor receptor and uses therefor
WO2006040153A2 (en) 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006122786A2 (en) 2005-05-18 2006-11-23 Ablynx Nv Improved nanobodies™ against tumor necrosis factor-alpha
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
WO2006122825A2 (en) 2005-05-20 2006-11-23 Ablynx Nv Single domain vhh antibodies against von willebrand factor
WO2007044756A2 (en) 2005-10-11 2007-04-19 Icos Corporation Monoclonal antibodies recognizing human ccr8
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008101985A2 (en) 2007-02-21 2008-08-28 Ablynx N.V. Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization
WO2008142164A2 (en) 2007-05-24 2008-11-27 Ablynx N.V. Amino acid sequences directed against rank-l and polypeptides comprising the same for the treatment of bone diseases and disorders
WO2013131010A2 (en) 2012-03-02 2013-09-06 Icahn School Of Medicine At Mount Sinai Function of chemokine receptor ccr8 in melanoma metastasis
WO2018181425A1 (en) 2017-03-29 2018-10-04 塩野義製薬株式会社 Medicinal composition for treating cancer
EP3431105A1 (en) 2017-03-29 2019-01-23 Shionogi&Co., Ltd. Medicinal composition for treating cancer
WO2019157098A1 (en) 2018-02-06 2019-08-15 Advaxis, Inc. Compositions comprising a recombinant listeria strain and an anti-ccr8 antibody and methods of use
WO2020138489A1 (en) 2018-12-27 2020-07-02 塩野義製薬株式会社 Novel anti-ccr8 antibody

