WO2022120137A1 - Compositions and methods for treating ocular diseases - Google Patents
Compositions and methods for treating ocular diseases Download PDFInfo
- Publication number
- WO2022120137A1 WO2022120137A1 PCT/US2021/061755 US2021061755W WO2022120137A1 WO 2022120137 A1 WO2022120137 A1 WO 2022120137A1 US 2021061755 W US2021061755 W US 2021061755W WO 2022120137 A1 WO2022120137 A1 WO 2022120137A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- clq
- amino acid
- seq
- faba
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- Glaucoma and Age-related macular degeneration are the leading cause of irreversible blindness globally.
- GA Geographic atrophy
- AMD Age-related macular degeneration
- AMD Age-related macular degeneration
- GA Geographic atrophy
- atrophic AMD also known as atrophic AMD or advanced dry AMD
- the global prevalence of glaucoma for the population aged 40-80 years is 3.54% (95% CrI, 2.09-5.82). By 2040, the prevalence is projected to rise to 112 million worldwide and 4.7 million in North America.
- approved glaucoma treatments are limited to lowering intraocular pressure (IOP). Surgery, laser treatment or IOP lowering agents are all commonly used. However, even with good control of IOP with medication or surgery, many glaucoma patients continue to experience progressive visual loss. Further, there are no approved treatments or therapies for GA.
- the present disclosure is generally directed to compositions and methods of preventing, reducing risk of developing, or treating an ocular disease (e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy) in a human patient.
- Such methods include administering to the patient a composition comprising about 1 mg to about 10 mg of an anti-Clq antibody via an intravitreal injection, wherein the antibody comprises a light chain variable domain comprising an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7; and a heavy chain variable domain comprising an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the antibody comprises a light chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 4 and 35-38 and wherein the light chain variable domain comprises an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7.
- the light chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 4 and 35-38.
- the antibody comprises a heavy chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 8 and 31-34 and wherein the heavy chain variable domain comprises an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 8 and 31-34.
- the antibody comprises a light chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 4 and 35-38, and wherein the light chain variable domain comprises an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7, and a heavy chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 8 and 31-34 and wherein the heavy chain variable domain comprises an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the antibody comprises a light chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 4 and 35-38, and a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 8 and 31-34.
- the antibody may be a monoclonal antibody, a humanized antibody, a human antibody, a chimeric antibody, an antibody fragment, or antibody derivative thereof.
- the antibody fragment may be a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a diabody, or a single chain antibody molecule.
- the Fab fragment comprises a heavy chain Fab fragment of SEQ ID NO: 39 and a light chain Fab fragment of SEQ ID NO: 40.
- the antibody is administered once a week, once every other week, once every three weeks, once a month, once every 4 weeks, once every 6 weeks, once every 8 weeks, once every other month, once every 10 weeks, once every 12 weeks, once every three months, or once every 4 months. In some embodiments, the antibody is administered for at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, or at least 12 months.
- the administered composition comprises about 1 mg, about
- the administered composition may comprise about 1 mg to about 5 mg of the anti-Clq antibody.
- the administered composition may comprise about 1 mg to about 2.5 mg, about
- the administrated composition may comprise about 5 mg of the anti- Clq antibody.
- the administrated composition may comprise about 10 mg of the anti-Clq antibody.
- the ocular disease is glaucoma or age-related macular degeneration, such as geographic atrophy.
- FIG. 2 shows that FabA inhibits the classical, but not the lectin and alternate complement pathways.
- FabA and Mab2 were evaluated for their ability to inhibit the classical, lectin and alternate pathways using ELISA based assay kits from Eurodiagnostica (WeislabTM). The wells are coated with specific activators of the classical pathway (IgM), the lectin pathway (mannan), or the alternate pathway (lipopolysaccharide), and activation of all pathways was assessed using a C5b-9 terminal complex detection antibody. An inhibitory antibody against C5 was used as a positive control.
- FabA and Mab2 selectively block the classical pathway with an IC50 of ⁇ 0.3 pg/mL, while anti-C5 inhibits all three pathways.
- Figure 3 shows inhibition of hemolysis of IgM-coated RBC in human serum.
- RBC hemolysis was quantified by measuring release of hemoglobin, and is expressed as a percentage of hemolysis induced by no-treatment.
- Figure 4 shows reduction in the number of damaged axons in the optic nerves of eyes treated with Mabl-Fab, Mabl, or Mab2.
- Increased IOP was induced in one eye of each animal by injection of I pl of 6 pm polystyrene beads, 1 pl of 10 pm polystyrene beads (Polybead Microspheres; Polysciences, Inc., Warrington, PA, USA) and 1 pl of viscoelastic solution (10 mg/mL sodium hyaluronate; Advanced Medical Optics Inc., USA) into the anterior chamber of the eye on Day 1.
- the contralateral eye was left untouched to serve as a control.
- Antibodies Mab2, Mabl, and Mabl-Fab Fab derived by enzymatic digest of Mabl
- saline were administered to the microbead-injected eyes intravitreally, one day prior to microbead injection and one week later (Day 0 and Day 7; 2 pU of a 10 mg/mU antibody saline solution for each injection vs. saline alone).
- optic nerves were collected from animals (perfused with saline and 4% paraformaldehyde), postfixed with 4% paraformaldehyde and 1% osmium, dehydrated in ascending alcohol concentration and placed in 1% uranyl acetate / ethanol. Nerves were embedded in epoxy resin and semi-thin sections ( 1 um) were cut.
- Figures 5A-5D show protection of photoreceptor neuron loss and retinal function in a mouse photodamage model with Mabl antibody.
- Figure 5A shows photodamage model in mouse for 7 days followed by intravitreal (IVT) administration of Mab 1 antibody and assessment of retinal function and histology at Day 14. Mice were administered 1 pU of 7.5 mg/mU Mabl or isotype control antibody via IVT administration on Day 7.
- Figure 5B shows that Mabl treatment led to a significant reduction in Tunel +ve photoreceptor cells in the outer nuclear layer of the retina, when compared to isotype control.
- Figure 5C shows that Mabl treatment led to an increase in the number of photoreceptor cell rows in the outer nuclear layer, when compared to isotype control.
- Figure 5D shows that Mabl antibody treatment led to a significant increase in the A- wave and B-wave in electroretinogram on Day 14, when compared to isotype control antibody.
- Figure 6 shows free Clq in aqueous humor after a single IVT injection.
- the present disclosure is generally directed to compositions and methods of preventing, reducing risk of developing, or treating an ocular disease (e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy).
- an ocular disease e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy.
- IgG 1 humanized Immunoglobulin G
- Anti-Clq Fab e.g., FabA, an anti-Clq Fab comprising heavy chain Fab fragment of SEQ ID NO: 39 and light chain Fab fragment of SEQ ID NO: 40
- IVT intravitreally
- GA geographic atrophy
- the hypervariable regions derived from the murine antibody Ml were expressed as a human IgGl Fab fragment construct (FabA).
- FabA human IgGl Fab fragment construct
- a full-length human IgG4 antibody (Mab2, an antibody comprising heavy chain variable domain of SEQ ID NO: 8 and light chain variable domain of SEQ ID NO: 4) comprising the hypervariable regions derived from Mabl was also expressed.
- Mabl and Mab2 as well as their Fabs (Mabl -Fab and Mab2-Fab), were used as surrogate molecules for FabA in pharmacology studies.
- FabA cannot bind to Clq through Fc domain interactions. Furthermore, with only a single antigen-binding arm, FabA does not exhibit agonistic activity for Clq over a broad range of concentrations of FabA.
- the complement cascade is a critical component of innate immunity and can be activated through 3 distinct pathways: the classical, lectin, and alternative complement pathways. All 3 pathways lead to the activation of complement component C3, which ultimately leads to immune cell recruitment, inflammation, membrane lysis through the membrane attack complex, and cell death.
- Clq the initiating molecule of the classical complement cascade
- Clq inhibition may block initiation of the classical complement cascade and slow down neuronal and synaptic damage via directly reducing damage to nerve cell membranes and by reducing the inflammatory consequences of complement activation.
- Mab2-Fab and/or FabA exhibit high affinity binding to human Clq as measured by Biacore ( ⁇ 10 pM) and by enzyme-linked immunosorbent assay (ELISA) (40-50 pM; Figure 1).
- Mabl binds to the isolated globular head domains of Clq, but not to Clq’s collagen tail (as determined by ELISA). Consistent with this finding, Mabl inhibits substrate interactions mediated by Clq’s globular head domain (IgM, C-reactive protein [CRP], and phosphatidylserine); and FabA inhibits Clq functional interaction with immunoglobulin M (IgM)-coated red blood cells (RBCs) (blocking hemolysis; Figure 3).
- IgM immunoglobulin M
- RBCs red blood cells
- Antibody Mabl specifically recognizes Clq, showing no binding to the other complement components (C3b and C5), or to other Cl q/tumor necrosis factor (TNF) superfamily members, including TNF and adiponectin, a protein that shares the highest sequence identity to Clq in its globular head domain. Consistent with these results, FabA does not inhibit the lectin complement pathway, which is initiated by the mannose-binding lectin (MBL, another member of the Clq/TNF superfamily), nor does it inhibit the alternative complement pathway (initiated by C3b) ( Figure 2).
- MBL mannose-binding lectin
- Glaucoma includes a group of progressive eye disorders that damage the optic nerve, ultimately leading to loss of vision.
- IOP intraocular pressure
- This vision loss is due to a progressive degeneration of: (1) retinal neurons, or ganglion cells, in the retinal ganglion cell (RGC) layer; (2) their axons, in the retinal nerve fiber layer (RNFL); and (3) a reduction in the number of neuronal synapses, predominantly in the inner plexiform layer of the retina.
- IOP intraocular pressure
- Clq recognizes certain pathogens, modifications of self-antigens, antigen-bound antibodies, or specific molecules on the surface of cells.
- Clq accumulates on synapses - perhaps those weakened by age or neuronal stress - and following various pathophysiological stimuli can trigger activation of the classical complement cascade, leading to the inappropriate elimination of synapses.
- This aberrant inflammatory response, associated with synapse removal, is termed complement-mediated neurodegeneration (CMND).
- CMND complement-mediated neurodegeneration
- Clq activation leads to synapse elimination and contributes to the loss of RGC’s and the optic nerve.
- Clq elevation and complement activation have been observed in human glaucomatous retina, demonstrated by proteomic analysis and by histological staining.
- CMND has also been reported in rat, mouse, and dog models of glaucoma.
- retinal Clq accumulation and synapse loss occur early in the disease process; genetic deletion of Clq is protective, significantly delaying loss of RGC and degeneration of the optic nerve.
- GA Age-related macular degeneration
- AMD Age-related macular degeneration
- AMD Age-related macular degeneration
- GA also known as atrophic AMD or advanced dry AMD
- AMD is an advanced form of AMD resulting in the progressive and irreversible loss of central retinal photoreceptors, retinal pigment epithelium, and choriocapillaris, leading to vision loss.
- Complement appears to be genetically linked to AMD with polymorphisms identified in 6 distinct proteins that can alter complement pathway activity.
- the activity of the classical pathway can be fully inhibited, leaving the lectin and alternative complement pathways intact.
- the Clq/classical complement pathway mediates elimination of unwanted synapses in development. In adults, Clq accumulates on synapses with age and disease and can aberrantly trigger synapse elimination, neuroinflammation and degeneration. Inhibition of Clq is protective in numerous models of neurodegeneration.
- Clq the initiating molecule of the classical complement cascade
- Clq has also been implicated in the initiation and propagation of GA.
- Clq accumulates with age in two separate and important GA-associated disease processes - on photoreceptor neuron synapses in the outer plexiform layer and on drusen.
- Increasing size and area of drusen which are extracellular accumulations comprised of lipids and proteins from degenerating photoreceptor cell outer segments, are associated with risk of developing AMD.
- both classical and alternative complement pathway activation is evident on photoreceptor outer segments and drives retinal atrophy in GA.
- Aberrant Clq / classical pathway activity is associated with loss of photoreceptors in a photodamage- induced mouse model of GA.
- Full-length antibodies may be prepared by the use of recombinant DNA engineering techniques.
- engineered versions include those created, for example, from natural antibody variable regions by insertions, deletions or changes in or to the amino acid sequences of the natural antibodies.
- Particular examples of this type include those engineered variable region domains containing at least one CDR and optionally one or more framework amino acids from one antibody and the remainder of the variable region domain from a second antibody.
- the DNA encoding the antibody may be prepared by deleting all but the desired portion of the DNA that encodes the full length antibody.
- DNA encoding chimerized antibodies may be prepared by recombining DNA substantially or exclusively encoding human constant regions and DNA encoding variable regions derived substantially or exclusively from the sequence of the variable region of a mammal other than a human.
- DNA encoding humanized antibodies may be prepared by recombining DNA encoding constant regions and variable regions other than the complementarity determining regions (CD Rs) derived substantially or exclusively from the corresponding human antibody regions and DNA encoding CDRs derived substantially or exclusively from a mammal other than a human.
