WO2022096829A1 - Utilisation d'une neolectine specifique pour detecter des microorganismes - Google Patents
Utilisation d'une neolectine specifique pour detecter des microorganismes Download PDFInfo
- Publication number
- WO2022096829A1 WO2022096829A1 PCT/FR2021/051944 FR2021051944W WO2022096829A1 WO 2022096829 A1 WO2022096829 A1 WO 2022096829A1 FR 2021051944 W FR2021051944 W FR 2021051944W WO 2022096829 A1 WO2022096829 A1 WO 2022096829A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- neolectin
- hydrolase
- use according
- sample
- specific
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4726—Lectins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01146—Beta-galactofuranosidase (3.2.1.146)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/24—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/285—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Pasteurellaceae (F), e.g. Haemophilus influenza
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/305—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Micrococcaceae (F)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
- G01N2333/35—Assays involving biological materials from specific organisms or of a specific nature from bacteria from Mycobacteriaceae (F)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/37—Assays involving biological materials from specific organisms or of a specific nature from fungi
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/37—Assays involving biological materials from specific organisms or of a specific nature from fungi
- G01N2333/38—Assays involving biological materials from specific organisms or of a specific nature from fungi from Aspergillus
Definitions
- the present invention relates to the use of a specific neolectin for detecting the presence of microorganisms in a sample, said microorganisms having on their surface at least one osidic unit of the hexofuranoside type.
- Glycans are molecules involved in many biological phenomena, and more particularly in cellular communication and molecular recognition, thanks to their saccharide parts. Due to their great structural diversity, many combinations can be obtained by combining several monosaccharide units.
- the number of possible combinations is even higher if we consider the natural ability of osidic units to cyclize in two forms: the pyranose form, comprising a heterocycle with 6 atoms: 5 carbon and one oxygen, which is thermodynamically favored , and the furanose form, comprising a 5-atom heterocycle, consisting of 4 carbon atoms and one oxygen atom.
- Pentoses osidic units made up of 5 carbon atoms, exist in one of two forms, pyranose or furanose.
- ribose ribofuranose is the form present in the nucleic acids of all organisms; in water, the predominant form is B-D-ribopyranose; xylose, a sugar present in plants and wood: the xylopyranose form is predominant in the polysaccharides (pectin, etc.) of plants; in water, the predominant form is B-D-xylofuranose.
- beta-galactose exists in the form D-galactofuranose (I, Gal), and in the form D-galactopyranose (II, Galp), as presented in the expanded formulas (I) and (II) below. below:
- hexoses are exclusively present in the pyranose form: they are called hexopyranosides.
- hexofuranosides While hexofuranosides are completely absent from mammalian cells, their presence has been observed in certain polysaccharides extracted from microorganisms, in particular pathogenic microorganisms such as Mycobacterium, Trypanosoma, Leishmania and Aspergillus (Peltier et al., 2008).
- lectins Sugar recognition proteins are called lectins. Due to their specificity for glycans presented on the surface of cells, lectins can serve as a molecular probe to specifically detect certain cells.
- neolectins synthetic lectins produced for a specific purpose, in particular to recognize certain sugars. These neolectins can be synthesized de novo, or be derived, by point mutations, from glycosidases or natural lectins (Arnaud et al., 2013).
- DC-SIGN lectin is expressed on the surface of dendritic cells, and interacts with D-galactofuranose; this interaction induces a pro-inflammatory immune system response.
- DC-SIGN also interacts with numerous other oses, in particular with D-mannopyranose, with the D-galactopyranose Galp form, as well as with glucoside 6; human intelectin (or Omentin) recognizes D-galactofuranose (B-Galf) and therefore the glycans comprising it, but also other glycans which include the following osidic units: D-phospho-glycerol (Gro-P) units , heptoses, D-glycero-D-talo-oct-2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-ulosonic acid (KDO) (Wesener et al., 2015).
- US Patent 10,082,506 describes a method for detecting microorganisms based on this ability of human intelectin to bind to these glycans, exclusively expressed by microorganisms. However, it is not a specific detection method for furanose forms.
- lectins are suitable tools for the detection of sugar units.
- the inventors of the present invention have generated for the first time a neolectin having excellent specificity for hexofuranoses.
- the present application describes certain forms of this neolectin specific for an saccharide unit of hexofuranoside type, and also the use of this neolectin for detecting the presence of microorganism(s) expressing said hexofuranoses in a sample.
- the present invention relates to the use of a neolectin for detecting the presence of microorganism(s) in a sample, the said microorganism(s) having on their surface at least one osidic unit of the hexofuranoside type, characterized in that said neolectin is derived from a specific hydrolase of a hexofuranoside type osidic unit whose hydrolytic activity has been reduced.
- said neolectin specifically recognizing a hexofuranoside consists of a specific hydrolase of said hexofuranoside whose catalytic site has been modified to reduce the hydrolytic activity of said enzyme.
- said neolectin may consist of galactofuranosidase from JHA 19 Streptomyces sp., the hydrolytic activity of which has been reduced relative to its original natural activity.
- the present invention also relates to a method for detecting the presence of microorganism(s) in a sample, the said microorganism(s) having on their surface at least one osidic unit of the hexofuranoside type.
- the present invention also relates to a detection kit for identifying the presence of microorganisms having on their surface at least one osidic unit of the hexofuranoside type, comprising the following elements: at least one neolectin as described above, or a nucleic acid encoding said neolectin; reagents suitable for the detection of said neolectin.
- the present invention also relates to a neolectin as defined above, in particular a neolectin coupled to a marker and/or to a molecular tag.
- FIG. 1 represents the kinetic characterization of three neolectins of the present invention, derived from the same hydrolase, whose hydrolytic activity (k ca t) is reduced, capable of specific recognition of Gal (KM of the same order of magnitude as that of the original hydrolase).
- the relative hydrolysis activity as a function of pH is shown in the lower right graph, for the original hydrolase (WT, in gray) and for the neolectin E464Q (in black).
- FIG. 2A represents the interaction profile of the BS ⁇ -Gal/ fluorescent probe with the DC-SIGN lectin as a function of the amount of DC-SIGN bound in the wells.
- the dotted curve with triangles represents the fluorescence measured when the ManBS ⁇ probe is used.
- the same experiment is also carried out in the presence of a compound antagonistic to DC-SIGN binding: GalNac-BS ⁇ .
- FIG. 2B represents the interaction profile of the probes BS ⁇ -Galf (top), BS ⁇ -Fuc and BS ⁇ - ⁇ -Gal (bottom) with Intelectin.
- the intelectin/BS ⁇ -Galf interaction is measured as a function the amount of intelectin bound in the wells of the plate. With the other probes, the Intelectin is fixed in the wells at an amount of 2000 ng/well.
- FIG. 2C represents the interaction profile of the BSA-Galf probe with the neolectin according to the invention, as a function of the quantity of neolectin fixed in the wells.
- FIG. 3A represents the expanded chemical structures of the galactofuranosides tested as competitors of the BSA-Galf/Neolectin interaction, the results of this competition experiment being shown in Figure 3B.
- FIG. 3B represents a test for inhibition of the BSA-Galf/Neolectin interaction with the galactofuranosides presented in FIG. 3A: GalfN3 (b-D-Galf N3), Galf-Thiolyl (Tolyl b-D-Galf), PNP-bGalf (pNP b-D- Galf), PNP-bGalp (pNP b-D-Galp) and PNP-aAraF.
- FIG. 4A represents the detection of the Neolectin/Aspergillus interaction by direct recognition, or [Fig. 4B] by competition with the BSA-Galf.
- FIG. 5 represents the residual hydrolytic activity of the neolectin E464Q (SEQ ID No. 4) as a function of temperature, and demonstrates its thermostability.
- the present invention relates to the use of a neolectin for detecting the presence of microorganism(s) in a sample, the said microorganism(s) having on their surface at least one osidic unit of the hexofuranoside type, characterized in that said neolectin is derived from a hydrolase specific for an osidic unit of the hexofuranoside type, the hydrolytic activity of which has been reduced.
- lectin refers to a protein capable of interacting specifically with sugars or glycoproteins comprising sugar units. Lectins are involved in various biological processes, particularly at the level of recognition between cells, by binding with membrane glycoproteins.
- neolectin designates a non-natural lectin, synthesized de novo or, more often, obtained from a natural lectin which has been modified in a directed manner to present specific characteristics. This notion of neolectin is notably presented in the article (Arnaud et al., 2013). Thus, the term “neolectin” refers to a synthetic lectin.
- hexofuranose and “hexofuranoside”, used interchangeably in the present application, denote free sugar units (“ose”) or glycosylated units in the anomeric position (“oside”) cyclized in the form "furanose » that is to say comprising a cycle made up of 5 atoms, 4 of carbon and one of oxygen.
- ose free sugar units
- oside glycosylated units in the anomeric position
- furanose » that is to say comprising a cycle made up of 5 atoms, 4 of carbon and one of oxygen.
- An example is in particular D-galactofuranose (Gai ), furanose form of galactose, the structural formula of which is presented in formula (I).
- hydrolytic enzyme or "hydrolase”, used interchangeably in the application, is meant an enzyme having an activity of hydrolysis of molecules according to the general reaction:
- hydrolase considered within the meaning of the invention is a glycosidase, classified in group EC 3.2.1.x.
- a hydrolase specific for an osidic unit of the hexofuranoside type designates an enzyme whose substrate is a hexofuranoside. This hydrolase therefore has a catalytic site, consisting of a "pocket” for fixing said hexofuranoside, where the hydrolysis reaction presented in equation 1 takes place.
- This hydrolase is also qualified, in the present application, as “initial enzyme” or “original enzyme” or “original hydrolase” or even “enzyme before modification”.
- the neolectin defined in the invention is derived from said specific hydrolase, that is to say that it was obtained by modifications introduced into the peptide sequence of this original hydrolase.
- reducing the hydrolytic activity of an enzyme refers to one or more modifications of the peptide sequence of an enzyme, making it possible to reduce or even completely eliminate its catalytic activity.