Non-Patent Citations (37)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols", METHODS IN MOLECULAR BIOLOGY, vol. 66, 1996
"Remington: The Science and Practice of Pharmacy", 2011, MACK PRINTING COMPANY, pages: 1289 - 1329
"UniProt", Database accession no. P51685
C. C. BAINA. MCL. MOWAT: "CD200 receptor and macrophage function in the intestine", IMMUNOBIOLOGY, vol. 217, 2012, pages 643 - 651, XP028913440, DOI: 10.1016/j.imbio.2011.11.004
CAMACHO ET AL., J. CLIN. ONCOLOGY, vol. 22, no. 145, 2004
DENIS ET AL., PLOS ONE, vol. 7, 2012, pages e34199
ERUSLANOV ET AL., CLIN CANCER RES, vol. 17, 2013, pages 1670 - 80
FAN G ET AL., J HEMATOL ONCOL, vol. 8, 2015, pages 130
FREEMAN, PROC NATL ACAD SCI USA, vol. 105, 2008, pages 10275 - 6
GREENBERG ET AL., NATURE, vol. 374, 1995, pages 168 - 73
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 8
HASSANZADEH-GHASSABEH ET AL., NANOMEDICINE (LOND, vol. 8, 2013, pages 1013 - 26
HAYES J ET AL., J INFLAMM RES, vol. 9, 2016, pages 209 - 219
HOELZINGER ET AL., J IMMUNOL, vol. 184, 2010, pages 8633 - 42
HURWITZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, no. 17, 1998, pages 10067 - 10071
KABAT E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION
KAWASHIMA ATSUNARI ET AL: "MP18-02 IDENTIFICATION OF CCR8 AS A SPECIFIC MARKER OF TUMOR TISSUE-INFILTRATING REGULATORY T CELLS AND ITS POSSIBILITY AS A THERAPEUTIC TARGET IN RENAL CELL CARCINOMA", JOURNAL OF UROLOGY, LIPPINCOTT WILLIAMS & WILKINS, BALTIMORE, MD, US, vol. 203, no. Suppl. 4, 1 April 2020 (2020-04-01), pages E234, XP009524215, ISSN: 0022-5347, DOI: 10.1097/JU.0000000000000843.02 *
KUFER ET AL., TRENDS BIOTECHNOL, vol. 22, 2004, pages 238 - 44
LAZAR ET AL., PROC NATL ACAD SCI USA, vol. 103, 2006, pages 2005 - 2010
LEFRANC, M.-P. ET AL., NUCLEIC ACIDS RESEARCH, 2009, pages D1006 - 1012
LIU XIAOQIANG ET AL: "CCL18 enhances migration, invasion and EMT by binding CCR8 in bladder cancer cells", MOLECULAR MEDICINE REPORTS, SPANDIDOS PUBLICATIONS, GR, vol. 19, no. 3, 28 February 2019 (2019-02-28), pages 1678 - 1686, XP009524216, ISSN: 1791-2997, [retrieved on 20181224], DOI: 10.3892/MMR.2018.9791 *
LO ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 292, 2017, pages 3900 - 3908
LOUAHED ET AL., EUROPEAN JOURNAL OF IMMUNOLOGY, vol. 33, 2003, pages 494 - 501
MOKYR ET AL., CANCER RES., vol. 58, 1998, pages 5301 - 5304
MUYLDERMANS, REVIEWS IN MOLECULAR BIOTECHNOLOGY, vol. 74, 2001, pages 277 - 302
PARDON E. ET AL.: "A general protocol for the generation of Nanobodies for structural biology", NATURE PROTOCOLS, vol. 9, no. 3, 2014, pages 674 - 693, XP055161463, DOI: 10.1038/nprot.2014.039
RICHARDS ET AL., MOL CANCER THER, vol. 7, 2008, pages 2517 - 27
SMITH ET AL., PROC NATL ACAD SCI USA, vol. 209, 2012, pages 6181 - 6
SPEISS C ET AL., MOLECULAR IMMUNOLOGY, vol. 67, 2015, pages 95 - 106
SPINETTI ET AL., JOURNAL OF LEUKOCYTE BIOLOGY, vol. 73, 2003, pages 201 - 207
TILLER KTESSIER P, ANNU REV BIOMED ENG, vol. 17, 2015, pages 191 - 216
VAFA ET AL., METHODS, vol. 65, no. 1, 2013, pages 114 - 26
VAN SNICK ET AL., JOURNAL OF IMMUNOLOGY, vol. 157, 1996, pages 2570 - 2576
WANG ET AL., CANCER IMMUNOL IMMONOTHER, 2020, Retrieved from the Internet <URL:https://doi.org/10.1007/s00262-020-02583-y>
WANG ET AL., PLOSONE, 2012, pages e30793
WANG ET AL., PROTEIN CELL, vol. 9, 2019, pages 63 - 73
WEINER G, NAT REV CANCER, vol. 15, 2015, pages 361 - 370