- CD Rs complementarity determining regions
- Suitable sources of DNA molecules that encode antibodies include cells, such as hybridomas, that express the full length antibody.
- the antibody may be isolated from a host cell that expresses an expression vector that encodes the heavy and/or light chain of the antibody.
- Antibody fragments including but not limited to Fab fragments, and/or antibody derivatives may also be prepared by the use of recombinant DNA engineering techniques involving the manipulation and re-expression of DNA encoding antibody variable and constant regions. Standard molecular biology techniques may be used to modify, add or delete further amino acids or domains as desired. Any alterations to the variable or constant regions are still encompassed by the terms 'variable' and 'constant' regions as used herein.
- PCR is used to generate an antibody fragment by introducing a stop codon immediately following the codon encoding the interchain cysteine of CHI, such that translation of the CHI domain stops at the interchain cysteine.
- Methods for designing suitable PCR primers are well known in the art and the sequences of antibody CHI domains are readily available.
- stop codons may be introduced using site-directed mutagenesis techniques.
- An antibody of the present disclosure may be derived from any antibody isotype (“class”) including for example IgG, IgM, IgA, IgD and IgE and subclasses thereof, including for example IgGl, IgG2, IgG3 and IgG4.
- the heavy and light chains of the antibody are from IgG.
- the heavy and/or light chains of the antibody may be from murine IgG or human IgG.
- the heavy and/or light chains of the antibody are from human IgGl .
- the heavy and/or light chains of the antibody are from human IgG4.
- An antibody of the present disclosure may bind to and inhibit a biological activity of Clq, Clr, or Cis.
- Clq binding to an autoantibody (2) Clq binding to Clr, (3) Clq binding to Cis, (4) Clq binding to phosphatidylserine, (5) Clq binding to pentraxin-3, (6) Clq binding to C-reactive protein (CRP), (7) Clq binding to globular Clq receptor (gClqR), (8) Clq binding to complement receptor 1 (CR1), (9) Clq binding to B-amyloid, or (10) Clq binding to calreticulin.
- CRP C-reactive protein
- gClqR globular Clq receptor
- CR1 complement receptor 1
- B-amyloid or (10) Clq binding to calreticulin.
- the biological activity of Clq is (1) activation of the classical complement activation pathway, (2) reduction in lysis and/or reduction in C3 deposition, (3) activation of antibody and complement dependent cytotoxicity, (4) CH50 hemolysis, (5) a reduction in red blood cell lysis, (6) a reduction in red blood cell phagocytosis, (7) a reduction in dendritic cell infdtration, (8) inhibition of complement-mediated red blood cell lysis, (9) a reduction in lymphocyte infdtration, (10) a reduction in macrophage infdtration, (11) a reduction in antibody deposition, (12) a reduction in neutrophil infdtration, (13) a reduction in platelet phagocytosis, (14) a reduction in platelet lysis, (15) an improvement in transplant graft survival, (16) a reduction in macrophage mediated phagocytosis, (17) a reduction in autoantibody mediated complement activation, (18) a reduction in red blood cell destruction due to transfusion reactions, (19
- CH50 hemolysis comprises human, mouse, and/or rat CH50 hemolysis.
- the antibody is capable of neutralizing from at least about 50%, to at least about 95% of CH50 hemolysis. In some embodiments, the antibody is capable of neutralizing 50%, 60%, 70%, 80, 90%, or 100% of CH50 hemolysis.
- the antibody may also be capable of neutralizing at least 50% of CH50 hemolysis at a dose of less than 150 ng/ml, less than 100 ng/ml, less than 50 ng/ml, or less than 20 ng/ml.
- in vitro assays to measure complement activity include ELISA assays for the measurement of split products of complement components or complexes that form during complement activation.
- Complement activation via the classical pathway can be measured by following the levels of C4d and C4 in the serum.
- Activation of the alternative pathway can be measured in an ELISA by assessing the levels of Bb or C3bBbP complexes in circulation.
- An in vitro antibody-mediated complement activation assay may also be used to evaluate inhibition of C3a production.
- An antibody of the present disclosure may be a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a humanized antibody, a human antibody, a chimeric antibody, a multispecific antibody, an antibody fragment thereof, or a derivative thereof.
- the antibody is humanized antibody.
- the antibodies of the present disclosure may also be an antibody fragment, such as a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a diabody, or a single chain antibody molecule.
- the antibody fragment is a Fab fragment.
- antibodies are human monoclonal antibodies which may be prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g. , a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the antibody, e.g. , from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- recombinant means such as (a) antibodies isolated from an animal (e.g. , a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the antibody, e.g.
- Such recombinant human antibodies have variable and constant regions derived from human germline and/or non-germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- antibodies are humanized and/or chimeric monoclonal antibodies, which can be raised by immunizing rodents (e.g., mice, rats, hamsters and guinea pigs) with either (1) the native complement component (e.g., Clq) derived from enzymatic digestion of a purified complement component from human plasma or serum, or (2) a recombinant complement component, or its derived fragment, expressed by either eukaryotic or prokaryotic systems.
- Other animals can be used for immunization, e.g., nonhuman primates, transgenic mice expressing human immunoglobulins, and severe combined immunodeficient (SCID) mice transplanted with human B-lymphocytes.
- SCID severe combined immunodeficient
- Ig immunoglobulin
- Hybridomas can be generated by conventional procedures by fusing B- lymphocytes from the immunized animals with myeloma cells.
- anti-Clq antibodies can be generated by screening recombinant single-chain Fv or Fab libraries from human B-lymphocytes in a phage-display system. The specificity of the MAbs to human Clq can be tested by enzyme linked immunosorbent assay (ELISA), Western immunoblotting, or other immunochemical techniques.
- the inhibitory activity on complement activation of antibodies identified in the screening process can be assessed by hemolytic assays using either unsensitized rabbit or guinea pig RBCs for the alternative complement pathway, or sensitized chicken or sheep RBCs for the classical complement pathway. Those hybridomas that exhibit an inhibitory activity specific for the classical complement pathway are cloned by limiting dilution. The antibodies are purified for characterization for specificity to human Clq by the assays described above.
- a” or “an” may mean one or more.
- the words “a” or “an” when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one.
- reference to an “antibody” is a reference from one to many antibodies.
- another may mean at least a second or more.
- administration “conjointly” with another compound or composition includes simultaneous administration and/or administration at different times.
- Administration in conjunction also encompasses administration as a co-formulation or administration as separate compositions, including at different dosing frequencies or intervals, and using the same route of administration or different routes of administration.
- immunoglobulin (Ig) is used interchangeably with “antibody” herein.
- antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) formed from at least two intact antibodies, antibody fragments so long as they exhibit biological activity, and antibody derivatives.
- the basic 4-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
- L light
- H heavy
- the pairing of a VH and VL together forms a single antigen-binding site.
- L light
- H heavy
- immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated alpha (“a”), delta (“5”), epsilon (“a”), gamma (“y”) and mu (“p”), respectively.
- the y and a classes are further divided into subclasses (isotypes) on the basis of relatively minor differences in the CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
- subclasses immunoglobulins
- the subunit structures and three dimensional configurations of different classes of immunoglobulins are well known and described generally in, for example, Abbas et al., Cellular and Molecular Immunology, 4 th ed. (W.B. Saunders Co., 2000).
- “Full-length antibodies” are usually heterotetrameric glycoproteins of about 150,000 daltons, comprising two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains.
- VH variable domain
- Each light chain has a variable domain at one end (VL) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
- Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
- An isolated molecule or cell is a molecule or a cell that is identified and separated from at least one contaminant molecule or cell with which it is ordinarily associated in the environment in which it was produced.
- the isolated molecule or cell is free of association with all components associated with the production environment.
- the isolated molecule or cell is in a form other than in the form or setting in which it is found in nature.
- Isolated molecules therefore are distinguished from molecules existing naturally in cells; isolated cells are distinguished from cells existing naturally in tissues, organs, or individuals.
- the isolated molecule is an anti- Clq antibody of the present disclosure.
- the isolated cell is a host cell or hybridoma cell producing anti-Clq antibody of the present disclosure.
- an "isolated' antibody is one that has been identified, separated and/or recovered from a component of its production environment (e.g., naturally or recombinantly).
- the isolated polypeptide is free of association with all other contaminant components from its production environment.
- Contaminant components from its production environment such as those resulting from recombinant transfected cells, are materials that would typically interfere with research, diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or non- proteinaceous solutes.
- the polypeptide will be purified: (1) to greater than 95% by weight of antibody as determined by, for example, the Lowry method, and in some embodiments, to greater than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under nonreducing or reducing conditions using Coomassie blue or, preferably, silver stain.
- An isolated antibody includes the antibody in situ within recombinant T-cells since at least one component of the antibody’s natural environment will not be present. Ordinarily, however, an isolated polypeptide or antibody will be prepared by a process including at least one purification step.
- variable region refers to the aminoterminal domains of the heavy or light chain of the antibody.
- the variable domains of the heavy chain and light chain may be referred to as “VH” and “VL”, respectively. These domains are generally the most variable parts of the antibody (relative to other antibodies of the same class) and contain the antigen binding sites.
- variable refers to the fact that certain segments of the vanable domains differ extensively in sequence among antibodies.
- the V domain mediates antigen binding and defines the specificity of a particular antibody for its particular antigen.
- the variability is not evenly distributed across the entire span of the variable domains. Instead, it is concentrated in three segments called hypervariable regions (HVRs) both in the light-chain and the heavy chain variable domains.
- HVRs hypervariable regions
- variable domains The more highly conserved portions of variable domains are called the framework regions (FR).
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three HVRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure.
- the HVRs in each chain are held together in close proximity by the FR regions and, with the HVRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
- the constant domains are not involved directly in the binding of antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent-cellular toxicity.
- CDR complementarity determining region
- CDRs have been described by Kabat et al., J. Biol. Chem. 252:6609-6616 (1977); Kabat et al., U.S. Dept, of Health and Human Services, “Sequences of proteins of immunological interest” (1991) (also referred to herein as Kabat 1991); by Chothia et al., J. Mol. Biol. 196:901-917 (1987) (also referred to herein as Chothia 1987); and MacCallum et al., J. Mol. Biol.
- CDR-L1 refers, respectively, to the first, second, and third CDRs in a light chain variable region.
- CDR-H1”, CDR-H2”, and CDR-H3 refer, respectively, to the first, second, and third CDRs in a heavy chain variable region.
- CDR-1 , CDR-2 , and CDR-3 refer, respectively, to the first, second and third CDRs of either chain's variable region.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies of the population are identical except for possible naturally occurring mutations and/or post-translation modifications (e.g., isomerizations, amidations) that may be present in minor amounts.
- Monoclonal antibodies are highly specific, being directed against a single antigenic site.
- polyclonal antibody preparations which typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody is directed against a single determinant on the antigen.
- monoclonal antibodies are advantageous since they are typically synthesized by hybridoma culture, uncontaminated by other immunoglobulins.
- the modifier “monoclonal” indicates the character of the antibody as being obtained as a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present disclosure may be made by a variety of techniques, including, for example, the hybridoma method (e.g., Kohler and Milstein., Nature, 256:495-97 (1975); Hongo et al., Hybridoma, 14 (3):253-260 (1995), Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2d ed.
- full-length antibody “intact antibody” and “whole antibody” are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment or antibody derivative.
- whole antibodies include those with heavy and light chains including an Fc region.
- the constant domains may be native sequence constant domains (e.g., human native sequence constant domains) or amino acid sequence variants thereof.
- the intact antibody may have one or more effector functions.
- antibody fragment or “antigen-binding fragment” or “functional fragments” of antibodies comprises a portion of an intact antibody, preferably the antigen binding and/or the variable region of the intact antibody or the F region of an antibody which retains or has modified FcR binding capability.
- antibody fragments include Fab, Fab', F(ab')2 and Fv fragments; diabodies; and linear antibodies (see U.S. Patent 5,641,870, Example 2; Zapata et al., Protein Eng. 8(10): 1057-1062 (1995)).
- Additional examples of antibody fragments include antibody derivatives such as single-chain antibody molecules, monovalent antibodies and multispecific antibodies formed from antibody fragments
- antibody derivative is any construct that comprises the antigen-binding region of an antibody.
- antibody derivatives include single-chain antibody molecules, monovalent antibodies and multispecific antibodies formed from antibody fragments.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual “Fc” fragment, a designation reflecting the ability to crystallize readily.
- the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CHI).
- VH variable region domain of the H chain
- CHI first constant domain of one heavy chain
- Each Fab fragment is monovalent with respect to antigen binding, i.e., it has a single antigen-binding site.
- Pepsin treatment of an antibody yields a single large F(ab')2 fragment which roughly corresponds to two disulfide linked Fab fragments having different antigen-binding activity and is still capable of cross-linking antigen.
- Fab' fragments differ from Fab fragments by having a few additional residues at the carboxy terminus of the CHI domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments with hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- the Fc fragment comprises the carboxy-terminal portions of both H chains held together by disulfides.
- the effector functions of antibodies are determined by sequences in the Fc region, the region which is also recognized by Fc receptors (FcR) found on certain types of cells.