- hydrolase whose hydrolytic activity has been reduced designates a hydrolase whose peptide sequence has been modified to reduce or even completely eliminate its enzymatic activity, in particular by modifying its primary sequence.
- the reduction in hydrolytic activity can be quantified using the catalytic constant kcat of the enzyme.
- the relationship between an enzyme and its substrate can be qualified according to several parameters, and in particular according to two constants: the catalytic constant kc a t and the Michaelis constant KM.
- the catalytic constant kcat represents the maximum number of molecules of substrate transformed per unit of time and per molecule of enzyme; this value is expressed in sec 1 or min 1 , that is to say in the number of substrate molecules transformed (in the present case, hydrolyzed according to equation 1 ) in one second or one minute.
- the expression "reducing the hydrolytic activity of an enzyme” means reducing the kcat value of this enzyme, for example reducing its kcat value by at least 50%, 60%, 70%, 80%, or 90% of its initial value, or even completely eliminating the activity, i.e. a reduction of 100% of the initial value of kc at t.
- a reduction of at least 50% from the initial kcat value means that the kcat value of the hydrolase before any modification has been halved.
- modified hydrolases were obtained with kcat values divided by 80 times or even by 2000 times compared to the initial value of the original enzyme.
- a hydrolase whose hydrolytic activity has been reduced is in particular a hydrolase whose kcat value is equal to or less than 10% of the kcat value of the original hydrolase, the two values being measured in equivalent conditions (of pH, temperature, reaction medium, incubation period, etc.), well known to those skilled in the art.
- This hydrolase is designated in the present application by the terms “modified hydrolase” or “neolectin”.
- a hydrolase whose hydrolytic activity has been reduced has a kcat value equal to or less than 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1 % of the value of k ca t of the original hydrolase, measured under equivalent conditions.
- the Michaelis constant designated by the abbreviation KM, is a value expressed in mole/litre, which corresponds to the value of the substrate concentration for which the enzymatic reaction rate is equal to half the maximum rate Vmax; this constant is related to the dissociation constant (K ⁇ j) of the enzyme for its substrate, a value which represents the strength of the interaction between the two, but is generally not strictly equal to it.
- the constant KM also depends on the value of kcat, according to the following equation:
- KM (kcat + k-i) / ki where ki represents the rate of formation of the enzyme-substrate complex and k-i the rate of the reverse reaction of dissociation of the enzyme and the substrate.
- the affinity of the enzyme for the substrate is strong. This is often the case for selective and/or very active enzymes.
- the KM value of the neolectin will be of the same order of magnitude as the initial KM value of the enzyme before modification, the two KM values being measured under equivalent conditions (pH, temperature, reaction medium, duration of incubation%) which can be chosen by the person skilled in the art on the basis of his general knowledge.
- the KM value of the neolectin will preferably be about 50%, 60%, 70%, 80%, 90% or 95% of the KM value of the original hydrolase.
- Hexoses monosaccharides comprising 6 carbons, all have the same molecular formula C ⁇ HIZO ⁇ . They all have a carbonyl group: either an aldehyde function in position 1 (aldohexoses); or a ketone function in position 2 (mainly), 3, 4 or 5 (ketohexoses or dihydroxyketone).
- hexose glucose, galactose, fucose and mannose, which are naturally present in nature.
- D-galactofuranose is the predominant compound.
- the present invention relates to a neolectin specifically recognizing D-galactofuranose (Gai).
- the kinetic characteristics of this enzyme have been determined: the constant of Michaelis KM with the substrate Gal/ is equal to 250 pM; the catalytic constancy kc a t is 213 min 1 .
- the neolectin of the invention consists of galactofuranosidase from JHA 19 Streptomyces sp., whose catalytic activity has been reduced, and more specifically whose catalytic site has been modified.
- the neolectin of the invention consists of a galactofuranosidase having a peptide sequence exhibiting at least 80%, or 85%, or 90%, or 95%, or 98%, or 99% identity of sequence with the peptide sequence SEQ ID NO. 1.
- hydrolytic activity of a hydrolase can be reduced by directed or random mutagenesis, or by directed evolution techniques.
- the point mutations introduced may concern all the portions of the protein.
- mutations may be introduced at the periphery of the catalytic site, or even in portions remote from the catalytic site, said mutations making it possible to reduce the activity of the catalytic site by the structural modifications induced.
- the hydrolytic activity of the original specific hydrolase has been reduced by modifying the catalytic site of said hydrolase, i.e. of at least one residue of said catalytic site.
- the catalytic site also called active site, refers to a three-dimensional structure within the enzyme, which has the shape of a cavity also called "pocket".
- the molecules on which the enzyme acts bind in the active site of the enzyme by forming interactions with the surface of the cavity of the active site.
- Certain amino acids forming the cavity of the active site can participate in the hydrolysis reaction: these amino acids are called catalytic residues.
- glycosidases the reaction mechanisms taking place in the catalytic site have been described ( ⁇ ti et al., 2017). In particular, it has been shown that the reaction hydrolysis involves residues of glutamic acid (E) or aspartic acid (D), whose side chains are negatively charged.
- the neolectin is derived from a hydrolase whose catalytic site has been modified so as to reduce its catalytic activity, and therefore the kcat value, while maintaining a significant affinity for the substrate, c ie a KM value of the same order of magnitude as the KM value of the original hydrolase, all these constants being measured independently but under equivalent or even similar experimental conditions in order to be able to be compared.
- At least one residue of the catalytic site of the hydrolase has been replaced by another residue.
- At least one residue means that one, two, three or even four or more residues of the catalytic site can be replaced.
- a residue of glutamic acid (E) and/or an aspartic acid residue (D), located in the catalytic site of the enzyme is replaced by another residue whose side chain is not charged. negatively.
- This residue E or D may in particular be replaced: by a residue whose side chain can be charged according to the local pH: serine (S), threonine (T), asparagine (N), glutamine (Q); or else by a residue chosen from alanine (A), glycine (G), proline (P) or cysteine (C).
- the catalytic site of the original hydrolase has been modified by replacing at least one glutamic acid residue (E). More specifically, this glutamic acid residue may be replaced by a serine, a cysteine or a glutamine, preferably by a cysteine or a glutamine. In the case of galactofuranosidase from JHA 19 Streptomyces sp., this glutamic acid residue may in particular be that located at position 464, and/or at position 573. In particular, residue E464 will be replaced by a serine, a cysteine or a glutamine.
- the catalytic site of the original hydrolase has been modified by the replacement of at least one residue of aspartic acid (D). More specifically, this aspartic acid residue may be replaced by a serine, a cysteine or a glutamine, preferably by a cysteine or a glutamine.
- E464S is the replacement of glutamic acid at position 464 with a serine
- E464C is the replacement of glutamic acid at position 464 with a cysteine
- E464Q the replacement of glutamic acid at position 464 with a glutamine.
- the galactofuranosidases with the point mutations E464S, E464C and E464Q show these characteristics of kcat and KM.
- the neolectin is a protein having a peptide sequence chosen from the following: SEQ ID No. 2, SEQ ID No. 3, and SEQ ID No. 4. More specifically, the neolectin according to the invention is a protein having the peptide sequence SEQ ID No. 4.
- the neolectin defined above retains the original properties of the hydrolase from which it is derived.
- the hydrolase from JHA 19 Streptomyces sp., a thermophilic microorganism is originally thermostable.
- the neolectin derived from this hydrolase is particularly thermostable, as presented in the experimental part of the application.
- the present invention also relates to the use of a neolectin coupled to at least one protein having another function, for example to an enzyme or to a cytotoxic protein.
- Such a protein construct is referred to as a “multifunctional neolectin”.
- This multifunctional neolectin comprises at least two covalently or non-covalently bonded monomers, one of which is the neolectin according to the invention.
- the present invention also relates to the use of a multimeric neolectin consisting of at least two neolectins, including at least one neolectin as defined above.
- Each monomer is made up of a peptide chain comprising a site that specifically recognizes a particular osidic unit.
- Monomeric proteins include dimers (which consist of two subunits), trimers (three subunits), tetramers (four subunits), etc.
- a multimeric neolectin comprises at least two, three or four monomers, all consisting of a neolectin as defined above, and therefore contains at least two, three or four identical active sites.
- the multimeric neolectin used comprises a single monomer consisting of a neolectin as defined above, coupled to one or more other monomers consisting of other lectins, each having a recognition site having a specificity different and therefore recognizing other saccharide units than D-galactofuranose.
- the multimeric neolectin used will comprise a monomer specific for a furanose entity, and another monomer specific for a pyranose entity.
- a multimeric neolectin By thus modulating the specificity of a multimeric neolectin, it will be possible to create neolectins capable of recognizing with great specificity a particular microorganism, having an original signature of osidic entities expressed on the surface.
- the neolectin used can be coupled to a marker and/or to a molecular tag.
- This coupling may be covalent or non-covalent, and will preferably be a covalent coupling.
- This coupling will be carried out by genetic engineering, by associating the nucleic acids encoding on the one hand the neolectin as defined, and on the other hand the marker or/and the molecular tag.
- the marker can be a biotin (recognized by streptavidin), or a colored or fluorescent marker, such as for example a fluorescent protein (GFP, RFP, CFP, YFP).
- a molecular tag may in particular be chosen from among the "tags" well known to those skilled in the art, added by genetic modification: poly-histidine tags (5 or 6 histidines), FLAG tag (DYKDDDK), HA tag (YPYDVPDYA), glutatione -S-transferase, Calmodulin Binding Peptide (26 amino acid tag), etc.
- the neolectin used according to the invention is coupled either to a marker, or to a molecular tag, or to a marker and a molecular tag.
- the present invention also relates to a neolectin as defined above.
- the neolectin according to the invention is coupled to a marker and/or to a molecular tag.
- This coupling may be covalent or non-covalent, and will preferably be a covalent coupling.
- This coupling will be carried out by genetic engineering, by associating the nucleic acids encoding on the one hand the neolectin according to the invention, and on the other hand the marker or/and the molecular tag.
- the marker can be a biotin (recognized by streptavidin), or a colored or fluorescent marker, such as for example a fluorescent protein (GFP, RFP, CFP, YFP).