Cited By (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3858860A1 (en) * 2017-03-29 2021-08-04 Shionogi & Co., Ltd Pharmaceutical composition for cancer treatment
US11932696B2 (en) 2017-03-29 2024-03-19 Shionogi & Co., Ltd. Method of treating cancer with an anti-CCR8 that binds tumor infiltrating cells
US11692038B2 (en) 2020-02-14 2023-07-04 Gilead Sciences, Inc. Antibodies that bind chemokine (C-C motif) receptor 8 (CCR8)
US12297282B2 (en) 2020-02-14 2025-05-13 Gilead Sciences, Inc. Nucleic acids encoding, and methods of producing, antibodies that bind human chemokine (C—C motif) receptor 8 (CCR8)
US12258411B2 (en) 2021-06-04 2025-03-25 Amgen Inc. Anti-CCR8 antibodies and uses thereof
US11639393B2 (en) 2021-07-27 2023-05-02 Abbvie Inc. Anti-CCR8 antibodies
WO2023230473A1 (en) 2022-05-24 2023-11-30 Bristol-Myers Squibb Company Antibodies that bind to human ccr8
WO2024059909A1 (en) * 2022-09-21 2024-03-28 Monash University Anti-ccr8 antibodies
WO2024248037A1 (en) 2023-05-30 2024-12-05 塩野義製薬株式会社 Bispecific antibody that recognizes ccr8 as antigen
WO2025076288A1 (en) 2023-10-06 2025-04-10 Amgen Inc. Combination therapy for cancer treatment
WO2025113643A1 (en) 2023-12-01 2025-06-05 Gilead Sciences Inc. Anti-fap-light fusion protein and use thereof
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025172588A1 (en) 2024-02-16 2025-08-21 Mestag Therapeutics Ltd Bispecific constructs directed against fap and ltbr
WO2025172587A1 (en) 2024-02-16 2025-08-21 Mestag Therapeutics Ltd Binding constructs
WO2025240847A1 (en) 2024-05-17 2025-11-20 Revolution Medicines, Inc. Ras inhibitors
WO2025255438A1 (en) 2024-06-07 2025-12-11 Revolution Medicines, Inc. Methods of treating a ras protein-related disease or disorder
WO2025259871A1 (en) 2024-06-14 2025-12-18 Gilead Sciences, Inc. Anti-ccr8 antibodies and uses thereof
WO2025265060A1 (en) 2024-06-21 2025-12-26 Revolution Medicines, Inc. Therapeutic compositions and methods for managing treatment-related effects
WO2026006747A1 (en) 2024-06-28 2026-01-02 Revolution Medicines, Inc. Ras inhibitors
WO2026015790A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015796A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015801A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Methods of treating a ras related disease or disorder
WO2026015825A1 (en) 2024-07-12 2026-01-15 Revolution Medicines, Inc. Use of ras inhibitor for treating pancreatic cancer
WO2026050446A1 (en) 2024-08-29 2026-03-05 Revolution Medicines, Inc. Ras inhibitors

Also Published As

Publication number Publication date
EP4267618A1 (en) 2023-11-01
US20240052044A1 (en) 2024-02-15
CA3206124A1 (en) 2022-06-30

Similar Documents

Publication Publication Date Title
US20240052044A1 (en) Non-blocking human ccr8 binders
US20240076391A1 (en) Human ccr8 binders
WO2022003156A1 (en) Ccr8 non-blocking binders
CN110869388B (en) Fc-Optimized Anti-CD25 for Tumor-Specific Cell Depletion
US20240052045A1 (en) Murine cross-reactive human ccr8 binders
RU2759970C2 (en) BISPECIFIC ANTIBODIES TO CD25 AND Fc GAMMA-RECEPTOR FOR ELIMINATION OF TUMOR-SPECIFIC CELLS
JP7225135B2 (en) Compounds and methods for tumor-specific cell depletion
KR20200131862A (en) Anti-CD25 against tumor specific cell depletion
US20240018248A1 (en) An ltbr agonist in combination therapy against cancer
KR20200140315A (en) Anti-CD27 antibodies and uses thereof
TW202305005A (en) Anti-siglec compositions and uses thereof
CN116888156A (en) Non-blocking human CCR8 binder
RU2839380C1 (en) Fc-OPTIMIZED ANTI-CD25 ANTIBODIES FOR TUMOUR-SPECIFIC CELL DEPLETION
HK40102183A (en) Non-blocking human ccr8 binders
CN116917320A (en) Murine cross-reactive human CCR8 binding agents
HK40101561A (en) Human ccr8 binders
HK40103081A (en) Murine cross-reactive human ccr8 binders
CN116964091A (en) Human CCR8 binder
CN117377687A (en) LTBR agonists in anticancer combination therapies
HK40016585A (en) Fc-optimized anti-cd25 for tumor specific cell depletion
HK40018012A (en) Compounds and methods for tumour-specific cell depletion
HK40016585B (en) Fc-optimized anti-cd25 for tumor specific cell depletion

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21835339

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3206124

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 18259141

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021835339

Country of ref document: EP

Effective date: 20230724

WWE Wipo information: entry into national phase

Ref document number: 202180094418.1

Country of ref document: CN