- Fc region herein is used to define a C-terminal region of an immunoglobulin heavy chain, including native-sequence Fc regions and variant Fc regions.
- the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl -terminus thereof.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during production or purification of the antibody, or by recombinantly engineering the nucleic acid encoding a heavy chain of the antibody.
- composition of intact antibodies may comprise antibody populations with all K447 residues removed, antibody populations with no K447 residues removed, and antibody populations having a mixture of antibodies with and without the K447 residue.
- Suitable native-sequence Fc regions for use in the antibodies of the disclosure include human IgGl, IgG2, IgG3 and IgG4.
- a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- Native sequence human Fc regions include a native sequence human IgGl Fc region (non-A and A allotypes); native sequence human IgG2 Fc region; native sequence human IgG3 Fc region; and native sequence human IgG4 Fc region as well as naturally occurring variants thereof.
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, preferably one or more amino acid substitution(s).
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g., from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% homology with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% homology therewith, more preferably at least about 95% homology therewith.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors, FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine-based activation motif (“ITAM”) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (“ITIM”) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- Binding to FcRn in vivo and serum half-life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
- WO 2004/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs. See also, e.g., Shields et al., J. Biol. Chem. 9(2):6591-6604 (2001).
- “Fv” is the minimum antibody fragment, which contains a complete antigenrecognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the sFv to form the desired structure for antigen binding.
- Pliickthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269- 315 (1994).
- diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10) residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, thereby resulting in a bivalent fragment, i.e., a fragment having two antigen-binding sites.
- Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
- Diabodies are described in greater detail in, for example, EP 404,097; WO 1993/011161; WO/2009/121948; WO/2014/191493; Hollinger et al., Proc. Nat’l Acad. Sci. USA 90:6444-48 (1993).
- a “chimeric antibody” refers to an antibody (immunoglobulin) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is(are) identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al., Proc. Nat’l Acad. Sci. USA, 81:6851-55 (1984)).
- Chimeric antibodies of interest herein include PRIMATIZED® antibodies wherein the antigenbinding region of the antibody is derived from an antibody produced by, e.g., immunizing macaque monkeys with an antigen of interest.
- “humanized antibody” is a subset of “chimeric antibodies.”
- “Humanized’ forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- a humanized antibody is a human immunoglobulin (recipient antibody) in which residues from an HVR of the recipient are replaced by residues from an HVR of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and/or capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and/or capacity.
- FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications may be made to further refine antibody performance, such as binding affinity.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin sequence, and all or substantially all of the FR regions are those of a human immunoglobulin sequence, although the FR regions may include one or more individual FR residue substitutions that improve antibody performance, such as binding affinity, isomerization, immunogenicity, and the like.
- the number of these amino acid substitutions in the FR is typically no more than 6 in the H chain, and in the L chain, no more than 3.
- the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- a "human antibody” is one that possesses an amino-acid sequence corresponding to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigenbinding residues.
- Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991). Also available for the preparation of human monoclonal antibodies are methods described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p.
- Human antibodies can be prepared by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Patent Nos. 6,075,181 and 6,150,584 regarding XENOMOUSETM technology). See also, for example, Li et al., Proc. Nat’l Acad. Set. USA, 103:3557-3562 (2006) regarding human antibodies generated via a human B-cell hybridoma technology.
- HVP hypervariable re ion
- HF hypervariable re ion
- antibodies comprise six HVRs; three in the VH (Hl, H2, H3), and three in the VL (LI, L2, L3).
- H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies.
- HVR delineations are in use and are encompassed herein.
- the HVRs that are Kabat complementarity-determining regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., supra). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
- the AbM HVRs represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody-modeling software.
- the “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below.
- HVRs may comprise “extended HVRs” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2), and 89-97 or 89-96 (L3) in the VL, and 26-35 (Hl), 50-65 or 49-65 (a preferred embodiment) (H2), and 93-102, 94-102, or 95-102 (H3) in the VH.
- the variable-domain residues are numbered according to Kabat et al., supra, for each of these extended-HVR definitions.
- “Framework” or "FR” residues are those variable-domain residues other than the HVR residues as herein defined.
- variable-domain residue-numbering as in Kabat or “amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
- a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
- the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- the “EU numbering system” or “EU index” is generally used when referring to a residue in an immunoglobulin heavy chain constant region (e.g., the EU index reported in Kabat et al., supra).
- the “EU index as in Kabat” refers to the residue numbering of the human IgGl EU antibody.
- references to residue numbers in the variable domain of antibodies means residue numbering by the Kabat numbering system. Unless stated otherwise herein, references to residue numbers in the constant domain of antibodies means residue numbering by the EU numbering system (e.g., see United States Patent Publication No. 2010-280227).
- acceptor human framework is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework or a human consensus framework.
- An acceptor human framework “derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain pre-existing amino acid sequence changes. In some embodiments, the number of pre-existing amino acid changes are 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, or 2 or fewer.
- VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- a "human consensus framework” is a framework that represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991). Examples include for the VL, the subgroup may be subgroup kappa I, kappa II, kappa III or kappa IV as in Kabat et al., supra. Additionally, for the VH, the subgroup may be subgroup I, subgroup II, or subgroup III as in Kabat et al., supra.
- amino-acid modification at a specified position refers to the substitution or deletion of the specified residue, or the insertion of at least one amino acid residue adjacent the specified residue. Insertion “adjacent” to a specified residue means insertion within one to two residues thereof. The insertion may be N-terminal or C-terminal to the specified residue.
- the preferred amino acid modification herein is a substitution.
- an “affinity-matured” antibody is one with one or more alterations in one or more HVRs thereof that result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody that does not possess those alteration(s).
- an affinity -matured antibody has nanomolar or even picomolar affinities for the target antigen.
- Affinity-matured antibodies are produced by procedures known in the art. For example, Marks et al., Bio/Technology 10:779-783 (1992) describes affinity maturation by VH- and VL-domain shuffling. Random mutagenesis of HVR and/or framework residues is described by, for example: Barbas et al. Proc Nat. Acad. Sci.
- the term “specifically recognizes” or “specifically binds” refers to measurable and reproducible interactions such as attraction or binding between a target and an antibody that is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
- an antibody that specifically or preferentially binds to a target or an epitope is an antibody that binds this target or epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets or other epitopes of the target. It is also understood that, for example, an antibody (or a moiety) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target.
- immunoassay formats can be used to select antibodies specifically immunoreactive with a particular protein.
- solid-phase ELISA immunoassays are routinely used to select monoclonal antibodies specifically immunoreactive with a protein. See, e.g., Harlow and Lane (1988) Antibodies, A Laboratory Manual, Cold Spring Harbor Publications, New York, for a description of immunoassay formats and conditions that can be used to determine specific immunoreactivity .
- Identity indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences.
- similarity indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences.
- leucine may be substituted for isoleucine or valine.
- Other amino acids which can often be substituted for one another include but are not limited to:
- an “interaction” between a complement protein and a second protein encompasses, without limitation, protein-protein interaction, a physical interaction, a chemical interaction, binding, covalent binding, and ionic binding.
- an antibody “inhibits interaction” between two proteins when the antibody disrupts, reduces, or completely eliminates an interaction between the two proteins.
- blocking antibody an “antagonist” antibody, an “inhibitory” antibody, or a “neutralizing” antibody is an antibody that inhibits or reduces one or more biological activities of the antigen it binds, such as interactions with one or more proteins.
- blocking antibodies, antagonist antibodies, inhibitory antibodies, or “neutralizing” antibodies substantially or completely inhibit one or more biological activities or interactions of the antigen.
- inhibitor refers to a compound having the ability to inhibit a biological function of a target biomolecule, for example, an mRNA or a protein, whether by decreasing the activity or expression of the target biomolecule.
- An inhibitor may be an antibody, a small molecule, or a nucleic acid molecule.
- antagonist refers to a compound that binds to a receptor, and blocks or dampens the receptor s biological response.
- inhibitor may also refer to an “antagonist.”
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
- affinity refers to the equilibrium constant for the reversible binding of two agents (e.g, an antibody and an antigen) and is expressed as a dissociation constant (KD).
- KD dissociation constant
- Affinity can be at least 1-fold greater, at least 2-fold greater, at least 3 -fold greater, at least 4-fold greater, at least 5 -fold greater, at least 6-fold greater, at least 7-fold greater, at least 8-fold greater, at least 9-fold greater, at least 10-fold greater, at least 20-fold greater, at least 30-fold greater, at least 40-fold greater, at least 50- fold greater, at least 60-fold greater, at least 70-fold greater, at least 80-fold greater, at least 90-fold greater, at least 100-fold greater, or at least 1,000-fold greater, or more, than the affinity of an antibody for unrelated amino acid sequences.
- Affinity of an antibody to a target protein can be, for example, from about 100 nanomolar (nM) to about 0.1 nM, from about 100 nM to about 1 picomolar (pM), or from about 100 nM to about 1 femtomolar (fM) or more.
- nM nanomolar
- pM picomolar
- fM femtomolar
- the term “avidity” refers to the resistance of a complex of two or more agents to dissociation after dilution.
- the terms “immunoreactive” and “preferentially binds” are used interchangeably herein with respect to antibodies and/or antigen-binding fragments.
- binding refers to a direct association between two molecules, due to, for example, covalent, electrostatic, hydrophobic, and ionic and/or hydrogen-bond interactions, including interactions such as salt bridges and water bridges.
- a subject anti-Clq antibody binds specifically to an epitope within a complement Clq protein.
- Specific binding refers to binding with an affinity of at least about KT 7 M or greater, e.g., 5* IO -7 M, IO -8 M, 5* IO -8 M, and greater.
- Non-specific binding refers to binding with an affinity of less than about KT 7 M, e.g., binding with an affinity of KT 6 M, K 5 M, K 4 M, etc.
- k O n is intended to refer to the rate constant for association of an antibody to an antigen.
- K O ff is intended to refer to the rate constant for dissociation of an antibody from the antibody/antigen complex.
- KD is intended to refer to the equilibrium dissociation constant of an antibody-antigen interaction.
- percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEG ALIGNTM (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms known in the art needed to achieve maximal alignment over the full length of the sequences being compared.
- a “biological sample” encompasses a variety of sample types obtained from an individual and can be used in a diagnostic or monitoring assay.
- the definition encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof.
- the definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents, solubilization, or enrichment for certain components, such as polynucleotides.
- the term “biological sample” encompasses a clinical sample, and also includes cells in culture, cell supernatants, cell lysates, serum, plasma, biological fluid, and tissue samples.
- biological sample includes urine, saliva, cerebrospinal fluid, interstitial fluid, ocular fluid, synovial fluid, blood fractions such as plasma and serum, and the like.
- biological sample also includes solid tissue samples, tissue culture samples, and cellular samples.
- isolated' nucleic acid molecule is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the environment in which it was produced. Preferably, the isolated nucleic acid is free of association with all components associated with the production environment.
- the isolated nucleic acid molecules encoding the polypeptides and antibodies herein is in a form other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from nucleic acids encoding any polypeptides and antibodies herein that exist naturally in cells.
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA into which additional DNA segments may be ligated.
- phage vector refers to a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- viral vector capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as “recombinant expression vectors,” or simply, “expression vectors.”
- expression vectors useful in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase or by a synthetic reaction.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may comprise modification(s) made after synthesis, such as conjugation to a label.
- modifications include, for example, “caps,” substitution of one or more of the naturally occurring nucleotides with an analog, intemucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metals
- any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
- the 5’ and 3’ terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls may also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2’-O-methyl-, 2’-O-allyl-, 2’-fluoro- or 2 ’-azido-ribose, carbocyclic sugar analogs, a-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs, and basic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S (“thioate”), P(S)S (“dithioate”), (0)NR2 (“amidate”), P(O)R, P(O)OR’, CO, or CH2 (“formacetal”), in which each R or R’ is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or aralkyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
- a host cell includes cells transfected in vivo with a polynucleotide(s) of this disclosure.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable earners include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpynolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, polyethylene glycol (PEG), and PLURONICSTM.
- buffers such as phosphate, citrate, and other organic acids
- antioxidants including ascorbic acid
- proteins such as serum album
- preventing is art-recognized, and when used in relation to a condition, such as an ocular disease (e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy) or related symptoms, relative to a patient who does not receive the therapy.
- a condition such as an ocular disease (e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy) or related symptoms, relative to a patient who does not receive the therapy.
- subject refers to a living mammal and may be interchangeably used with the term “patient”.
- mammals include, but are not limited to, any member of the mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.
- the term does not denote a particular age or gender.
- treating includes reducing, arresting, or reversing the symptoms, clinical signs, or underlying pathology of a condition to stabilize or improve a subject's condition or to reduce the likelihood that the subject’s condition will worsen as much as if the subject did not receive the treatment.
- terapéuticaally effective amount of a compound with respect to the subject method of treatment refers to an amount of the compound(s) in a preparation which, when administered as part of a desired dosage regimen (to a mammal, preferably a human) alleviates a symptom, ameliorates a condition, or slows the onset of disease conditions according to clinically acceptable standards for the disorder or condition to be treated or the cosmetic purpose, e.g., at a reasonable benefit/risk ratio applicable to any medical treatment.