- a biotin cognized by streptavidin
- a colored or fluorescent marker such as for example a fluorescent protein (GFP, RFP, CFP, YFP).
- a molecular tag may in particular be chosen from the "tags" well known to those skilled in the art, added by genetic modification: poly-histidine tags (5 or 6 histidines), FLAG tag (DYKDDDK), HA tag (YPYDVPDYA), glutatione -S-transferase, Calmodulin Binding Peptide (26 amino acid tag), etc.
- the neolectin according to the invention is coupled either to a marker, or to a molecular tag, or to a marker and a molecular tag.
- the present invention also relates to a method for detecting the presence of microorganism(s) in a sample, the said microorganism(s) having on their surface at least one osidic unit of the hexofuranoside type, comprising the following steps: bringing the sample into contact with at least one neolectin coupled to a marker and/or to a molecular tag, detection of the marker and/or of the molecular tag, characterized in that when the said marker and/or molecular tag is detected, then the presence of at least one microorganism exhibiting at its surface at least one osidic unit of hexofuranoside type is established.
- the present invention relates to a method for detecting the presence of microorganism(s) in a sample, the said microorganism(s) having on their surface at least one osidic unit of the hexofuranoside type, comprising a step of bringing the neolectin into contact as described above with the sample, and a step of detecting the interactions of this neolectin with osidic units present in the sample.
- the contacting step could for example be carried out in the wells of a plate suitable for such tests.
- the neolectin used is immobilized on the plate and each sample tested is placed in different wells of the plate.
- Example 4 The conditions of this contacting step will be easily determined by those skilled in the art, in particular as regards the incubation period, the agitation and the temperature.
- the conditions presented in Example 4 may in particular be used (incubation for 2 h at 37° C. with gentle agitation).
- microorganism we mean in the sense of the invention any microscopic living being, that is to say invisible to the naked eye. This term refers in particular to bacteria, viruses, parasites and microscopic fungi.
- the present invention relates to the use of a neolectin as described above, or of the method according to the invention, for detecting the presence of microorganism(s) chosen from bacteria and microscopic and/or unicellular parasites .
- the sugar units detected on the surface of said microorganisms are generally incorporated into glycoconjugates (glycoproteins, glycolipids, proteo- and glycosaminoglycans) or oligo-/polysaccharides, present on the surface of certain microorganisms present in the sample.
- glycoconjugates glycoproteins, glycolipids, proteo- and glycosaminoglycans
- oligo-/polysaccharides present on the surface of certain microorganisms present in the sample.
- the neolectin is coupled to a marker and/or to a molecular tag.
- this use and this method are particularly suitable for detecting microorganisms belonging to one of the following species: Leishmania, Mycobacterium, Trypanosoma cruzi, Aspergillus, Reni bacterium salmoninarum, Actinobacillus, Pleuropneumoniae, Yersinia pestis, Lachnoanaerobaculum saburreum and Cryphonectria parasitica.
- the sample analyzed will be chosen from the following list: a biological fluid (blood, lymph, tears, respiratory secretions, urine, cerebrospinal fluid) or a sample of tissue from a living organism, human or animal (obtained by biopsy), a sample taken from consumer products such as food or hygiene products, a sample taken from technical products such as laboratory reagents and industrial reagents, a sample taken from stagnant water (marshes, ponds) or flowing water, for example river water, sea water, and water flowing in pipes, and a sample taken from any type of surface (floor, work surfaces, reactor walls).
- a biological fluid blood, lymph, tears, respiratory secretions, urine, cerebrospinal fluid
- a sample of tissue from a living organism, human or animal obtained by biopsy
- a sample taken from consumer products such as food or hygiene products
- a sample taken from technical products such as laboratory reagents and industrial reagents
- a sample taken from stagnant water (marshes, ponds) or flowing water for example river
- the sample analyzed comes from a human organism, and the use of the neolectin or the process makes it possible to detect the presence of pathogenic microorganisms in this sample.
- Neolectin is thus used in a method for diagnosing microbial infections.
- the present invention relates to a detection kit for identifying the presence of microorganisms having on their surface at least one osidic unit of the hexofuranoside type, comprising the following elements: at least one neolectin according to the invention, preferably a neolectin coupled to a marker and/or to a molecular tag, or a nucleic acid encoding said neolectin; reagents suitable for the detection of said neolectin.
- This kit may also include an explanatory note, and/or equipment, suitable for carrying out the method for detecting microorganisms described above.
- the neolectin will be coupled to a colored or fluorescent marker
- the kit will comprise the appropriate reagents for the detection of this colored or fluorescent marker.
- the kit comprises an expression vector, consisting of nucleic acid, coding for a neolectin according to the invention; this expression vector will be introduced into host cells, in particular bacterial cells, to allow the expression of the neolectin.
- the kit then comprises reagents allowing the introduction of the expression vector into host cells.
- Example 1 Generation of a neolectin from a hydrolase
- neolectin An enzyme with excellent enzymatic activity has been modified to suppress its hydrolytic activity and retain only its recognition properties to make it a synthetic lectin specific for D-galactofuranose called neolectin.
- E464S is the replacement of glutamic acid at position 464 with a serine
- E464C is the replacement of glutamic acid at position 464 with a cysteine
- E464Q is the replacement of glutamic acid at position 464 with a glutamine.
- the peptide sequence used comprises a histidine tag and therefore has the peptide sequence SEQ ID NO. 5, with a length of 822 amino acids, presented below, the underlined characters being the residues of the histidine tag as well as the residue E464:
- Example 2 Binding characteristics of this neolectin to Gal, in comparison with those of the lectins DC-SIGN and intelectin-1.
- DC-SIGN is not able to recognize the D-galactofuranose entity (carried by this probe), contrary to what has been published ( Figure 2A). Indeed, DC-SIGN is not able to move the probe: there is therefore no fluorescence intensity measured.
- the second lectin that has been reported in the literature to interact with D-galactofuranose is lntelectin-1 (or Omentin or Intelectin).
- the results obtained are presented in Figure 2B, and show that the interaction of the lectin with the BS ⁇ -Galf probe is well detected and is specific for this sugar (no interaction with the BS ⁇ -Fuc and BS ⁇ -aGal probes).
- the IC50 for the Galf probe (which represents the amount of inhibitor needed to achieve 50% inhibition of enzyme/substrate binding, which is therefore another constant related to affinity) neolectins tested was determined:
- the experimental protocol for performing inhibition tests on neolectin was described in the article (Landemarre et al., 2013).
- the neolectin is first immobilized at the bottom of a 96-well plate.
- the interaction profiles of each compound were determined by an indirect method based on the inhibition by the compound of the interaction between the neolectin and the NeoGalf neoglycoprotein specific for the latter. Briefly, a mixture of neoglycoproteins (fixed concentration) and corresponding compounds (range of concentrations) prepared in PBS supplemented with CaCl2 (1 mM) and MgCl2 (0.5 mM) is added to each well (50 ⁇ L each) in triplicate and incubated for two hours at room temperature.
- Figure 3B shows the results obtained. No inhibition takes place in the case of the following oses: PNPBDGalp, PNPaLAraf, which demonstrates the specificity of the neolectin of the invention for D-galactofuranose.
- the neolectin tested recognizes neither D-galactopyranose nor arabinose, which are the 2 structurally closest sugars. Only GalfN3 and Galf-Tolyle are recognized.
- Example 4 Use of neolectin to detect microorganisms in a biological sample
- the neolectin is first immobilized at the bottom of a 96-well plate.
- a bacterial culture of Aspergillus niger is carried out following the requirements specific to this microbial type. After centrifugation and counting, the microbial pellet is taken up in PBS and labeled with carboxyfluorescein diacetate succinimidylester (CFDA-SE, Sigma-Aldrich, St. Louis, MO, USA) for 1 hour at 37° C. Then the bacterial suspension is centrifuged and washed twice using PBS buffer. The labeled bacteria are added to each well of the microplate immobilized with the neolectin and incubated for 2 h at 37° C. with gentle shaking.
- CFDA-SE carboxyfluorescein diacetate succinimidylester
- a calibration curve is produced with the solution of labeled bacteria to determine the number of bacteria remaining in interaction with the neolectin.
- Example 5 Other characteristics of the neolectins used according to the invention
- Neolectins exhibit thermostability up to 60-70°C, which is an advantage for the study of complex biological fluids.
- Binding sugars from natural lectins to synthetic receptors and engineered neolectins. Chemical Society reviews, 42(11), 4798-4813.
- Senicar M., Legentil, L., Ferrines, V., Eliseeva, S. V., Petoud, S., Takegawa, K., Lafite, P., & Daniellou, R. (2019). Galactofuranosidase from JHA 19 Streptomyces sp.: subcloning and biochemical characterization. Carbohydrate research, 480, 35-41.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
23 ABREGE La présente invention concerne l'utilisation d'une néolectine pour détecter la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, caractérisée en ce que ladite néolectine est issue d'une hydrolase spécifique d'une unité osidique de type hexofuranoside dont l'activité hydrolytique a été réduite.
Description
UTILISATION D’UNE NEOLECTINE SPECIFIQUE POUR DETECTER DES MICROORGANISMES
DOMAINE DE L'INVENTION
La présente invention concerne l’utilisation d’une néolectine spécifique pour détecter la présence de microorganismes dans un échantillon, lesdits microorganismes présentant à leur surface au moins une unité osidique de type hexofuranoside.
ETAT DE LA TECHNIQUE
Les glycanes sont des molécules impliquées dans de nombreux phénomènes biologiques, et plus particulièrement dans la communication cellulaire et la reconnaissance moléculaire, grâce à leurs parties saccharidiques. De par leur grande diversité structurale, de nombreuses combinaisons peuvent être obtenues en combinant plusieurs unités monosaccharidiques.
Le nombre de combinaisons possibles est encore plus élevé si l’on considère la capacité naturelle des unités osidiques à cycliser sous deux formes : la forme pyranose, comprenant un hétérocycle à 6 atomes : 5 de carbone et un d'oxygène, qui est thermodynamiquement favorisée, et la forme furanose, comprenant un hétérocycle à 5 atomes, consistant en 4 atomes de carbone et un atome d'oxygène.