- a therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
- an individual "at risk” of developing a particular disease, disorder, or condition may or may not have detectable disease or symptoms of disease, and may or may not have displayed detectable disease or symptoms of disease prior to the treatment methods described herein.
- “At risk” denotes that an individual has one or more risk factors, which are measurable parameters that correlate with development of a particular disease, disorder, or condition, as known in the art. An individual having one or more of these risk factors has a higher probability of developing a particular disease, disorder, or condition than an individual without one or more of these risk factors.
- Chronic administration refers to administration of the medicament(s) in a continuous as opposed to acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
- Intermittent administration refers to treatment that is not administered consecutively without interruption, but rather is cyclic/periodic in nature.
- anti-Clq antibodies disclosed herein are potent inhibitors of Clq and can be dosed for continuous inhibition of Clq function over any period, and then optionally withdrawn to allow for return of normal Clq function at times when its activity may be important. Results obtained with anti-Clq antibodies disclosed herein in animal studies can be readily carried forward into the clinic with humanized or human antibodies, as well as with fragments and/or derivatives thereof.
- Clq is a large multimeric protein of 460 kDa consisting of 18 polypeptide chains (6 Clq A chains, 6 Clq B chains, and 6 Clq C chains).
- Clr and Cis complement proteins bind to the Clq tail region to form the Cl complex (Clqr 2 S2).
- the antibodies of this disclosure specifically recognize complement factor Clq and/or Clq in the Cl complex of the classical complement activation pathway.
- the bound complement factor may be derived, without limitation, from any organism having a complement system, including any mammalian organism such as human, mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig.
- Cl complex refers to a protein complex that may include, without limitation, one Clq protein, two Clr proteins, and two Cis proteins (e.g., Clqr ).
- Anti-Clq antibodies disclosed herein may inhibit Cl complex formation.
- complement factor Clq refers to both wild type sequences and naturally occurring variant sequences.
- a non-limiting example of a complement factor Clq recognized by antibodies of this disclosure is human Clq, including the three polypeptide chains A, B, and C:
- an anti-Clq antibody of the present disclosure may bind to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of a Clq protein.
- an anti-Clq antibody of the present disclosure binds to polypeptide chain A, polypeptide chain B, and/or polypeptide chain C of human Clq or a homolog thereof, such as mouse, rat, rabbit, monkey, dog, cat, cow, horse, camel, sheep, goat, or pig Clq.
- the anti-Clq antibody is a human antibody, a humanized antibody, a chimeric antibody, or a fragment thereof or a derivative thereof.
- the antibody is humanized antibody.
- the antibody is antibody fragment, such as, a Fab fragment.
- the amino acid sequence of the light chain variable domain of antibody Ml is:
- the hyper variable regions (HVRs) of the light chain variable domain are depicted in bolded and underlined text.
- the HVR-L1 of the Ml light chain variable domain has the sequence RASKSINKYLA (SEQ ID NO:5)
- the HVR-L2 of the Ml light chain variable domain has the sequence SGSTLQS (SEQ ID NO:6)
- the HVR-L3 of the Ml light chain variable domain has the sequence QQHNEYPLT (SEQ ID NO:7).
- the amino acid sequence of the heavy chain variable domain of antibody Ml is: QVQLQOPGAELVKPGASVKLSCKSSGYHFTSYWMHWVKQRPGQGLEWIGVIH PNSGSINYNEKFESKATLTVDKSSSTAYMOLSSLTSEDSAVYYCAGERDSTEVL PMDYWGOGTSVTVSS (SEQ ID NO:8).
- the hyper variable regions (HVRs) of the heavy chain variable domain are depicted in bolded and underlined text.
- the HVR-H1 of the Ml heavy chain variable domain has the sequence GYHFTSYWMH (SEQ ID NO:9)
- the HVR-H2 of the Ml heavy chain variable domain has the sequence VIHPNSGSINYNEKFES (SEQ ID NOTO)
- the HVR-H3 of the Ml heavy chain variable domain has the sequence ERDSTEVLPMDY (SEQ ID NO: 11).
- the nucleic acid sequence encoding the light chain variable domain was determined to be: GATGTCCAGATAACCCAGTCTCCATCTTATCTTGCTGCATCTCCTGGAGAAAC CATTACTATTAATTGCAGGGCAAGTAAGAGCATTAACAAATATTTAGCCTGGT ATCAAGAGAAACCTGGGAAAACTAATAAGCTTCTTATCTACTCTGGATCCACT TTGCAATCTGGAATTCCATCAAGGTTCAGTGGCAGTGGATCTGGTACAGATTT CACTCTCACCATCAGTAGCCTGGAGCCTGAAGATTTTGCAATGTATTACTGTC AACAACATAATGAATACCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCT GAAA (SEQ ID NO: 12).
- the nucleic acid sequence encoding the heavy chain variable domain was determined to be: CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTAAAGCCTGGGGCTTCAG TGAAGTTGTCCTGCAAGTCTTCTGGCTACCATTTCACCAGCTACTGGATGCAC TGGGTGAAGCAGAGGCCTGGACAAGGCCTTGAGTGGATTGGAGTGATTCATC CTAATAGTGGTAGTATTAACTACAATGAGAAGTTCGAGAGCAAGGCCACACT GACTGTAGACAAATCCTCCAGCACAGCCTACATGCAACTCAGCAGCCTGACA TCTGAGGACTCGGCGGTCTATTATTGTGCAGGAGAGAGATTCTACGGAGG TTCTCCCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCGTCCTCA (SEQ ID NO: 13).
- the hybridoma cell line producing the Ml antibody (mouse hybridoma ClqMl 7788-l(M) 051613) has been deposited with ATCC under conditions that assure that access to the culture will be available during pendency of the patent application and for a period of 30 years, or 5 years after the most recent request, or for the effective life of the patent, whichever is longer. A deposit will be replaced if the deposit becomes nonviable during that period. The deposit is available as required by foreign patent laws in countries wherein counterparts of the subject application, or its progeny are filed. However, it should be understood that the availability of the deposit does not constitute a license to practice the subject invention in derogation of patent rights granted by governmental action.
- the antibody may bind to at least human Clq, mouse Clq, or rat Clq.
- the antibody may be a humanized antibody, a chimeric antibody, or a human antibody.
- the antibody may be a monoclonal antibody, an antibody fragment thereof, and/or an antibody derivative thereof.
- the antibody is humanized antibody.
- the antibody is antibody fragment, such as, a Fab fragment.
- the light chain variable domain comprises the HVR-U1, HVR-U2, and HVR-U3 of the monoclonal antibody Ml produced by a hybridoma cell line deposited with Accession Number PTA-120399.
- the heavy chain variable domain comprises the HVR-H1, HVR-H2, and HVR-H3 of the monoclonal antibody Ml produced by a hybridoma cell line deposited with ATCC Accession Number PTA-120399.
- the ammo acid sequence of the light chain vanable domain and heavy chain variable domain comprise one or more of SEQ ID NO:5 of HVR-L1, SEQ ID NO: 6 of HVR-L2, SEQ ID NO: 7 of HVR-L3, SEQ ID NO: 9 of HVR-H1, SEQ ID NO: 10 of HVR-H2, and SEQ ID NO: 11 of HVR-H3.
- the antibody may comprise a light chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NON, preferably while retaining the HVR-L1 RASKSINKYLA (SEQ ID NO:5), the HVR-L2 SGSTLQS (SEQ ID NO:6), and the HVR-L3 QQHNEYPLT (SEQ ID NO:7).
- the antibody may comprise a heavy chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO: 8, preferably while retaining the HVR-H1 GYHFTSYWMH (SEQ ID NO:9), the HVR-H2 VIHPNSGSINYNEKFES (SEQ ID NO: 10), and the HVR-H3 ERDSTEVLPMDY (SEQ ID NO: 11).
- an anti-Clq antibody which inhibits the interaction between Clq and an autoantibody.
- the anti-Clq antibody causes clearance of Clq from the circulation or tissue.
- the anti-Clq antibody of this disclosure inhibits the interaction between Clq and Cis. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and Clr. In some embodiments the anti-Clq antibody inhibits the interaction between Clq and Cis and between Clq and Clr. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and another antibody, such as an autoantibody. In preferred embodiments, the anti-Clq antibody causes clearance of Clq from the circulation or tissue. In some embodiments, the anti- Clq antibody inhibits the respective interactions, at a stoichiometry of less than 2.5: 1; 2.0: 1; 1.5: 1; or 1.0: 1.
- the Clq antibody inhibits an interaction, such as the Clq-Cls interaction, at approximately equimolar concentrations of Clq and the anti-Clq antibody.
- the anti-Clq antibody binds to Clq with a stoichiometry of less than 20: 1; less than 19.5: 1; less thanl9: l; less than 18.5: 1; less than 18: 1; less than 17.5: 1; less than 17: 1; less than 16.5: 1; less than 16: 1; less than 15.5: 1; less than 15: 1; less than 14.5: 1; less than 14: 1; less than 13.5: 1; less than 13: 1; less than 12.5: 1; less than 12: 1; less than 11.5: 1; less than 11: 1; less than 10.5: 1; less than 10: 1; less than 9.5: 1; less than 9: 1; less than 8.5: 1; less than 8: 1; less than 7.5: 1; less than 7: 1; less than
- the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 20: 1 to 1.0: 1 or less thanl .0: 1. In certain embodiments, the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 6: 1 to 1.0: 1 or less thanl.0: 1. In certain embodiments, the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 2.5: 1 to 1.0: 1 or less thanl.0: 1. In some embodiments, the anti-Clq antibody inhibits the interaction between Clq and Clr, or between Clq and Cis, or between Clq and both Clr and Cis.
- the anti-Clq antibody inhibits the interaction between Clq and Clr, between Clq and Cis, and/or between Clq and both Clr and Cis. In some embodiments, the anti-Clq antibody binds to the Clq A- chain. In other embodiments, the anti-Clq antibody binds to the Clq B-chain. In other embodiments, the anti-Clq antibody binds to the Clq C-chain. In some embodiments, the anti-Clq antibody binds to the Clq A-chain, the Clq B-chain and/or the Clq C-chain. In some embodiments, the anti-Clq antibody binds to the globular domain of the Clq A- chain, B-chain, and/or C-chain. In other embodiments, the anti-Clq antibody binds to the collagen-like domain of the Clq A-chain, the Clq B-chain, and/or the Clq C-chain.
- antibodies of this disclosure inhibit the interaction between two or more complement factors, such as the interaction of Clq and Cis, or the interaction between Clq and Clr
- the interaction occurring in the presence of the antibody may be reduced by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% relative to a control wherein the antibodies of this disclosure are absent.
- antibodies of this disclosure reduces the interaction between two or more complement factors by 50%, 60%, 70%, 80%, 90%, or 100%.
- the interaction occurring in the presence of the antibody is reduced by an amount that ranges from at least 30% to at least 99% relative to a control wherein the antibodies of this disclosure are absent.
- the antibodies of this disclosure inhibit C2 or C4-cleavage by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- Methods for measuring C2 or C4-cleavage are well known in the art.
- the ECso values for antibodies of this disclosure with respect C2 or C4-cleavage may be less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit C2 or C4-cleavage at approximately equimolar concentrations of Clq and the respective anti- Clq antibody.
- the antibodies of this disclosure inhibit autoantibodydependent and complement-dependent cytotoxicity (CDC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- CDC autoantibodydependent and complement-dependent cytotoxicity
- the ECso values for antibodies of this disclosure with respect to inhibition of autoantibody -dependent and complement-dependent cytotoxicity may be less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit complementdependent cell-mediated cytotoxicity (CDCC) by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99%, or by an amount that ranges from at least 30% to at least 99%, relative to a control wherein the antibodies of this disclosure are absent.
- CDCC complementdependent cell-mediated cytotoxicity
- the ECso values for antibodies of this disclosure with respect CDCC inhibition may be 1 less than 3 pg/ml; 2.5 pg/ml; 2.0 pg/ml; 1.5 pg/ml; 1.0 pg/ml; 0.5 pg/ml; 0.25 pg/ml; 0.1 pg/ml; 0.05 pg/ml.
- the antibodies of this disclosure inhibit CDCC but not antibody-dependent cellular cytotoxicity (ADCC).
- Humanized antibodies of the present disclosure specifically bind to a complement factor Clq and/or Clq protein in the Cl complex of the classical complement pathway.
- the humanized anti-Clq antibody may specifically bind to human Clq, human and mouse Clq, to rat Clq, or human Clq, mouse Clq, and rat Clq.
- the human heavy chain constant region is a human IgG4 heavy chain constant region comprising the amino acid sequence of SEQ ID NO:47, or with at least 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90% homology to SEQ ID NO: 47.
- the human IgG4 heavy chain constant region may comprise an Fc region with one or more modifications and/or ammo acid substitutions according to Kabat numbering.
- the Fc region comprises a leucine to glutamate amino acid substitution at position 248, wherein such a substitution inhibits the Fc region from interacting with an Fc receptor.
- the Fc region comprises a serine to proline amino acid substitution at position 241, wherein such a substitution prevents arm switching in the antibody.
- the amino acid sequence of human IgG4 (S241P L248E) heavy chain constant domain is: ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEV HNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISK AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG K (SEQ ID NO: 47).
- the antibody may comprise a heavy chain variable domain and a light chain variable domain, wherein the heavy chain variable domain comprises an amino acid sequence selected from any one of SEQ ID NOs: 31-34, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from any one of SEQ ID NOs: 31-34.
- the light chain variable domain comprises an amino acid sequence selected from any one of SEQ ID NOs: 35-38, or an amino acid sequence with at least about 90% homology to the amino acid sequence selected from any one of SEQ ID NOs: 35-38.
- VH1 heavy chain variable domain variant 1
- the amino acid sequence of heavy chain variable domain variant 1 is: QVQLVQSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKQAPGQGLEWIGVIH PNSGSINYNEKFESKATITVDKSTSTAYMOLSSLTSEDSAVYYCAGERDSTEVLP MD YWGOGTS VTVS S (SEQ ID NO: 31).
- the hyper variable regions (HVRs) of VH1 are depicted in bolded and underlined text.
- VH2 heavy chain variable domain variant 2
- the amino acid sequence of heavy chain variable domain variant 2 is: QVQLVQSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKQAPGQGLEWIGVIH PNSGSINYNEKFESRATITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLP MD YWGOGTTVTVS S (SEQ ID NO: 32).
- the hyper vanable regions (HVRs) of VH2 are depicted in bolded and underlined text.
- VH3 heavy chain variable domain variant 3
- the amino acid sequence of heavy chain variable domain variant 3 is: OVOLVOSGAELKKPGASVKVSCKSSGYHFTSYWMHWVKQAPGOGLEWIGVIH PNSGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLP MD YWGOGTTVTVS S (SEQ ID NO: 33).
- the hyper variable regions (HVRs) of VH3 are depicted in bolded and underlined text.
- VH4 heavy chain variable domain variant 4
- the amino acid sequence of heavy chain variable domain variant 4 is: QVQLVQSGAELKKPGASVKVSCKSSGYHFTSYWMHWVRQAPGQGLEWIGVIH PNSGSINYNEKFESRVTITVDKSTSTAYMELSSLRSEDTAVYYCAGERDSTEVLP MD YWGOGTTVTVS S (SEQ ID NO: 34).
- the hyper variable regions (HVRs) of VH4 are depicted in bolded and underlined text.
- VKI kappa light chain variable domain variant 1
- the amino acid sequence of kappa light chain variable domain variant 1 is: DVQITQSPSYLAASLGERATINCRASKSINKYLAWYQOKPGKTNKLLIYSGSTLQ SGIPARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGQGTKLEIK (SEQ ID NO: 35).
- the hyper variable regions (HVRs) of VKI are depicted in bolded and underlined text.
- VK2 The amino acid sequence of kappa light chain variable domain variant 2 (VK2) is: DVOITOSPSSLSASLGERATINCRASKSINKYLAWYOQKPGKANKLLIYSGSTLQ SGIPARFSGSGSGTDFTLTISSLEPEDFAMYYCOOHNEYPLTFGOGTKLEIK (SEQ ID NO: 36).
- HVRs hyper variable regions
- VK3 The amino acid sequence of kappa light chain variable domain variant 3 (VK3) is: DVOITOSPSSLSASLGERATINCRASKSINKYLAWYOQKPGKAPKLLIYSGSTLQ SGIPARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGQGTKLEIK (SEQ ID NO: 37).
- the hyper variable regions (HVRs) of VK3 are depicted in bolded and underlined text.
- VK4 The amino acid sequence of kappa light chain variable domain variant 4 (VK4) is: DIQLTQSPSSLSASLGERATINCRASKSINKYLAWYQOKPGKAPKLLIYSGSTLQS GIPARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGQGTKLEIK (SEQ ID NO: 38).
- the hyper variable regions (HVRs) of VK4 are depicted in bolded and underlined text.
- the antibody may comprise a light chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO:35-38 while retaining the HVR-L1 RASKSINKYLA (SEQ ID NO:5), the HVR-L2 SGSTLQS (SEQ ID NO:6), and the HVR-L3 QQHNEYPLT (SEQ ID NO:7).
- the antibody may comprise a heavy chain variable domain amino acid sequence that is at least 85%, 90%, or 95% identical to SEQ ID NO: 31-34 while retaining the HVR-H1 GYHFTSYWMH (SEQ ID NO: 9), the HVR-H2 VIHPNSGSINYNEKFES (SEQ ID NOTO), and the HVR-H3 ERDSTEVLPMDY (SEQ ID NO: 11).
- the antibody comprises a light chain variable domain amino acid sequence of SEQ ID NO: 35 and a heavy chain variable domain amino acid sequence of SEQ ID NO: 31. In some embodiments, the antibody comprises a light chain variable domain amino acid sequence of SEQ ID NO: 36 and a heavy chain variable domain amino acid sequence of SEQ ID NO: 32. In some embodiments, the antibody comprises a light chain variable domain amino acid sequence of SEQ ID NO: 37 and a heavy chain variable domain amino acid sequence of SEQ ID NO: 33. In some embodiments, the antibody comprises a light chain variable domain amino acid sequence of SEQ ID NO: 38 and a heavy chain variable domain amino acid sequence of SEQ ID NO: 34.
- humanized anti-Clq antibodies of the present disclosure include a heavy chain variable region that contains an Fab region and a heavy chain constant regions that contains an Fc region, where the Fab region specifically binds to a Clq protein of the present disclosure, but the Fc region is incapable of binding the Clq protein.
- the Fc region is from a human IgGl, IgG2, IgG3, or IgG4 isotype.
- the Fc region is incapable of inducing complement activity and/or incapable of inducing antibody -dependent cellular cytotoxicity (ADCC).
- the Fc region comprises one or more modifications, including, without limitation, amino acid substitutions.
- the Fc region of humanized anti-Clq antibodies of the present disclosure comprise an amino acid substitution at position 248 according to Kabat numbering convention or a position corresponding to position 248 according to Kabat numbering convention, and/or at position 241 according to Kabat numbering convention or a position corresponding to position 241 according to Kabat numbering convention.
- the amino acid substitution at position 248 or a positions corresponding to position 248 inhibits the Fc region from interacting with an Fc receptor.
- the amino acid substitution at position 248 or a positions corresponding to position 248 is a leucine to glutamate amino acid substitution.
- the amino acid substitution at position 241 or a positions corresponding to position 241 prevents arm switching in the antibody. In some embodiments, the amino acid substitution at position 241 or a positions corresponding to position 241 is a serine to proline amino acid substitution.
- the Fc region of humanized anti-Clq antibodies of the present disclosure comprises the amino acid sequence of SEQ ID NO: 47, or an amino acid sequence with at least about 70%, at least about 75%, at least about 80% at least about 85% at least about 90%, or at least about 95% homology to the amino acid sequence of SEQ ID NO: 47.
- proteolytic enzymes that cleave polypeptide sequences have been used to dissect the structure of antibody molecules and to determine which parts of the molecule are responsible for its various functions.
- Limited digestion with the protease papain cleaves antibody molecules into three fragments. Two fragments, known as Fab fragments, are identical and contain the antigen-binding activity.
- the Fab fragments correspond to the two identical arms of the antibody molecule, each of which consists of a complete light chain paired with the VH and CHI domains of a heavy chain. The other fragment contains no antigen binding activity but was originally observed to crystallize readily, and for this reason was named the Fc fragment (Fragment crystallizable).
- Fab molecules were compared to IgG molecules, it was found that Fab are superior to IgG for certain in vivo applications due to their higher mobility and tissue penetration capability, their reduced circulatory half-life, their ability to bind antigen monovalently without mediating antibody effector functions, and their lower immunogenicity.
- the Fab molecule is an artificial ⁇ 50-kDa fragment of the Ig molecule with a heavy chain shortened by constant domains CH2 and CH3.
- Two heterophilic (VL-VH and CL- CHI) domain interactions underlie the two-chain structure of the Fab molecule, which is further stabilized by a disulfide bridge between CL and CHI .
- Fab and IgG have identical antigen binding sites formed by six complementarity -determining regions (CDRs), three each from VL and VH (LCDR1, LCDR2, LCDR3 and HCDR1, HCDR2, HCDR3).
- the CDRs define the hypervariable antigen binding site of antibodies.
- LCDR3 and HCDR3 typically form the core of the antigen binding site.
- the conserved regions that connect and display the six CDRs are referred to as framework regions.
- the framework regions form a sandwich of two opposing antiparallel -sheets that are linked by hypervariable CDR loops on the outside and by a conserved disulfide bridge on the inside.
- the present disclosure provides an anti-Clq antibody Fab fragment that binds to a Clq protein comprising a heavy (VH/CHI) and light chain (VL/CL), wherein the anti-Clq antibody Fab fragment has six complementarity determining regions (CDRs), three each from VL and VH (HCDR1, HCDR2, HCDR3, and LCDR1, LCDR2, LCDR3).
- the heavy chain of the antibody Fab fragment is truncated after the first heavy chain domain of IgG 1 (SEQ ID NO: 39), and comprises the following amino acid sequence:
- CDRs complementarity determining regions
- the light chain domain of the antibody Fab fragment comprises the following amino acid sequence (SEQ ID NO: 40): DVQITQSPSSLSASLGERATINCRASKSINKYLAWYQQKPGKAPKLLIYSGST LQSGIPARFSGSGSGTDFTLTISSLEPEDFAMYYCOQHNEYPLTFGQGTKLEI KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGN SQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR GEC (SEQ ID NO: 40)
- CDRs complementarity determining regions
- Antibodies suitable for use in the methods of the present disclosure may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567.
- isolated nucleic acids having a nucleotide sequence encoding any of the antibodies of the present disclosure are provided. Such nucleic acids may encode an amino acid sequence containing the VL/CL and/or an amino acid sequence containing the VH/CH1 of the anti-Clq antibody.
- one or more vectors e.g., expression vectors
- a host cell containing such nucleic acid may also be provided.
- the host cell may contain (e.g., has been transduced with): (1) a vector containing a nucleic acid that encodes an amino acid sequence containing the VL/CL of the antibody and an amino acid sequence containing the VH/CHI of the antibody, or (2) a first vector containing a nucleic acid that encodes an amino acid sequence containing the VL/CL of the antibody and a second vector containing a nucleic acid that encodes an amino acid sequence containing the VH/CHI of the antibody.
- the host cell is eukaryotic, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
- the host cell is a bacterium such as E. coli.
- the method includes culturing a host cell of the present disclosure containing a nucleic acid encoding the anti-Clq antibody, under conditions suitable for expression of the antibody. In some embodiments, the antibody is subsequently recovered from the host cell (or host cell culture medium).
- a nucleic acid encoding the antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Suitable vectors containing a nucleic acid sequence encoding any of the antibodies of the present disclosure, or fragments thereof polypeptides (including antibodies) described herein include, without limitation, cloning vectors and expression vectors.
- Suitable cloning vectors can be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
- Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mpl8, mpl9, pBR322, pMB9, ColEl, pCRl, RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
- Bluescript e.g., pBS SK+
- mpl8 mpl9 mpl9
- pBR322 mpl9
- ColEl ColEl
- pCRl pCRl
- RP4 phage DNAs
- shuttle vectors such as pSA3 and pAT28.
- the vectors containing the nucleic acids of interest can be introduced into the host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (e.g., where the vector is an infectious agent such as vaccinia virus).
- electroporation employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances
- microprojectile bombardment e.g., where the vector is an infectious agent such as vaccinia virus.
- infection e.g., where the vector is an infectious agent such as vaccinia virus.
- the vector contains a nucleic acid containing one or more amino acid sequences encoding an anti-Clq antibody of the present disclosure.
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells.
- an anti-Clq antibody of the present disclosure may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria e.g., U.S. Patent Nos. 5,648,237, 5,789,199, and 5,840,523; and Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, describing expression of antibody fragments in E. coll.).
- the antibody of the present disclosure may be produced in eukaryotic cells, e.g., a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell) (e.g., U.S. Pat. App. No. 14/269,950, U.S. Pat. No. 8,981,071, Eur J Biochem. 1991 Jan 1; 195(1): 235 -42).
- a Chinese Hamster Ovary (CHO) cell or lymphoid cell e.g., Y0, NSO, Sp20 cell
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- the anti-Clq antibody (e.g., Fab A) of the present disclosure may be administered in the form of pharmaceutical compositions.
- Therapeutic formulations of an antibody, antibody fragments and/or antibody derivatives of the disclosure may be prepared for storage by mixing the antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. [1980]), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- Lipofections or liposomes may also be used to deliver an antibody or antibody fragment, or antibody derivative into a cell, wherein the epitope or smallest fragment which specifically binds to the binding domain of the target protein is preferred.