Les pentoses, unités osidiques constituées de 5 atomes de carbone, existent sous l’une des deux formes pyranose ou furanose. On peut citer comme exemples : le ribose : le ribofuranose est la forme présente dans les acides nucléiques de tous les organismes ; dans l'eau, la forme prédominante est le B-D-ribopyranose ; le xylose, sucre présent dans les plantes et le bois : la forme xylopyranose est majoritaire dans les polysaccharides (pectine, etc) des plantes ; dans l'eau, la forme prédominante est le B-D-xylofuranose.
En ce qui concerne les hexoses de formule brute CÔHIZOÔ, ces unités osidiques peuvent également exister sous les deux formes. Par exemple, le beta -galactose existe sous la forme D-galactofuranose (I, Gai ), et sous la forme D-galactopyranose (II, Galp), comme cela est présenté dans les formules développés (I) et (II) ci-dessous :
Formule (I) Formule (II)
Toutefois, dans les cellules mammifères, les hexoses sont exclusivement présents sous la forme pyranose : ils sont désignés hexopyranosides.
Alors que les hexofuranosides sont totalement absents des cellules mammifères, leur présence a été observée dans certains polysaccharides extraits de microorganismes, notamment de microorganismes pathogènes tels que Mycobacterium, Trypanosoma, Leishmania et Aspergillus (Peltier et al., 2008).
Cette présence spécifique de certains oses, et donc des glycoprotéines les comprenant, pourrait être utilisée pour détecter, dans des échantillons biologiques, la présence de microorganismes présentant lesdites glycoprotéines à leur surface. Les hexofuranosides étant absents des cellules mammifères, celles-ci deviendraient ainsi distinguables des autres cellules présentes dans un échantillon complexe.
Toutefois, à ce jour, aucun procédé de détection de ce type n’a été décrit, faute d’outil moléculaire adéquat permettant une telle détection spécifique d’hexofuranosides.
Les protéines de reconnaissance des sucres sont dénommées lectines. De par leur spécificité pour les glycanes présentées à la surface des cellules, les lectines peuvent servir de sonde moléculaire pour détecter spécifiquement certaines cellules.
Récemment, la notion de « néolectines », lectines synthétiques produites dans un but spécifique, en particulier pour reconnaître certains sucres, a été développée. Ces néolectines peuvent être synthétisées de novo, ou être dérivées, par mutations ponctuelles, de glycosidases ou de lectines naturelles (Arnaud et al., 2013).
A ce jour, peu de lectines naturelles capables de reconnaître des oses sous forme furanose (tels que D-galactofuranose, D-arabinofuranose) ont été identifiées.
Dans l’espèce humaine, deux lectines ont été identifiées, l’intelectine (Tsuji et al., 2001 ) et le DC-SIGN (Chiodo et al., 2013), qui reconnaissent le D-galactofuranose avec une faible spécificité.
Toutefois, ces deux lectines ne sont pas spécifiques exclusivement des formes furanoses :
la lectine DC-SIGN est exprimée à la surface des cellules dendritiques, et interagit avec le D-galactofuranose ; cette interaction induit une réponse pro-inflammatoire du système immunitaire. Toutefois, DC-SIGN interagit également avec de nombreux autres oses, notamment avec le D-mannopyranose, avec la forme D-galactopyranose Galp, ainsi qu’avec le glucoside 6 ; l’intelectine humaine (ou Omentine) reconnaît le D-galactofuranose (B-Galf) et donc les glycanes le comprenant, mais également d’autres glycanes qui comprennent les unités osidiques suivantes: des motifs D-phospho-glycerol (Gro-P), des heptoses, le D-glycero-D-talo-oct-2- ulosonic acide (KO) et le 3-deoxy-D-manno-oct-2-ulosonic acide (KDO) (Wesener et al., 2015).
Le brevet US 10,082,506 décrit une méthode de détection de microorganismes basée sur cette capacité de l’intelectine humaine à se lier à ces glycanes, exclusivement exprimés par des microorganismes. Toutefois, il ne s’agit pas d’une méthode de détection spécifique des formes furanoses.
La demande internationale WO 2018/208977 décrit une autre méthode de détection de D- galactofuranose dans un échantillon biologique, basée sur l’utilisation d’un anticorps spécifique du D-galactofuranose, après inhibition de la liaison intelectine / D- galactofuranose.
Toutefois, il est malaisé de produire des anticorps contre des unités osidiques, qui sont par nature très peu immunogènes. L’utilisation d’anticorps pour détecter des sucres n’est donc pas privilégiée.
Par contre, les lectines sont des outils adaptés pour la détection d’unités osidiques.
Toutefois, il n’existe pas, à ce jour, de méthode mettant en oeuvre une lectine, permettant de détecter uniquement et manière spécifique la présence d’un hexofuranose dans un échantillon biologique.
Les inventeurs de la présente invention ont généré pour la première fois une néolectine ayant une excellente spécificité pour les hexofuranoses. La présente demande décrit certaines formes de cette néolectine spécifique d’une unité osidique de type hexofuranoside, et également l’utilisation de cette néolectine pour détecter la présence de microorganisme(s) exprimant lesdits hexofuranoses dans un échantillon.
EXPOSE DE L'INVENTION
La présente invention concerne l’utilisation d’une néolectine pour détecter la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, caractérisée en ce que ladite
néolectine est issue d’une hydrolase spécifique d’une unité osidique de type hexofuranoside dont l’activité hydrolytique a été réduite.
Plus spécifiquement, ladite néolectine reconnaissant spécifiquement un hexofuranoside, consiste en une hydrolase spécifique dudit hexofuranoside dont le site catalytique a été modifié pour réduire l’activité hydrolytique de ladite enzyme.
Plus particulièrement, ladite néolectine peut consister en la galactofuranosidase issue de JHA 19 Streptomyces sp., dont l’activité hydrolytique a été réduite par rapport à son activité naturelle d’origine.
La présente invention concerne également un procédé de détection de la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside.
La présente invention est également relative à un kit de détection pour identifier la présence de microorganismes présentant à leur surface au moins une unité osidique de type hexofuranoside, comprenant les éléments suivants : au moins une néolectine telle que décrite ci-dessus, ou un acide nucléique codant pour ladite néolectine; des réactifs adaptés pour la détection de ladite néolectine.
La présente invention concerne également une néolectine telle que définie ci-dessus, notamment une néolectine couplée à un marqueur et/ou à une étiquette moléculaire.
DESCRIPTION DES FIGURES
[Fig. 1 ] représente la caractérisation cinétique de trois néolectines de la présente invention, issues d’une même hydrolase, dont l’activité hydrolytique (kcat) est réduite, capables de reconnaissance spécifique du Gai (KM du même ordre de grandeur que celle de l’hydrolase d’origine). L’activité relative d’hydrolyse en fonction du pH est présentée dans le graphique en bas à droite, pour l’hydrolase d’origine (WT, en gris) et pour la néolectine E464Q (en noir).
[Fig. 2À] représente le profil d’interaction de la sonde fluorescente BSÀ-Gal/ avec la lectine DC-SIGN en fonction de la quantité de DC-SIGN fixée dans les puits. La courbe en pontillés avec triangles représente la fluorescence mesurée lorsque la sonde ManBSÀ est utilisée. La même expérience est également réalisée en présence d’un composé antagoniste de la liaison à DC-SIGN : GalNac-BSÀ.
[Fig. 2B] représente le profil d’interaction des sondes BSÀ-Galf (en haut), BSÀ-Fuc et BSÀ-a- Gal (en bas) avec l’Intelectin. L’interaction intelectine / BSÀ-Galf est mesurée en fonction
de la quantité d’intelectine fixée dans les puits de la plaque. Avec les autres sondes, l’Intelectine est fixée dans les puits à une quantité de 2000 ng/puits.
[Fig. 2C] représente le profil d’interaction de la sonde BSA-Galf avec la néolectine selon l’invention, en fonction de la quantité de néolectine fixée dans les puits.
[Fig. 3A] représente les structures chimiques développées des galactofuranosides testés comme compétiteurs de l’interaction BSA-Galf/Néolectine, les résultats de cette expérience de compétition étant présentés en figure 3B.
[Fig. 3B] représente un test d’inhibition de l’interaction BSA-Galf/Néolectine avec les galactofuranosides présentés en figure 3A : GalfN3 (b-D-Galf N3), Galf-Thiolyle (Tolyl b-D- Galf), PNP-bGalf (pNP b-D-Galf), PNP-bGalp (pNP b-D-Galp) et PNP-aAraF.
[Fig. 4A] représente la détection de l’interaction Néolectine/Aspergillus par reconnaissance directe, ou [Fig. 4B] par compétition avec le BSA-Galf.
[Fig. 5] représente l’activité résiduelle hydrolytique de la néolectine E464Q (SEQ ID No. 4) en fonction de la température, et démontre sa thermostabilité.
DESCRIPTION DETAILLEE DE L'INVENTION
La présente invention concerne l’utilisation d’une néolectine pour détecter la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, caractérisée en ce que ladite néolectine est issue d’une hydrolase spécifique d’une unité osidique de type hexofuranoside dont l’activité hydrolytique a été réduite.
Le terme « lectine » désigne une protéine capable d’interagir spécifiquement avec des sucres ou des glycoprotéines comprenant des unités osidiques. Les lectines interviennent dans divers processus biologiques, notamment au niveau de la reconnaissance entre les cellules, en se liant avec des glycoprotéines membranaires.
Au sens de l’invention, le terme « néolectine » désigne une lectine non naturelle, synthétisée de novo ou, plus souvent, obtenue à partir d’une lectine naturelle qui a été modifiée de manière dirigée pour présenter des caractéristiques spécifiques. Cette notion de néolectine est notamment présentée dans l’article (Arnaud et al., 2013). Ainsi, le terme « néolectine » désigne une lectine synthétique.