- the antibody may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- the formulations to be used for administration may be sterile. This is readily accomplished by filtration through sterile filtration membranes.
- Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
- copolymers of L-glutamic acid and y ethyl-L-glutamate non- degradable ethylene-vinyl acetate
- degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate)
- poly-D-(-)-3-hydroxybutyric acid While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
- the antibodies, antibody fragments and/or antibody derivatives and compositions of the present disclosure are typically administered by an intravitreal administration.
- compositions may also include, depending on the formulation desired, pharmaceutically-acceptable, non-toxic carriers of diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
- diluents are selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, buffered water, physiological saline, PBS, Ringer's solution, dextrose solution, and Hank's solution.
- the pharmaceutical composition or formulation may include other carriers, adjuvants, or nontoxic, nontherapeutic, non-immunogenic stabilizers, excipients and the like.
- the compositions may also include additional substances to approximate physiological conditions, such as pH adjusting and buffering agents, toxicity adjusting agents, wetting agents and detergents.
- the composition may also include any of a variety of stabilizing agents, such as an antioxidant for example.
- the polypeptide may be complexed with various well-known compounds that enhance the in vivo stability of the polypeptide, or otherwise enhance its pharmacological properties (e.g., increase the half-life of the polypeptide, reduce its toxicity, enhance other pharmacokinetic and/or pharmacodynamic characteristics, or enhance solubility or uptake). Examples of such modifications or complexing agents include sulfate, gluconate, citrate and phosphate.
- the polypeptides of a composition may also be complexed with molecules that enhance their in vivo attributes.
- Such molecules include, for example, carbohydrates, polyamines, amino acids, other peptides, ions (e.g., sodium, potassium, calcium, magnesium, manganese), and lipids. Further guidance regarding formulations that are suitable for various types of administration may be found in Remington's Pharmaceutical Sciences, Mace Publishing Company, Philadelphia, Pa., 17th ed. (1985). For a brief review of methods for drug delivery, see, Langer, Science 249: 1527-1533 (1990).
- Toxicity and therapeutic efficacy of the active ingredient may be determined according to standard pharmaceutical procedures in cell cultures and/or experimental animals, including, for example, determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index and it may be expressed as the ratio LD50/ED50.
- Compounds that exhibit large therapeutic indices are preferred.
- the data obtained from cell culture and/or animal studies and/or human clinical trials may be used in formulating a range of dosages for humans.
- the dosage of the active ingredient typically lines within a range of circulating concentrations that include the ED50 with low toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
- compositions intended for parenteral use are usually sterile. To the extent that a given compound must be synthesized prior to use, the resulting product is typically substantially free of any potentially toxic agents, particularly any endotoxins, which may be present during the synthesis or purification process.
- compositions for parental administration are also typically substantially isotonic and made under GMP conditions.
- compositions of the disclosure may be administered using any medically appropriate procedure, e.g., intravitreal injection.
- the present disclosure is generally directed to compositions and methods of preventing, reducing risk of developing, or treating an ocular disease (e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy) in a human patient.
- Such methods include administering to the patient a composition comprising about 1 mg to about 10 mg (e.g., about 1 mg, about 1.5 mg, about 2 mg, about 2.5 mg, about 3 mg, about 3.5 mg, about 4 mg, about 4.5 mg, about 5 mg, about 5.5 mg, about 6 mg, about 6.5 mg, about 7 mg, about 7.5 mg, about 8 mg, about 8.5 mg, about 9 mg, about 9.5 mg, or about 10 mg of the anti-Clq antibody) of an anti-Clq antibody via an intravitreal injection.
- an ocular disease e.g., glaucoma or age-related macular degeneration, such as AMD, including geographic atrophy
- Such methods include administering to the patient a composition comprising about 1 mg to about 10
- Such methods also include administering to the patient a composition comprising about 1 mg to about 10 mg (e.g., about 1 mg, about 1.5 mg, about 2 mg, about 2.5 mg, about 3 mg, about 3.5 mg, about 4 mg, about 4.5 mg, about 5 mg, about 5.5 mg, about 6 mg, about 6.5 mg, about 7 mg, about 7.5 mg, about 8 mg, about 8.5 mg, about 9 mg, about 9.5 mg, or about 10 mg of the anti-Clq antibody) of an anti-Clq antibody via an intravitreal injection, wherein the antibody comprises a light chain variable domain comprising an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7; and a heavy chain variable domain comprising an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the
- the administered composition may comprise about 1 mg to about 5 mg of the anti-Clq antibody.
- the administered composition may comprise about 1 mg to about 2.5 mg, about 2.5 mg to about 5 mg, about 5 mg to about 7.5 mg, or about 7.5 mg to about 10 mg of the anti-Clq antibody.
- the administered composition may comprise about 5 mg of the anti- Clq antibody.
- the administered composition may comprise about 10 mg of the anti-Clq antibody.
- the antibody comprises a light chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 4 and 35-38 and wherein the light chain variable domain comprises an HVR-L1 having the ammo acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7.
- the light chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 4 and 35-38.
- the antibody comprises a heavy chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 8 and 31-34 and wherein the heavy chain variable domain comprises an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 8 and 31-34.
- the antibody comprises a light chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 4 and 35-38, and wherein the light chain variable domain comprises an HVR-L1 having the amino acid sequence of SEQ ID NO: 5, an HVR-L2 having the amino acid of SEQ ID NO: 6, and an HVR-L3 having the amino acid of SEQ ID NO: 7, and a heavy chain variable domain comprising an amino acid sequence with at least about 95% homology to the amino acid sequence selected from SEQ ID NO: 8 and 31-34 and wherein the heavy chain variable domain comprises an HVR-H1 having the amino acid sequence of SEQ ID NO: 9, an HVR-H2 having the amino acid of SEQ ID NO: 10, and an HVR-H3 having the amino acid of SEQ ID NO: 11.
- the antibody comprises a light chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 4 and 35- 38, and a heavy chain variable domain comprising an amino acid sequence selected from SEQ ID NO: 8 and 31-34.
- the antibody may be a monoclonal antibody, a humanized antibody, a human antibody, a chimeric antibody, an antibody fragment, or antibody derivative thereof.
- the antibody fragment may be a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a diabody, or a single chain antibody molecule.
- the Fab fragment comprises a heavy chain Fab fragment of SEQ ID NO: 39 and a light chain Fab fragment of SEQ ID NO: 40.
- the antibody is administered once a week, once every other week, once every three weeks, once a month, once every 4 weeks, once every six weeks, once every 8 weeks, once every other month, once every 10 weeks, once every 12 weeks, once every three months, or once every 4 months. In some embodiments, the antibody is administered for at least 6 months, at least 7 months, at least 8 months, at least 9 months, at least 10 months, at least 11 months, or at least 12 months.
- the ocular disease is glaucoma or age-related macular degeneration, such as geographic atrophy.
- FabA is administered at a dose of 2.5 mg/eye once every month, once every 4 weeks, once every 6 weeks, or once every other month as an IVT injection.
- FabA is administered at a dose of 5 mg/eye once every month, once every 4 weeks, once every 6 weeks, or every other month as an IVT injection.
- FabA is administered at a dose of 5 mg/eye once every month, once every 4 weeks, once every 6 weeks, or once every other month as an IVT injection.
- FabA is administered at a dose of 10 mg/eye once every month, once every 4 weeks, once every 6 weeks, or every other month as an IVT injection.
- Injection of FabA is completed by a physician qualified by training and experience to perform IVT injections, using aseptic technique.
- the anti-Clq antibody may inhibit the interaction between Clq and an autoantibody or between Clq and Clr, or between Clq and Cis, or may promote clearance of Clq from circulation or a tissue.
- the anti-Clq antibody has a dissociation constant (KD) that ranges from 100 nM to 0.005 nM or less than 0.005 nM.
- the anti-Clq antibody binds Clq with a binding stoichiometry that ranges from 20: 1 to 1.0: 1 or less than 1.0: 1, a binding stoichiometry that ranges from 6: 1 to 1.0: 1 or less than 1.0: 1, or a binding stoichiometry that ranges from 2.5: 1 to 1.0: 1 or less than 1.0: 1.
- the methods inhibit a biological activity of Clq. For example, (1) Clq binding to an autoantibody, (2) Clq binding to Clr, (3) Clq binding to Cis, (4) Clq binding to phosphatidylserine, (5) Clq binding to pentraxin-3, (6) Clq binding to C-reactive protein (CRP), (7) Clq binding to globular Clq receptor (gClqR), (8) Clq binding to complement receptor 1 (CR1), (9) Clq binding to B-amyloid, or (10) Clq binding to calreticulin.
- the biological activity of Clq is (1) activation of the classical complement activation pathway, (2) reduction in lysis and/or reduction in C3 deposition, (3) activation of antibody and complement dependent cytotoxicity, (4) CH50 hemolysis, (5) a reduction in red blood cell lysis, (6) a reduction in red blood cell phagocytosis, (7) a reduction in dendritic cell infiltration, (8) inhibition of complement- mediated red blood cell lysis, (9) a reduction in lymphocyte infiltration, (10) a reduction in macrophage infiltration, (11) a reduction in antibody deposition, (12) a reduction in neutrophil infiltration, (13) a reduction in platelet phagocytosis, (14) a reduction in platelet lysis, (15) an improvement in transplant graft survival, (16) a reduction in macrophage mediated phagocytosis, (17) a reduction in autoantibody mediated complement activation, ( 18) a reduction in red blood cell destruction due to transfusion reactions, (19) a reduction in red blood cell lysis
- CH50 hemolysis comprises human CH50 hemolysis.
- the antibody may be capable of neutralizing from at least about 50%, to about 100% of human CH50 hemolysis.
- the antibody may be capable of neutralizing about 50%, about 60%, about 70%, about 80%, about 90%, about 100% of human CH50 hemolysis.
- the antibody may be capable of neutralizing at least 50% of CH50 hemolysis at a dose of less than 150 ng/ml, less than 100 ng/ml, less than 50 ng/ml, or less than 20 ng/ml.
- the antibody is a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a humanized antibody, a human antibody, a chimeric antibody, a monovalent antibody, a multispecific antibody, or an antibody fragment, or antibody derivative thereof.
- the antibody is humanized antibody.
- the antibody is antibody fragment, such as, a Fab fragment. Examples of an antibody fragment are a Fab fragment, a Fab' fragment, a F(ab')2 fragment, a Fv fragment, a diabody, and a single chain antibody molecule.
- compositions may be obtained and used under the guidance of a physician for in vivo use.
- the dosage of the therapeutic formulation may vary widely, depending upon the nature of the disease, the frequency of administration, the manner of administration, the clearance of the agent from the host, and the like.
- chronically administered As used herein, “chronically administered,” “chronic treatment,” “treating chronically,” or similar grammatical variations thereof refer to a treatment regimen that is employed to maintain a certain threshold concentration of a therapeutic agent in the eye of a patient in order to completely or substantially suppress systemic complement activity in the patient over a prolonged period of time.
- a patient chronically treated with anti-Clq antibody may be treated for a period of time that is greater than or equal to 2 weeks (e.g, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, or 52 weeks; 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months; or 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, or 12 years or for the remainder of the patient's life) with the antibody in an amount and with a dosing frequency that are sufficient to maintain a concentration of the antibody in the patient's eye that inhibits or substantially inhibits systemic complement activity in the patient.
- 2 weeks e.g, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
- the antibody may be chronically administered to a patient in need thereof in an amount and with a frequency that are effective to maintain serum hemolytic activity at less than or equal to 20% (e.g., 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, or even below 5%). In some embodiments, the antibody may be administered to a patient in an amount and with a frequency that are effective to maintain serum lactate dehydrogenase (LDH) levels at within at least 20% (e.g., 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, or even below 5%) the normal range for LDH.
- Therapeutic agents e.g., anti-Clq antibodies, can be incorporated into a variety of formulations for therapeutic administration by combination with appropriate pharmaceutically acceptable carriers or diluents.
- FabA Drug Product is a sterile, isotonic liquid for IVT injection.
- FabA is provided as sterile, single-use vials for IVT injection.
- the antibody Mabl, Mabl-Fab, and Mab2 were active in an acute mouse model of glaucoma, protecting against retinal ganglion cell and/or nerve fiber loss.
- Mab 1 administered intravitreally protected against photoreceptor cell loss and retinal functional connectivity in the eye.
- the FabA GLP studies consist of a single-dose rat ocular toxicology study, and three repeat-dose cynomolgus monkey ocular toxicology studies.
- the route of administration for the toxicology studies was IVT injection.
- FabA has shown no evidence of adverse ocular toxicity with a No-Observed- Adverse-Effect-Level (NOAEL) of 5 mg/eye (equivalent to 10 mg human dose) once monthly in cynomolgus monkeys, and 0.05 mg/eye (equivalent to 10 mg human dose) in the single dose rat study.
- NOAEL No-Observed- Adverse-Effect-Level
- Anti-Clq antibody treatment prevents optic nerve damage in an acute mouse model of glaucoma
- mice injection of polystyrene beads into the anterior chamber of the eye results in acute elevation of IOP, loss of the retinal ganglion cells, and optic nerve damage over a period of 2 weeks.
- Mabl, Mabl-Fab and Mab2 were administered intravitreally into mice on the day before and 7 days after IOP elevation. 2 pL of 10 mg/mL antibody or saline was administered at each time point. Based on a vitreal volume of 5-10 pL in mouse eye, the concentration of antibody was 2000-4000 pg/mL.
- Optic nerves were collected 2 weeks following the injury and the number of intact and damaged axons was quantified.
- Anti-Clq antibody treatment led to protection against RGC loss and/or retinal nerve fiber damage in this induced mouse model of glaucoma ( Figure 4).
- Anti-Clq antibody treatment protects against photoreceptor cell damage in a photo- oxidative light-induced damage model
- mice were administered 1 pL of 7.5 mg/mL antibody, which is equivalent to 750-1500 ug/mL concentration in the vitreous.
- systemic delivery of Mabl at 100 mg/kg on Day 0, 4, and 8 had no effect of photoreceptor loss or function.
- Retinal Clq was mainly expressed by subretinal microglia / macrophages located in the outer retina in early AMD and in mouse retinas.
- protection with anti- Clq antibody suggests a clear role of Clq in initiation of photoreceptor damage and the classical complement cascade in the pathogenesis of GA in human disease.
- the safety pharmacology endpoints for the full-length antibody, Mab2 following IV administration up to 200 mg/kg weekly in a 4-week repeat-dose GLP toxicity study in monkeys and up to 200 mg/kg weekly in a 26-week repeat-dose toxicity study in monkeys, in which there was no evidence of a treatment-related effect on cardiovascular, respiratory, or neurologic endpoints support the systemic safety of FabA administered IVT.
- the safety pharmacology endpoints for FabA following SC administration up to 20 mg/kg daily in a 4-week repeat-dose GLP toxicity study in monkeys where there was no evidence of a treatment-related effect on cardiovascular, respiratory, or neurologic endpoints support the systemic safety of FabA administered IVT.
- Nonclinical studies designed to characterize the PK, TK, and PD of FabA were conducted in rats and in cynomolgus monkeys. These studies include single dose IVT PK studies in rats and cynomolgus monkeys, and repeat-dose TK/PD studies in the cynomolgus monkey with FabA. More extensive TK/PD studies were performed in the monkey, and there was no ocular toxicity in either the rat or monkey single dose studies.
- Pharmacokinetic/Toxicokinetic/Pharmacodvnamic Analyses Pharmacokinetics of FabA in the Vitreous
- FabA IVT PK was dose linear.
- vitreous humor FabA concentrations were quantifiable on Day 184 in all animals that received FabA through Day 169, and were below the quantification limit (BQL) in all animals on Day 242/243 after the 10-week dose-free recovery period. Vitreous humor FabA concentrations showed high variability with no clear differences or trends between dose groups or sexes.
- FabA can either bind to Clq, or remain in its free form and be quantifiable with the assay, resulting in low FabA serum concentrations which were not quantifiable (i.e., ⁇ 1.25 ng/mL) in the 1 mg/eye group, and a mean Cmax of 3.3 and 10.1 ng/mL for the 2.5 and 5.0 mg/eye, respectively.
- FabA maximum concentrations were 13800 and 17000 ng/mL in the 2 cynomolgus monkeys tested and the concentrations declined very rapidly afterwards, consistent with a half-life of approximately 2 hours, as expected for a Fab fragment.
- Tl/2 The half-life (Tl/2) values for FabA in serum were calculable/reportable only in a few instances in animals in the 5/2.5 mg/eye biweekly group and ranged from 49.9 to 143 hours across all evaluation days, likely representing distribution from the ocular space into the serum. There was little accumulation of FabA in serum with repeated monthly IVT dosing at 2.5 mg/eye. However, there were increasingly more calculable FabA serum concentrations in this group on each subsequent evaluation day after Day 1. Accumulation could not be determined from Day 1 in any other groups due to the changes in dose levels after Day 57.
- Day 169/Day 85 area under the curve to time “t” (AUC[0-t]) ratios ranged from 0.0407 to 0.664 in 5/2.5 mg/eye once monthly males and females, and ranged from 0.132 to 7. 15 in 5/2.5 mg/eye biweekly males and females.
- FabA exposure AUCO-t (1,230 hr*ng/mL or 1.23 hr*pg/mL) after bilateral IVT administration at 5/2.5 mg/eye biweekly compared to the 200 mg/kg AUCO-t (3,150,000 hr* pg/mL) obtained after once weekly systemic IV administration of Mab2, the FabA serum exposures were considerably lower (FabA /Mab2 Cmax ratio of 0.000000073, AUCO-t ratio of 0.00000039).
- FabA The safety of FabA is supported by a comprehensive nonclinical ocular toxicology program designed to support the use of FabA for IVT administration in clinical trials.
- Initial single dose studies were performed in the rat and cynomolgus monkey with FabA and no ocular toxicity was observed in either of these species.
- the cynomolgus monkey was selected for repeat-dose ocular toxicology studies of FabA.
- the repeat dose ocular toxicology studies included ophthalmic examinations (OE), IOP, electroretinogram (ERG), ocular histopathology, and the measurement of FabA in serum and vitreous for TK analyses. Additionally, FabA PD properties were characterized by measurement of Clq in vitreous (for all repeat dose studies) and ocular tissues (in two dose studies), and the inhibition of Clq-dependent hemolysis in serum (in two dose studies).
- FabA In this single dose GLP rat ocular toxicology study, vehicle or FabA was administered at doses of 0.01 mg/eye (equivalent to 2 mg human dose) and 0.05 mg/eye (equivalent to 10 mg human dose) by IVT injection once bilaterally to young adult male rats. FabA treated animals were terminated at Day 1 (6 hours post dose), Day 3, Day 7, Day 10, Day 20, Day 30 and all vehicle control animals were terminated on Day 30. All animals survived until scheduled necropsy. Standard safety parameters were included in this study. Blood samples were collected at termination and terminal vitreous samples were obtained for TK analysis. Additionally, ophthalmic examinations (OEs), including IOP, and ocular histopathology were evaluated.
- OEs ophthalmic examinations
- Vitreous exposure to FabA was confirmed by TK in treated animals for 6 hours (first collection) to 144 hours post dose at both 0.01 mg/eye (equivalent to 2 mg human dose) and 0.05 mg/eye (equivalent to 10 mg human dose). Serum exposure to FabA was confirmed on TK in treated animals (2 to 48 hours post dose only) at 0.01 and 0.05 mg/eye.
- FabA In this single dose non-GLP cynomolgus monkey ocular toxicology study, vehicle or FabA was administered bilaterally by IVT injection at doses of 1 mg/eye (equivalent to 2 mg human dose) and 5 mg/eye (equivalent to 10 mg human dose) to young adult female cynomolgus monkeys. FabA treated animals were terminated at Day 1 (6 hours post dose), Day 3, Day 7, Day 10, Day 20, Day 30. All vehicle control animals were terminated on Day 30 and all animals survived until scheduled necropsy.
- Standard safety parameters including OE, IOP, and ocular histopathology were assessed in this study. Additionally, blood samples were collected throughout the study, and terminal vitreous samples for TK and PD were analyzed.
- FabA-related changes were limited to non-adverse findings that were not associated with inflammation. These findings included histiocytic infiltrates in the uvea and mild basophilia in the 1 mg/eye dose group. Findings in the 5 mg/eye dose consisted of histiocytic infiltrates in the uvea, and minimal to mild basophilia.
- FabA was administered at least once every 4 weeks by IVT injection. Repeat-dose administration of FabA was well tolerated in the cynomolgus monkey. In the initial repeat-dose GLP ocular toxicology studies, the NOAEL for the cynomolgus monkey was 5 mg/eye (equivalent to 10 mg human dose) once monthly for two doses, the highest dose evaluated.
- NOAEL In the 26-week chronic ocular toxicology study in cynomolgus monkeys, adverse ocular changes were associated with the double injection procedure and/or determined to be ADA-mediated and not a direct effect of FabA IVT administration, thus the NOAEL was determined to be 2.5 mg/eye (equivalent to 5 mg human dose) biweekly or once monthly in cynomolgus monkeys for 13 or 7 doses, respectively.
- Standard safety parameters were included in this study, and blood samples were collected throughout the study. Terminal vitreous samples for TK and PD analysis and terminal optic nerve sections for TK and PD analysis were collected as well. Additionally, OEs, lOPs, ERGs, and ocular histopathology were evaluated.
- FabA findings determined to not be adverse were limited to one high dose (2.5 mg/eye) (equivalent to 5 mg human dose) female, which had minimal basophilic / bluestaining of the vitreous with no associated inflammation (referred to as basophilia). Importantly, there were no FabA-related changes noted in OEs, lOPs, and ERGs. TK confirmed exposure to FabA in all treated animals in the vitreous for the duration of the study and through recovery (30 days post the last dose).
- Serum exposure was not measurable at 1 mg/eye (equivalent to 2 mg human dose), was low and transient (12 to 48 hours post the first dose, 6 to 168 hours post the last dose) at 2.5 mg/eye (equivalent to 5 mg human dose) and did not exceed 8 ng/mL (LLOQ 1.25 ng/mL).
- PD confirmed the absence of Clq in all treated animals in the vitreous, when FabA levels were -100 ng/mL.
- FabA ADAs were detected in animals at the 1 mg/eye (equivalent to 2 mg human dose) (6 of 12 animals) and 2.5 mg/eye (equivalent to 5 mg human dose) (7 of 12 animals), but there was no clear impact of ADA on FabA exposure in serum or vitreous.
- Standard safety parameters were included in this study (with the exception of systemic histopathology), and blood samples were collected throughout the study, as well as terminal vitreous samples for TK and PD analysis. ADA and aqueous humor samples were collected and archived. Additionally, OEs, lOPs, ERGs, and ocular histopathology were evaluated.
- basophilia minimal -mild basophilic / blue-staining of the vitreous with no associated inflammation
- TK confirmed exposure to FabA in all treated animals in the vitreous for the duration of the study and through recovery (30 days post the last dose). The absence of FabA was confirmed in the serum and vitreous of control animals. PD confirmed the absence of Clq in all treated main study animals in the vitreous on Day 44. On Day 59, 2/4 recovery animals had measurable Clq in the vitreous. FabA ADAs were detected in animals at the 5 mg/eye (equivalent to 10 mg human dose) (9 of 10 animals) group, but there was no clear impact of ADA on FabA exposure in serum or vitreous.
- Standard safety parameters were included in this study (with the exception of systemic histopathology), and blood samples were collected throughout the study, as well as terminal vitreous samples for TK and PD analysis. ADA and aqueous humor samples were collected and archived. Additionally, OEs, lOPs, ERGs, ocular histopathology, and immunohistochemistry (IHC) for the detection of deposited immune complexes in globes were evaluated.
- IHC immunohistochemistry
- Ocular clinical signs and ophthalmic examination findings considered related to FabA were limited to eyeball opacity (likely due to opacity in the anterior chamber, lens capsule, and/or posterior chamber) and the presence of cells and/or pigment.
- the presence of these findings in animals that did not have ADA detected in serum (4 of 12 Group 2 animals, 2 of 12 Group 3 animals, and 2 of 12 Group 4 animals) indicates a relationship to FabA.
- Findings considered related to ADA and potentially to immune complex deposition tended to be more severe and included aqueous flare and the presence of vitreal haze, altered pupillary light reflex, and retinal vessel attenuation.
- Intraocular changes related to inflammation included mild mixed cell infiltration of the ciliary body and vitreous chamber, minimal to moderate fibrosis (severity proportional to dose frequency) within the vitreous chamber, and minimal to mild posterior lens degeneration (severity proportional to dose frequency).
- Minimal perivascular mononuclear cell infiltrates were also observed within the posterior retina in one female each at 5/2.5 mg/eye biweekly and monthly treatment groups.
- Minimal to mild, mononuclear cell infiltration was observed within the periocular limbus of animals administered 5/2.5 mg/eye biweekly and monthly, with severity proportional to dose frequency.
- Minimal mixed cell infiltration and fibrosis of the vitreous chamber persisted at 5/2.5 mg/eye biweekly, while moderate decreased cellularity and hemosiderin pigment of the retina developed.
- Minimal perivascular mononuclear cell infiltration of the retina at the optic disk was also observed at 5/2.5 mg/eye biweekly. These changes were also considered secondary to an ADA-mediated response to FabA.
- Immunohistochemistry was conducted for 2 of 12, 4 of 12, and 6 of 12 animals from Groups 1, 3, and 4, respectively. Evaluation revealed the presence of immunohistochemically detected granular deposits containing FabA, monkey IgG, IgM, and/or C3 within the left eye of 4 of 10 treated animals in the mid dose 5/2.5 mg/eye monthly (2 of 4 animals) and high dose 5/2.5 mg/eye biweekly (2 of 6 animals) selected for IHC. These intramural vascular deposits were present in association with perivascular inflammatory cellular infiltrates similar to those observed with hematoxylin and eosin evaluation of the right eye. Other microscopic changes observed within the right eye were consistent with secondary changes associated with this immune response to FabA in the monkey.