Au sens de l’invention, les termes « hexofuranose » et « hexofuranoside », utilisés indifféremment dans la présente demande, désignent des unités sucres libres (« ose ») ou glycosylés en position anomérique (« oside ») cyclisées sous la forme « furanose » c’est-à- dire comprenant un cycle constitué de 5 atomes, 4 de carbone et un d’oxygène. Un exemple
est notamment le D-galactofuranose (Gai ), forme furanose du galactose, dont la formule développée est présentée en formule (I).
Par « enzyme hydrolytique » ou « hydrolase », utilisés indifféremment dans la demande, on entend une enzyme possédant une activité d’hydrolyse de molécules suivant la réaction générale :
R-R' + H2O R-OH + R'-H
Plus spécifiquement, l’hydrolase considérée au sens de l’invention est une glycosidase, classifiée dans le groupe EC 3.2.1.x.
Àu sens de l’invention, « une hydrolase spécifique d’une unité osidique de type hexofuranoside» désigne une enzyme dont le substrat est un hexofuranoside. Cette hydrolase possède donc un site catalytique, constitué d’une « poche » de fixation dudit hexofuranoside, où a lieu la réaction d’hydrolyse présentée à l’équation 1.
Cette hydrolase est également qualifiée, dans la présente demande, d’« enzyme initiale » ou « enzyme d’origine » ou « hydrolase d’origine » ou encore « enzyme avant modification ».
La néolectine définie dans l’invention est issue de ladite hydrolase spécifique, c’est-à-dire qu’elle a été obtenue par modifications introduites dans la séquence peptidique de cette hydrolase d’origine.
L’expression « réduire l’activité hydrolytique d’une enzyme » fait référence à une ou plusieurs modifications de la séquence peptidique d’une enzyme, permettant de diminuer voire d’éliminer totalement son activité catalytique.
L’expression « hydrolase dont l’activité hydrolytique a été réduite » désigne une hydrolase dont la séquence peptidique a été modifiée pour réduire voire éliminer totalement son activité enzymatique, notamment en modifiant sa séquence primaire.
La réduction de l’activité hydrolytique peut être évaluée de manière chiffrée grâce à la constante catalytique kcat de l’enzyme.
La relation entre une enzyme et son substrat peut être qualifiée selon plusieurs paramètres, et notamment selon deux constantes : la constante catalytique kcat et la constance de Michaelis KM.
La constante catalytique kcat représente le nombre maximum de molécules de substrat transformées par unité de temps et par molécule d'enzyme ; cette valeur est exprimée en sec1 ou min 1, c’est-à-dire en nombre de molécules de substrat transformées (dans le cas présent, hydrolysées selon l’équation 1 ) en une seconde ou une minute.
Selon l’invention, l’expression « réduire l’activité hydrolytique d’une enzyme » signifie diminuer la valeur de kcat de cette enzyme, par exemple réduire sa valeur de kcat d’au moins
50%, 60%, 70%, 80%, ou 90% de sa valeur initiale, voire d’éliminer totalement l’activité soit une diminution de 100% de la valeur initiale de kcat. Une réduction d’au moins 50% de la valeur initiale de kcat signifie que la valeur de kcat de l’hydrolase avant toute modification a été divisée par deux. Comme cela est présenté dans les exemples, des hydrolases modifiées ont été obtenues avec des valeurs de kcat divisées par 80 fois ou même par 2000 fois par rapport à la valeur initiale de l’enzyme d’origine.
Selon l’invention, une hydrolase dont l’activité hydrolytique a été réduite est notamment une hydrolase dont la valeur de kcat est égale ou inférieure à 10% de la valeur de kcat de l’hydrolase d’origine, les deux valeurs étant mesurées dans des conditions équivalentes (de pH, température, milieu réactionnel, durée d’incubation, ...), bien connues de l’Homme du métier. Cette hydrolase est désignée dans la présente demande par les termes « hydrolase modifiée » ou « néolectine ».
En particulier, une hydrolase dont l’activité hydrolytique a été réduite présente une valeur de kcat égale ou inférieure à 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% ou 1% de la valeur de kcat de l’hydrolase d’origine, mesurées dans des conditions équivalentes.
Cette réduction ou élimination de l’activité hydrolytique d’une enzyme est réalisée sans modifier de manière significative la valeur de la constante de Michaelis de l’enzyme considérée.
La constante de Michaelis, désignée par l’abréviation KM, est une valeur exprimée en mole/litre, qui correspond à la valeur de la concentration de substrat pour laquelle la vitesse de réaction enzymatique est égale à la moitié de la vitesse maximale Vmax ; cette constante est reliée à la constante de dissociation (K<j) de l'enzyme pour son substrat, valeur qui représente la force de l’interaction entre les deux, mais n'est en général pas strictement égale à celle-ci. En effet, la constante KM dépend également de la valeur de kcat, selon l’équation suivante :
KM = (kcat + k-i) / ki où ki représente la vitesse de formation du complexe enzyme-substrat et k-i la vitesse de la réaction inverse de dissociation de l’enzyme et du substrat.
Plus le KM est élevé, plus la concentration de substrat nécessaire à une activité importante de l'enzyme est élevée. Cela traduit une faible affinité de l'enzyme pour son substrat.
Plus le KM est faible, plus l'activité enzymatique maximale est atteinte pour un faible niveau de concentration de substrat. L'affinité de l'enzyme pour le substrat est forte. C’est souvent le cas d'enzymes sélectives et/ou très actives.
Dans le cas présent d’une hydrolase modifiée ayant une activité catalytique représentée par la valeur kcat réduite, voire très réduite, la valeur du KM est impactée par cette valeur de kcat
très faible, mais sans que cela n’ait d’incidence sur la réelle affinité de l’enzyme modifiée pour son substrat.
De préférence, la valeur de KM de la néolectine sera du même ordre de grandeur que la valeur KM initiale de l’enzyme avant modification, les deux valeurs de KM étant mesurées dans des conditions équivalentes (pH, température, milieu réactionnel, durée d’incubation...) qui pourront être choisies par l’Homme du métier sur la base de ses connaissances générales.
La valeur de KM de la néolectine sera de préférence égale à environ 50%, 60%, 70%, 80%, 90% ou 95% de la valeur KM de l’hydrolase d’origine.
D-galactofuranose et hydrolase spécifique
Les hexoses, monosaccharides comportant 6 carbones, ont tous la même formule brute CÔHIZOÔ. Ils possèdent tous un groupement carbonyle : soit une fonction aldéhyde en position 1 (aldohexoses) ; soit une fonction cétone en position 2 (principalement), 3, 4 ou 5 (cétohexoses ou dihydroxycétone).
On peut citer comme exemple d’hexose : le glucose, le galactose, le fucose et le mannose, naturellement présents dans la nature.
Parmi ces hexoses, peu d’entre eux ont été identifiés comme adoptant une structure de type furanose ; ainsi, parmi les hexofuranoses, le D-galactofuranose est le composé majoritaire.
Selon une mise en oeuvre préférée, la présente invention concerne une néolectine reconnaissant spécifiquement le D-galactofuranose (Gai ).
Récemment, une galactofuranosidase a été identifiée dans l’espèce JHÀ 19 Streptomyces sp. (Matsunaga et al., 2015). Après purification de cette enzyme, il a été mis en évidence qu’elle hydrolyse de manière exclusive le substrat D-galactofuranose (Senicar et al., 2019). Cet article rapporte l’utilisation de 21 monosaccharides différents testés comme substrat de l’enzyme ; les résultats obtenus démontrent que seul le D-galactofuranose est hydrolysé, même les analogues du Gai tels que Ara/ (arabinofuranose) ou Rib/ (ribofuranose) ne sont pas hydrolysés par cette enzyme.
Par ailleurs, les caractéristiques cinétiques de cette enzyme ont été déterminées : la constance de Michaelis KM avec le substrat Gai/ est égale à 250 pM ; la constance catalytique kcat est de 213 min 1.
Selon une mise en œuvre particulière, la néolectine de l’invention consiste en la galactofuranosidase issue de JHA 19 Streptomyces sp., dont l’activité catalytique a été réduite, et plus spécifiquement dont le site catalytique a été modifié.
La séquence de cette galactofuranosidase, avant modification du site catalytique, est présentée en SEQ ID NO. 1 .
Selon une autre mise en œuvre particulière, la néolectine de l’invention consiste en une galactofuranosidase ayant une séquence peptidique présentant au moins 80%, ou 85%, ou 90%, ou 95%, ou 98%, ou 99% d’identité de séquence avec la séquence peptidique SEQ ID NO. 1.
Modifications du site catalytique de hydrolase
Tous les moyens connus de l’Homme du métier pour réduire l’activité hydrolytique d’une hydrolase pourront être mis en œuvre pour obtenir la néolectine définie dans la présente demande.
Par exemple, l’activité hydrolytique d’une hydrolase peut être réduite par des actions de mutagenèse dirigée ou aléatoire, ou encore par des techniques d’évolution dirigée.
Dans le cas où la réduction de l’activité hydrolytique de l’hydrolase est réalisée par mutagenèse dirigée, les mutations ponctuelles introduites pourront concerner toutes les portions de la protéine. En particulier, des mutations pourront être introduites à la périphérie du site catalytique, ou même dans des portions éloignées du site catalytique, lesdites mutations permettant de réduire l’activité du site catalytique de par les modifications structurelles induites.
Selon une mise en œuvre particulière, l’activité hydrolytique de l’hydrolase spécifique d’origine a été réduite par une modification du site catalytique de ladite hydrolase, i.e. d’au moins un résidu dudit site catalytique.
Le site catalytique, aussi dénommé site actif, fait référence à une structure tridimensionnelle au sein de l’enzyme, qui a la forme d'une cavité aussi dite « poche ». Les molécules sur lesquelles agit l’enzyme se fixent dans le site actif de l'enzyme en formant des interactions avec la surface de la cavité du site actif. Certaines acides aminés formant la cavité du site actif peuvent participer à la réaction d’hydrolyse : on dénomme ces acides aminés des résidus catalytiques.
L’Homme du métier connaît de multiples moyens de modifier le site catalytique d’une enzyme dont la séquence peptidique et l’activité enzymatique sont connues.
En ce qui concerne les glycosidases, les mécanismes réactionnels prenant place dans le site catalytique ont été décrits (Àti et al., 2017). Il a notamment été montré que la réaction
d’hydrolyse implique des résidus d’acide glutamique (E) ou d’acide aspartique (D), dont les chaînes latérales sont chargées négativement.
Dans le cadre de la présente invention, la néolectine est issue d’une hydrolase dont le site catalytique a été modifié de manière à en réduire l’activité catalytique, et donc la valeur kcat, tout en maintenant une affinité significative pour le substrat, c’est-à-dire une valeur de KM du même ordre de grandeur que la valeur de KM de l’hydrolase d’origine, toutes ces constantes étant mesurées indépendamment mais dans des conditions expérimentales équivalentes voire similaires pour pouvoir être comparées.
Selon une mise en oeuvre de l’invention, au moins un résidu du site catalytique de l’hydrolase a été remplacé par un autre résidu. « Àu moins un résidu » signifie qu’un, deux, trois voire quatre résidus ou plus du site catalytique peuvent être remplacés.
En particulier, un résidu d’acide glutamique (E) et/ou un résidu d’acide aspartique (D), situé dans le site catalytique de l’enzyme, est remplacé par un autre résidu dont la chaîne latérale n’est pas chargée négativement.
Ce résidu E ou D pourra notamment être remplacé : par un résidu dont la chaîne latérale peut être chargée suivant le pH local : sérine (S), thréonine (T), asparagine (N), glutamine (Q) ; ou bien par un résidu choisi parmi l’alanine (À), la glycine (G), la proline (P) ou la cystéine (C).
Selon une mise en oeuvre préférée de l’invention, le site catalytique de l’hydrolase d'origine a été modifié par le remplacement d’au moins un résidu d’acide glutamique (E). Plus précisément, ce résidu d’acide glutamique pourra être remplacé par une sérine, une cystéine ou une glutamine, de manière préférée par une cystéine ou une glutamine. Dans le cas de la galactofuranosidase issue de JHA 19 Streptomyces sp., ce résidu d’acide glutamique pourra notamment être celui situé en position 464, et/ou en position 573. En particulier, le résidu E464 sera remplacé par une sérine, une cystéine ou une glutamine.
Selon une autre mise en oeuvre de l’invention, le site catalytique de l’hydrolase d’origine a été modifié par le remplacement d’au moins un résidu d’acide aspartique (D). Plus précisément, ce résidu d’acide aspartique pourra être remplacé par une sérine, une cystéine ou une glutamine, de manière préférée par une cystéine ou une glutamine.
Comme cela est présenté dans l’exemple 1 , les remplacements du résidu suivant de la galactofuranosidase issue de JHÀ 19 Streptomyces sp. ont été testés :
E464S soit le remplacement de l’acide glutamique en position 464 avec une sérine ;
E464C soit le remplacement de l’acide glutamique en position 464 avec une cystéine ;
E464Q le remplacement de l’acide glutamique en position 464 avec une glutamine.
Les caractéristiques cinétiques (constante de Michaelis KM et constante catalytique kcat) de chaque hydrolase modifiée ont été déterminées et sont présentées dans le tableau 1 suivant :
Parmi ces enzymes modifiées, dans le but d’obtenir une néolectine reconnaissant spécifiquement le D-galactofuranose mais possédant une activité d’hydrolyse réduite, le choix se porte sur les protéines présentant à la fois un KM (constante liée à l’affinité pour le substrat) du même ordre de grandeur que celui de l’enzyme d’origine, et une kcat réduite à moins de 10% de la valeur de kcatde l’hydrolase d’origine.
Dans le cas présent, les galactofuranosidases présentant les mutations ponctuelles E464S, E464C et E464Q présentent ces caractéristiques de kcat et de KM.
Ainsi, selon une mise en oeuvre particulière de l’invention, la néolectine est une protéine présentant une séquence peptidique choisie parmi les suivantes : SEQ ID No. 2, SEQ ID No. 3, et SEQ ID No. 4. Plus spécifiquement, la néolectine selon l’invention est une protéine présentant la séquence peptidique SEQ ID No. 4.
D’autres modifications du site catalytique d’une hydrolase peuvent être envisagés et sont inclus dans la présente invention, comme par exemple la suppression totale (sans remplacement) d’un résidu du site catalytique, notamment d’un résidu d’acide glutamique ou d’acide aspartique.
Ces modifications seront réalisées par génie génétique, en modifiant l’acide nucléique codant pour la séquence peptidique de l’enzyme en question.
Avantageusement, la néolectine définie ci-dessus conserve les propriétés d’origine de l’hydrolase dont elle est issue. Par exemple, l’hydrolase issue de JHA 19 Streptomyces sp., un microorganisme thermophile, est originellement thermostable. Avantageusement, la néolectine dérivée de cette hydrolase est particulièrement thermostable, comme cela est présenté dans la partie expérimentale de la demande.
La présente invention concerne également l’utilisation d’une néolectine couplée à au moins une protéine présentant une autre fonction, par exemple à une enzyme ou à une protéine cytotoxique. Une telle construction protéique est désignée « néolectine multifonctionnelle ». Cette néolectine multifonctionnelle comprend au moins deux monomères liés de manière covalente ou non-covalente, dont l’un est la néolectine selon l’invention.
La présente invention concerne également l’utilisation d’une néolectine multimérique constituée d’au moins deux néolectines, dont au moins une néolectine telle que définie ci- dessus.
Chaque monomère est constitué d’une chaîne peptidique comprenant un site reconnaissant de manière spécifique une unité osidique particulière.
Parmi les protéines monomériques, on distingue les dimères (qui sont constitués de deux sous-unités), les trimères (trois sous-unités), les tétramères (quatre sous-unités), etc.
Selon une mise en oeuvre, une néolectine multimérique comprend au moins deux, trois ou quatre monomères, tous constitués d’une néolectine telle que définie ci-dessus, et donc contient au moins deux, trois ou quatre sites actifs identiques.
Selon une autre mise en oeuvre, la néolectine multimérique utilisée comprend un seul monomère constitué d’une néolectine telle que définie ci-dessus, couplé à un ou plusieurs autres monomères consistant en d’autres lectines, ayant chacun un site de reconnaissance ayant une spécificité différente et donc reconnaissant d’autres unités osidiques que le D- galactofuranose.
Par exemple, la néolectine multimérique utilisée comprendra un monomère spécifique d’une entité furanose, et un autre monomère spécifique d’une entité pyranose. En modulant ainsi la spécificité d’une néolectine multimérique, il sera possible de créer des néolectines capables de reconnaître avec une grande spécificité un microorganisme particulier, ayant une signature originale d’entités osidiques exprimées en surface.
Selon une mise en oeuvre particulière, la néolectine utilisée peut être couplée à un marqueur et/ou à une étiquette moléculaire.
Ce couplage pourra être covalent ou non covalent, et sera de préférence un couplage covalent. Ce couplage sera réalisé par génie génétique, en associant les acides nucléiques codant d’une part la néolectine telle que définie, et d’autre part le marqueur ou/et l’étiquette moléculaire.
Le marqueur peut être une biotine (reconnue par la streptavidine), ou un marqueur coloré ou fluorescent, comme par exemple une protéine fluorescente (GFP, RFP, CFP, YFP).
Une étiquette moléculaire pourra notamment être choisie parmi les « tags » bien connus de l’ Homme du métier, ajoutés par modification génétique : étiquettes poly-histidine (5 ou 6 histidines), étiquette FLAG (DYKDDDK), étiquette HA (YPYDVPDYA), glutatione-S-tranférase, Calmodulin Binding Peptide (étiquette de 26 acides aminés), etc.
La néolectine utilisée selon l’invention est couplée soit à un marqueur, soit à une étiquette moléculaire, soit à un marqueur et une étiquette moléculaire.
Néolectine
La présente invention concerne également une néolectine telle que définie ci-dessus.
Selon une mise en oeuvre particulière, la néolectine selon l’invention est couplée à un marqueur et/ou à une étiquette moléculaire.
Ce couplage pourra être covalent ou non covalent, et sera de préférence un couplage covalent. Ce couplage sera réalisé par génie génétique, en associant les acides nucléiques codant d’une part la néolectine selon l’invention, et d’autre part le marqueur ou/et l’étiquette moléculaire.
Le marqueur peut être une biotine (reconnue par la streptavidine), ou un marqueur coloré ou fluorescent, comme par exemple une protéine fluorescente (GFP, RFP, CFP, YFP).
Une étiquette moléculaire pourra notamment être choisie parmi les « tags » bien connus de l’ Homme du métier, ajoutés par modification génétique : étiquettes poly-histidine (5 ou 6 histidines), étiquette FLAG (DYKDDDK), étiquette HA (YPYDVPDYA), glutatione-S-tranférase, Calmodulin Binding Peptide (étiquette de 26 acides aminés), etc.
La néolectine selon l’invention est couplée soit à un marqueur, soit à une étiquette moléculaire, soit à un marqueur et une étiquette moléculaire.
Procédé de détection de microorçanismes
La présente invention concerne également un procédé pour détecter la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, comprenant les étapes suivantes : mise en contact de l’échantillon et d’au moins une néolectine couplée à un marqueur et/ou à une étiquette moléculaire, détection du marqueur et/ou de l’étiquette moléculaire, caractérisé en ce que lorsque ledit marqueur et/ou étiquette moléculaire est détectée, alors la présence d’au moins un microorganisme présentant à sa surface au moins une unité osidique de type hexofuranoside est établie.
Autrement dit, la présente invention concerne un procédé de détection de la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, comprenant une étape de mise en contact de la néolectine telle que décrite ci-dessus avec l’échantillon, et une étape de détection des interactions de cette néolectine avec des unités osidiques présentes dans l’échantillon.
L’étape de mise en contact pourra par exemple être réalisée dans les puits d’une plaque adaptée pour de tels tests. De manière avantageuse, la néolectine utilisée est immobilisée sur la plaque et chaque échantillon testé est placé dans différents puits de la plaque.