- FabA Drug Product is a sterile, isotonic liquid for IVT injection.
- a Phase 1 first- in-human, open-label, dose-escalation study (FabA-GLA-01) was conducted to evaluate the initial safety and tolerability of a single IVT injection of FabA in patients with primary open-angle glaucoma.
- a Phase lb, randomized, double-masked study (FabA-GLA-02) was conducted to evaluate the safety and tolerability of repeat IVT injections of FabA in patients with primary open-angle glaucoma.
- FabA-GLA-02 is a Phase lb study in which aqueous humor was sampled to assess PK and PD. Subjects were administered two IVT injections of sham, 2.5 mg/eye FabA (equivalent to 5 mg human dose), or 5 mg/eye (equivalent to 10 mg human dose) FabA separated by 29 days. In this study, aqueous humor was sampled predose and 29 days following the first FabA dose, prior to the second dose. Free FabA was detected in the aqueous humor of all treated patients on Day 29 (D29). In parallel, both dose levels of 2.5 mg/eye and 5 mg/eye FabA inhibited free Clq for at least 29 days in aqueous humor (Figure 6).
- FabA-GLA-01 is a single dose Phase 1 study in which serum FabA and Clq were sampled predose and at 3 hours postdose.
- FabA-GLA-02 is a multidose Phase lb study in which serum and FabA and Clq were sampled predose and at 3 hours postdose for each of 2 doses separated by 29 days.
- FabA was generally not detectable in systemic circulation after single or repeat IVT injections at any dose level studied in either the Phase 1 or Phase lb clinical studies. Similarly, no changes in circulating free Clq were detected in either study. As described below, the 5 mg/eye (equivalent to 10 mg human dose) dose level was well tolerated as single or two doses separated by 29 days in FabA clinical studies.
- TEAEs Ocular treatment-emergent adverse event
- IOP returned to normal (within 5 mmHg of immediate pre-injection IOP or ⁇ 21 mm Hg) within 30 minutes in 9 of 9 patients.
- FabA was generally not detectable in the systemic circulation and no changes in circulating free Clq were detected after single IVT administration.
- Dose Level 1 2.5 mg/eye, single dose (0.05 mL) x 2 doses
- Dose level 2 5.0 mg/eye, single dose (0.10 mL) x 2 doses
- IOP returned to normal ( ⁇ 21 mm Hg) for 16/17 patients within 30 minutes of the IVT injection and within 45 minutes for the remaining patient.
- Example 3 A Phase 2, Multicenter, Randomized, Parallel-Group, Double-Masked, 4- Arm, Sham-Controlled Study of the Efficacy, Safety, and Tolerability of FabA Administered by Intravitreal Injection in Patients with Geographic Atrophy (GA) Secondary to Age-Related Macular Degeneration (AMD) Rationale:
- This study is being conducted in patients with GA secondary to AMD.
- the purpose of the study is to determine if intravitreal (IVT) injections of FabA once every month (EM) or once every other month (EOM) for 12 months reduces GA lesion growth rate.
- IVT intravitreal
- the study consists of a 30-day screening period and a 12-month treatment period, followed by a 6-month (off treatment) follow-up period. The total duration of patient participation is 19 months. Patients visit the clinic each month during the 12-month treatment period for treatment and/or safety assessments.
- Intervention Groups and Duration Approximately 240 patients are enrolled and randomly assigned to one of 4 treatment arms so that approximately 204 patients are evaluable at Month 12 for the primary analysis (primary analysis is based on modified intent-to-treat [ITT]). Intervention Groups and Duration:
- Study intervention assignment is based on randomization (2:2: 1 : 1). Patients are assigned to one of the following treatment arms. Dose level is fixed and are not modified.
- FabA/Sham administration is completed by the injecting physician using aseptic technique.
- the injecting physician assesses hand motion vision or central retinal artery perfusion visualization. If necessary, rule out other causes of vision loss such as vitreous hemorrhage. If needed, perform digital massage, and administer topical/oral IOP lowering medications, until hand motion vision or central retinal artery perfusion is observed.
- IOP insulin pressure
- Plasma samples for PK (FabA serum concentrations) and PD evaluations (serum Clq concentrations and plasma concentrations of other biomarkers) are collected within 30 minutes before dosing and 3 hours ( ⁇ 15 min) after dosing at the visits.
- Samples for immunogenicity testing are collected pre-injection during the site visits. Additionally, a sample for ADA is collected at Week 2 at the site or a home health visit.
- Immunogenicity This test requires serum. Immunogenicity is assessed by analysis of serum anti -drug (FabA) antibodies (ADA).
- FabA The dose volume of FabA is fixed at 0.10 mL once every month (EM) for 12 months (12 doses) or once every other month (EOM) for 12 months (6 doses).
- IOP intraocular pressure
- Sham injection The preparation and post-injection care for the sham injection is identical to injection with FabA.
- the sham injection is performed by applying pressure to the eye at the location of a typical intravitreal injection using the blunt end of an empty syringe without a needle.
- Post-Intravitreal Injection 1. Patients are to remain in the clime after injection for ocular evaluations and safety follow-up.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Ophthalmology & Optometry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020237022463A KR20230117192A (ko) | 2020-12-04 | 2021-12-03 | 안구 질환을 치료하기 위한 조성물 및 방법 |
| IL303289A IL303289A (en) | 2020-12-04 | 2021-12-03 | Compositions and methods for treating ocular diseases |
| EP21901508.8A EP4255485A4 (en) | 2020-12-04 | 2021-12-03 | COMPOSITIONS AND METHODS FOR TREATING EYE DISEASES |
| US18/265,380 US20240059765A1 (en) | 2020-12-04 | 2021-12-03 | Compositions and methods for treating ocular diseases |
| CA3200976A CA3200976A1 (en) | 2020-12-04 | 2021-12-03 | Compositions and methods for treating ocular diseases |
| AU2021391800A AU2021391800A1 (en) | 2020-12-04 | 2021-12-03 | Compositions and methods for treating ocular diseases |
| MX2023006591A MX2023006591A (es) | 2020-12-04 | 2021-12-03 | Composiciones y metodos para el tratamiento de enfermedades oculares. |
| CN202180090142.XA CN116782940A (zh) | 2020-12-04 | 2021-12-03 | 用于治疗眼部疾病的组合物和方法 |
| JP2023533830A JP2023551734A (ja) | 2020-12-04 | 2021-12-03 | 眼の疾患を治療するための組成物及び方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063121629P | 2020-12-04 | 2020-12-04 | |
| US63/121,629 | 2020-12-04 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022120137A1 true WO2022120137A1 (en) | 2022-06-09 |
Family
ID=81853584
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/061755 Ceased WO2022120137A1 (en) | 2020-12-04 | 2021-12-03 | Compositions and methods for treating ocular diseases |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240059765A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4255485A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2023551734A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230117192A (cg-RX-API-DMAC7.html) |
| CN (1) | CN116782940A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021391800A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3200976A1 (cg-RX-API-DMAC7.html) |
| CL (1) | CL2023001596A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL303289A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2023006591A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022120137A1 (cg-RX-API-DMAC7.html) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11649279B2 (en) | 2013-07-09 | 2023-05-16 | Annexon, Inc. | Anti-complement factor C1Q antibodies and uses thereof |
| WO2023212719A1 (en) * | 2022-04-29 | 2023-11-02 | Annexon, Inc. | Compositions and methods for treating ocular diseases |
| US11999779B2 (en) | 2015-11-24 | 2024-06-04 | Annexon, Inc. | Anti-complement factor C1q Fab fragments and uses thereof |
| US12486322B2 (en) | 2021-12-13 | 2025-12-02 | Annexon, Inc. | Anti-complement factor C1q antibodies with single binding arms and uses thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017091719A1 (en) * | 2015-11-24 | 2017-06-01 | Annexon, Inc. | Anti-complement factor c1q fab fragments and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK3019240T3 (da) * | 2013-07-09 | 2024-06-03 | Annexon Inc | Anti-komplementfaktor C1Q antistoffer og anvendelser deraf |
-
2021
- 2021-12-03 CN CN202180090142.XA patent/CN116782940A/zh active Pending
- 2021-12-03 IL IL303289A patent/IL303289A/en unknown
- 2021-12-03 EP EP21901508.8A patent/EP4255485A4/en active Pending
- 2021-12-03 WO PCT/US2021/061755 patent/WO2022120137A1/en not_active Ceased
- 2021-12-03 US US18/265,380 patent/US20240059765A1/en active Pending
- 2021-12-03 MX MX2023006591A patent/MX2023006591A/es unknown
- 2021-12-03 JP JP2023533830A patent/JP2023551734A/ja active Pending
- 2021-12-03 AU AU2021391800A patent/AU2021391800A1/en active Pending
- 2021-12-03 KR KR1020237022463A patent/KR20230117192A/ko active Pending
- 2021-12-03 CA CA3200976A patent/CA3200976A1/en active Pending
-
2023
- 2023-06-02 CL CL2023001596A patent/CL2023001596A1/es unknown
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017091719A1 (en) * | 2015-11-24 | 2017-06-01 | Annexon, Inc. | Anti-complement factor c1q fab fragments and uses thereof |
Non-Patent Citations (3)
| Title |
|---|
| ANITA GROVER; SETHU SANKARANARAYANAN; VIDHU MATHUR; POOJAN SURI; YAISA ANDREWS-ZWILLING; KIRSTEN MEASE; LORI K TAYLOR; ELLEN CAHIR: "Pharmacokinetics and target engagement of intravitreal administration of ANX007, an anti-C1q antibody fragment, in nonhuman primates", INVESTIGATIVE OPHTHALMOLOGY & VISUAL SCIENCE : IOVS, vol. 62, no. 8, 1 June 2021 (2021-06-01), US , pages 219, XP009537163, ISSN: 0146-0404 * |
| JIAO HAIHAN, RUTAR MATT, FERNANDO NILISHA, YEDNOCK TED, SANKARANARAYANAN SETHU, AGGIO-BRUCE RIEMKE, PROVIS JAN, NATOLI RICCARDO: "Subretinal macrophages produce classical complement activator C1q leading to the progression of focal retinal degeneration", MOLECULAR NEURODEGENERATION, vol. 13, no. 1, 1 December 2018 (2018-12-01), pages 1 - 18, XP055936689, DOI: 10.1186/s13024-018-0278-0 * |
| See also references of EP4255485A4 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11649279B2 (en) | 2013-07-09 | 2023-05-16 | Annexon, Inc. | Anti-complement factor C1Q antibodies and uses thereof |
| US12534522B2 (en) | 2013-07-09 | 2026-01-27 | Annexon, Inc. | Anti-complement factor C1q antibodies and uses thereof |
| US11999779B2 (en) | 2015-11-24 | 2024-06-04 | Annexon, Inc. | Anti-complement factor C1q Fab fragments and uses thereof |
| US12486322B2 (en) | 2021-12-13 | 2025-12-02 | Annexon, Inc. | Anti-complement factor C1q antibodies with single binding arms and uses thereof |
| WO2023212719A1 (en) * | 2022-04-29 | 2023-11-02 | Annexon, Inc. | Compositions and methods for treating ocular diseases |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4255485A4 (en) | 2025-05-14 |
| CN116782940A (zh) | 2023-09-19 |
| KR20230117192A (ko) | 2023-08-07 |
| JP2023551734A (ja) | 2023-12-12 |
| US20240059765A1 (en) | 2024-02-22 |
| CL2023001596A1 (es) | 2024-01-19 |
| CA3200976A1 (en) | 2022-06-09 |
| EP4255485A1 (en) | 2023-10-11 |
| IL303289A (en) | 2023-07-01 |
| MX2023006591A (es) | 2023-08-11 |
| AU2021391800A1 (en) | 2023-06-22 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250002567A1 (en) | Anti-complement factor c1q fab fragments and uses thereof | |
| US20240059765A1 (en) | Compositions and methods for treating ocular diseases | |
| AU2019370485B2 (en) | Compositions and methods for treating brain injury | |
| AU2017299579A1 (en) | Compositions and methods for treating frontotemporal dementia | |
| US20250313614A1 (en) | Compositions and methods for treating ocular diseases | |
| EP4228696A1 (en) | Compositions and methods for treating blood disorders | |
| EA050212B1 (ru) | Композиции и способы лечения болезней глаз | |
| HK40101076A (zh) | 用於治疗眼部疾病的组合物和方法 | |
| HK40121733A (zh) | 用於治疗眼部疾病的组合物和方法 | |
| CA3006092C (en) | Anti-complement factor c1q fab fragments and uses thereof | |
| JP2025533847A (ja) | 抗c1q抗体のための製剤 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21901508 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3200976 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023533830 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 18265380 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023010736 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2021391800 Country of ref document: AU Date of ref document: 20211203 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20237022463 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021901508 Country of ref document: EP Effective date: 20230704 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180090142.X Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112023010736 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230531 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523441025 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523441025 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523441025 Country of ref document: SA |
|
| WWR | Wipo information: refused in national office |
Ref document number: 523441025 Country of ref document: SA |