Les conditions de cette étape de mise en contact seront aisément déterminées par l’ Homme du métier, notamment en ce qui concerne la durée d’incubation, l’agitation et la température. On pourra notamment utiliser les conditions présentées dans l’exemple 4 (incubation 2 h à 37 °C sous agitation douce).
Par « microorganisme », on entend au sens de l’invention tout être vivant microscopique, c’est à dire invisible à l’oeil nu. Ce terme désigne notamment les bactéries, les virus, les parasites et les champignons microscopiques.
Plus particulièrement, la présente invention concerne l’utilisation d’une néolectine telle que décrite ci-dessus, ou du procédé selon l’invention, pour détecter la présence de microorganisme(s) choisis parmi des bactéries et des parasites microscopiques et/ou unicellulaires.
Les unités osidiques détectées à la surface desdits microorganismes sont en général intégrées à des glycoconjugués (glycoprotéines, glycolipides, protéo- et glycosaminoglycannes) ou oligo-/polysaccharides, présents à la surface de certains microorganismes présents dans l’échantillon.
Dans le cadre de cette utilisation, la néolectine est couplée à un marqueur et/ou à une étiquette moléculaire.
En particulier, cette utilisation et ce procédé sont particulièrement adaptés pour détecter les microorganismes appartenant à l’une des espèces suivantes : Leishmania, Mycobacterium, Trypanosoma cruzi, Aspergillus, Reni bacterium salmoninarum, Actinobacillus, Pleuropneumoniae, Yersinia pestis, Lachnoanaerobaculum saburreum et Cryphonectria parasitica.
Cette utilisation et ce procédé pourront être réalisés sur tout type d’échantillons, notamment d’échantillons biologiques.
Selon une mise en oeuvre particulière de l’invention, l’échantillon analysé sera choisi parmi la liste suivante :
un fluide biologique (sang, lymphe, larmes, sécrétions respiratoires, urine, liquide céphalo-rachidien) ou un échantillon de tissu issu d’un organisme vivant, humain ou animal (obtenu par biopsie), un échantillon prélevé dans des produits de consommation tels que produits alimentaires ou d’hygiène, un échantillon prélevé dans des produits techniques tels que réactifs de laboratoire et réactifs industriels, un échantillon prélevé dans des eaux stagnantes (marais, étangs) ou des eaux circulantes, par exemple eaux de rivière, eaux marines, et eaux circulant dans des canalisations, et un échantillon prélevé sur tout type de surface (sol, plans de travail, parois de réacteurs).
Selon une mise en oeuvre particulière, l’échantillon analysé est issu d’un organisme humain, et l’utilisation de la néolectine ou le procédé permettent de détecter la présence de microorganismes pathogènes dans cet échantillon. La néolectine est ainsi utilisée dans une méthode de diagnostic d’infections microbiennes.
Kit de détection
Selon un autre aspect, la présente invention concerne un kit de détection pour identifier la présence de microorganismes présentant à leur surface au moins une unité osidique de type hexofuranoside, comprenant les éléments suivants : au moins une néolectine selon l’invention, de préférence une néolectine couplée à un marqueur et/ou à une étiquette moléculaire, ou un acide nucléique codant pour ladite néolectine ; des réactifs adaptés pour la détection de ladite néolectine.
Ce kit pourra également comprendre une notice explicative, et/ou du matériel, adapté(e) pour réaliser le procédé de détection de microorganismes décrit ci-dessus.
De préférence, la néolectine sera couplée à un marqueur coloré ou fluorescent, et le kit comprendra les réactifs adaptés pour la détection de ce marqueur coloré ou fluorescent.
Selon une mise en oeuvre particulière, le kit comprend un vecteur d’expression, constitué d’acide nucléique, codant pour une néolectine selon l’invention ; ce vecteur d’expression sera introduit dans des cellules hôtes, notamment des cellules bactériennes, pour permettre l’expression de la néolectine. Avantageusement, le kit comprend alors des réactifs permettant l’introduction du vecteur d’expression dans des cellules hôtes.
EXEMPLES
Exemple 1. Génération d’une néolectine à partir d’une hydrolase
Une enzyme présentant une excellente activité enzymatique a été modifiée pour supprimer son activité hydrolytique et ne conserver que ses propriétés de reconnaissance pour en faire une lectine synthétique spécifique du D-galactofuranose appellée néolectine.
Les néolectines suivantes ont été caractérisées :
E464S soit le remplacement de l’acide glutamique en position 464 avec une sérine ;
E464C soit le remplacement de l’acide glutamique en position 464 avec une cystéine ;
E464Q soit le remplacement de l’acide glutamique en position 464 avec une glutamine.
Les caractéristiques cinétiques (constante de Michaelis KM et constante catalytique kcat) ont été déterminées et sont présentées en Figure 1 et dans le tableau 2 suivant :
La séquence de la galactofuranosidase WT (sauvage) issue de JHÀ 19 Streptomyces sp., d’une longueur de 786 acides aminés, est la suivante (SEQ ID NO.1 ) ; le résidu E464 est souligné :
MRRVPÀGRQRFÀWLRRRÀRWÀTTÀLÀVFÀLAÀGTÀLTÀTGSÀTAÀPRÀWTPKPSPMTTPWTDQVPVDN PLPEYPRPQLTRPDWÀNLNGIWDFÀVTSÀNÀGQPÀTFPEQIRVPFVÀESÀLSGIQRKITQNDKLWYKRTFT
VPSNWNGRRVQLNFGÀSDWRTTVWVNGRQÀGÀVHSGGYDÀFSYDVTDLLTÀGTNTLWSVWDPTETGT QÀVG KQRI RDVÀPH PGGG I LYTÀÀSG IWQTVWLEPTAAÀHVTRLDLVPDPÀNSRLKVTVRGÀG ISG HQÀR VTVSTGGTTVGTÀTGPVGTEFTVPVPNPRLWTPEDPFLYDVRÀDPLSGGTTVDSVGSYTGMRTIÀLÀSVG G HQRPVLNG KFVFQTGTLDQG YWPDG I YTÀPTDAÀLRH DLQKH KDLG FNMVRKH I KVEPQRWFYWÀDR
LGLLVWQDMPNMERTPDAAÀRTQWEÀEYDRIIDQHRSSPSLVLWVNQNEGWGQYDQÀRLÀDKVKÀYDPT
RLVDNMSGVNCCGÀVDGGNGDWDHHVYVGPGTTVPSÀTRAÀVLGEFGGLGFKVÀGHEWYPGGGFSYE DQPDLÀH LN N RFVG Ll DÀI REVRMPRG LSÀSVYTEITDVEN EVNG LLTYDRQWKVDEÀRVRAÀN RÀLI DÀS RGTTÀPLTLPVDQYRSLRVTTPGYTDRFMRHKDGAÀFTEWNÀGSDSLLKNDÀTWRIVPGLÀNGTCYSFES RNYPGQYLRHREYRVYKEAGSGDLYRADATFCPVRGADGGVRLSAYNFPEQYLRHYDAELWLATPGGTH TWDNAALFTQDTTWAVEAPWAP
Dans les exemples de la présente demande, la séquence peptidique utilisée comprend un tag histidine et présente donc la séquence peptidique SEQ ID NO. 5, d’une longueur de 822 acides aminés, présentée ci-dessous, les caractères soulignés étant les résidus du tag histidine ainsi que le résidu E464 :
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSNSMRRVPAGRQRFAWLRRRARWATTALAVFALAA GTALTATGSATAAPRAWTPKPSPMTTPWTDQVPVDNPLPEYPRPQLTRPDWANLNGIWDFAVTSANAGQ PATFPEQIRVPFVAESALSGIQRKITQNDKLWYKRTFTVPSNWNGRRVQLNFGASDWRTTVWVNGRQAGA VHSGGYDAFSYDVTDLLTAGTNTLWSVWDPTETGTQAVGKQRIRDVAPHPGGGILYTAASGIWQTVWLE PTAAAHVTRLDLVPDPANSRLKVTVRGAGISGHQARVTVSTGGTTVGTATGPVGTEFTVPVPNPRLWTPE DPFLYDVRADPLSGGTTVDSVGSYTGMRTIALASVGGHQRPVLNGKFVFQTGTLDQGYWPDGIYTAPTDA ALRH DLQKH KDLG FNMVRKH I KVEPQRWFYWADRLG LLVWQDMPNMERTPDAAARTQWEAEYDRI I DQH RSSPSLVLWVNQNEGWGQYDQARLADKVKAYDPTRLVDNMSGVNCCGAVDGGNGDWDHHVYVGPGT TVPSATRAAVLGEFGGLGFKVAGHEWYPGGGFSYEDQPDLAHLNNRFVGLIDAI REVRMPRG LSASVYTEI TDVENEVNGLLTYDRQWKVDEARVRAANRALIDASRGTTAPLTLPVDQYRSLRVTTPGYTDRFMRHKDG AAFTEWNAGSDSLLKNDATWRIVPGLANGTCYSFESRNYPGQYLRHREYRVYKEAGSGDLYRADATFCPV RGADGGVRLSAYNFPEQYLRHYDAELWLATPGGTHTWDNAALFTQDTTWAVEAPWAP
Les exemples suivants utilisent la néolectine « E464Q » qui présente une constante kcat d’environ 1 % de la valeur kcat de l’hydrolase d’origine.
L’activité hydrolytique de cette néolectine E464Q (SEQ ID No. 4) a été mesurée en fonction du pH et est présentée en bas à droite de la Figure 1 . Le taux de 100% est représentatif de la meilleure activité obtenue.
Exemple 2. Caractéristiques de liaison de cette néolectine à Gai , en comparaison avec celles des lectines DC-SIGN et intelectine-1.
Une sonde fluorescente présentant de multiples entités D-galactofuranose a été utilisée pour ces études, elle est dénommée BSA-Galf.
DC-SIGN n’est pas capable de reconnaître l’entité D-galactofuranose (portée par cette sonde), contrairement à ce qui a été publié (Figure 2À). En effet, DC-SIGN n’est pas capable de déplacer la sonde : il n’y a donc pas d’intensité de fluorescence mesurée.
La seconde lectine ayant été rapportée dans la littérature comme interagissant avec le D- galactofuranose est l’lntelectine-1 (ou Omentine ou Intelectin). Les résultats obtenus sont présentés en Figure 2B, et montrent que l’interaction de la lectine avec la sonde BSÀ-Galf est bien détectée et est spécifique de ce sucre (pas d’interaction avec les sondes BSÀ-Fuc et BSÀ-aGal).
Les résultats présentés en Figure 2C montrent que la néolectine selon l’invention interagit avec la sonde BSÀ-Galf (Figure 2C).
Sur la base de ces résultats, l’IC50 pour la sonde Galf (qui représente la quantité nécessaire d’inhibiteur pour obtenir 50% d’inhibition de la liaison enzyme/substrat, qui est donc une autre constante en lien avec l’affinité) des néolectines testées a été déterminé :
16 nM pour l’intelectine-1 ;
24 nM pour la néolectine testée, soit un IC50 du même ordre de grandeur que celui déterminé dans des conditions similaires pour l’intelectine-1.
Exemple 3. Spécificité de la liaison au D-D-galactofuranose de la néolectine
Des tests d’inhibition ont été réalisés également sur la néolectine avec les oses suivants : PNP-BGalf, PNPBDGalp, PNPaLÀraf, GalfN3, GalfTolyl (inhibiteur Galf), dont les structures chimiques sont présentées en Figure 3À.
Le protocole expérimental pour la réalisation des tests d’inhibition sur la néolectine a été décrit dans l’article (Landemarre et al., 2013). La néolectine est tout d’abord immobilisée au fond d’une plaque 96 puits. Les profils d'interaction de chaque composé ont été déterminés par une méthode indirecte basée sur l'inhibition par le composé de l'interaction entre la néolectine et la néoglycoprotéine NeoGalf spécifique de cette dernière. En bref, un mélange de néoglycoprotéines (concentration fixe) et des composés correspondants (gamme de concentrations) préparés dans du PBS supplémenté avec CaCl2 (1 mM) et MgCl2 (0,5 mM) est déposé dans chaque puits (50 pL chacun) en triple et incubé deux heures à température ambiante. Après lavage avec du tampon PBS, le conjugué streptavidine-DTÀF est ajouté (50 pL) et incubé 30 min. La plaque est ensuite lavée de nouveau avec du PBS. Enfin, 100 pL de PBS ont été ajoutés pour la lecture de la plaque fluorescente réalisée avec un lecteur de fluorescence (Àex = 485 nm, Àem = 530 nm, Fluostar OPTIAAÀ, BMG LÀBTECH, France). L'intensité du signal est inversement corrélée à la capacité du composé à être reconnu par
la lectine et exprimée en pourcentage d'inhibition par comparaison avec le traceur correspondant seul (Néoglycoprotéine).
La Figure 3B montre les résultats obtenus. Aucune inhibition n’a lieu dans le cas des oses suivants : PNPBDGalp, PNPaLAraf, ce qui démontre la spécificité de la néolectine de l’invention pour le D-galactofuranose. La néolectine testée ne reconnaît ni le D- galactopyranose, ni l’arabinose, qui sont les 2 sucres structurellement les plus proches. Seuls sont reconnus le GalfN3 et le Galf-Tolyle.
Exemple 4. Utilisation de la néolectine pour détecter des microorganismes dans un échantillon biologique
Un premier test concluant et encourageant a été réalisé avec Aspergillus niger, en démontrant l’interaction directe entre la néolectine et le microorganisme (Figure 4A) ou bien en inhibant cette interaction par la BSA-Galf (Figure 4B).
La néolectine est tout d’abord immobilisée au fond d’une plaque 96 puits. Une culture bactérienne d’Aspergillus niger est réalisée en suivant les exigences propres à ce type microbien. Après centrifugation, et numération, le culot microbien est repris dans du PBS et marqué à l’aide de carboxyfluorescéine diacétate succinimidylester (CFDA-SE, Sigma- Aldrich, St. Louis, MO, USA) pendant 1 h à 37° C. Puis la suspension bactérienne est centrifugée et lavée à deux reprises à l’aide de tampon PBS. Les bactéries marquées sont ajoutées dans chaque puits de la microplaque immobilisée avec la néolectine et incubées 2 h à 37 °C sous agitation douce. Après lavage avec du PBS, l'intensité de fluorescence est mesurée à l'aide d'un lecteur de microplaques (Àex = 485 nm, Àem = 530 nm, Fluostar OPTIMA, BMG LABTECH, France). En parallèle, une courbe d'étalonnage est réalisée avec la solution de bactéries marquées pour déterminer le nombre de bactéries restées en interaction avec la néolectine.
Exemple 5. Autres caractéristiques des néolectines utilisées selon l’invention
Les neolectines présentent une thermostabilité jusqu’à 60-70 °C, ce qui constitue un avantage pour l’étude de fluides biologiques complexes.
On notera qu’en particulier, les lectines endogènes de type intelectin-1 ne sont pas thermostables.
REFERENCES
US 10,082,506
WO 2018/208977
WO 2015/132699
Peltier, P., Euzen, R., Daniellou, R., Nugier-Chauvin, C., & Ferrières, V. (2008). Recent knowledge and innovations related to hexofuranosides: structure, synthesis and applications. Carbohydrate research, 343(12), 1897-1923.
Arnaud, J., Audfray, A., & Imberty, A. (2013). Binding sugars: from natural lectins to synthetic receptors and engineered neolectins. Chemical Society reviews, 42(11 ), 4798- 4813.
Tsuji, S., Uehori, J., Matsumoto, M., Suzuki, Y., Matsuhisa, A., Toyoshima, K. , & Seya, T. (2001 ). Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall. The Journal of biological chemistry, 276(26), 23456-23463.
Chiodo, F., Marradi, M., Tefsen, B., Snippe, H., van Die, I., & Penadés, S. (2013). High sensitive detection of carbohydrate binding proteins in an ELISA-solid phase assay based on multivalent glyconanoparticles. PloS one, 8(8), e73027.
Wesener, D. A., Wangkanont, K., McBride, R., Song, X., Kraft, M. B., Hodges, H. L, Zarling, L. C., Splain, R. A., Smith, D. F., Cummings, R. D., Paulson, J. C., Forest, K. T., & Kiessling,
L. L. (2015). Recognition of microbial glycans by human intelectin-1 . Nature structural & molecular biology, 22(8), 603-610.
Matsunaga, E., Higuchi, Y., Mori, K., Yairo, N., Oka, T., Shinozuka, S., Tashiro, K., Izumi,
M., Kuhara, S., & Takegawa, K. (2015). Identification and Characterization of a Novel Galactofuranose-Specific B-D-Galactofuranosidase from Streptomyces Species. PloS one, 10(9), e0137230.
Senicar, M., Legentil, L., Ferrières, V., Eliseeva, S. V., Petoud, S., Takegawa, K., Lafite, P., & Daniellou, R. (2019). Galactofuranosidase from JHA 19 Streptomyces sp.: subcloning and biochemical characterization. Carbohydrate research, 480, 35-41.
Ati, J., Lafite, P., a Daniellou, R. (2017). Enzymatic synthesis of glycosides: from natural O- and N-glycosides to rare C- and S-glycosides. Beilstein journal of organic chemistry, 13, 1857-1865.
Landemarre, L., a Duverger, E. (2013). Lectin glycoprofiling of recombinant therapeutic interleukin-7. Methods in molecular biology (Clifton, N.J.), 988, 221 -226.
Claims
1. Utilisation d’une néolectine pour détecter la présence de microorganisme(s) dans un échantillon, le(s)dit(s) microorganisme(s) présentant à leur surface au moins une unité osidique de type hexofuranoside, caractérisée en ce que ladite néolectine est issue d’une hydrolase spécifique d’une unité osidique de type hexofuranoside dont l’activité hydrolytique a été réduite.
2. Utilisation selon la revendication 1 , caractérisée en ce que l’activité hydrolytique de l’hydrolase spécifique a été réduite par une modification du site catalytique de ladite hydrolase.
3. Utilisation selon la revendication 2, caractérisée en ce que au moins un résidu du site catalytique de l’hydrolase spécifique a été remplacé par un autre résidu.
4. Utilisation selon l’une des revendications 1 à 3, caractérisée en ce que l’hydrolase spécifique d’une unité osidique de type hexofuranoside est une hydrolase reconnaissant spécifiquement le D-galactofuranose.
5. Utilisation selon l’une des revendications 1 à 4, caractérisée en ce que la néolectine est issue de la galactofuranosidase de JHA 19 Streptomyces sp., dont l’activité hydrolytique a été réduite.
6. Utilisation selon l’une des revendications 1 à 5, caractérisée en ce que la néolectine utilisée est une néolectine couplée à un marqueur et/ou à une étiquette moléculaire.
7. Utilisation selon l’une des revendications 1 à 6, dans laquelle lesdits microorganismes détectés appartiennent à l’une des espèces suivantes : Leishmania, Mycobacterium, Trypanosoma cruzi, Aspergillus, Renibacterium salmoninarum, Actinobacillus, Pleuropneumoniae, Yersinia pestis, Lachnoanaerobaculum saburreum et Cryphonectria parasitica.
8. Utilisation selon l’une des revendications 1 à 7, dans laquelle l’échantillon est choisi parmi : un fluide biologique (sang, lymphe, larmes, sécrétions respiratoires, urine, liquide céphalo-rachidien) ou un échantillon de tissu issu d’un organisme vivant, humain ou animal,
- un échantillon prélevé dans des produits de consommation tels que produits alimentaires ou d’hygiène,
- un échantillon prélevé dans des produits techniques tels que réactifs de laboratoire et réactifs industriels,
- un échantillon prélevé dans des eaux stagnantes (marais, étangs) ou des eaux circulantes, par exemple eaux de rivière, eaux marines, et eaux circulant dans des canalisations, et
- un échantillon prélevé sur tout type de surface (sol, plans de travail, parois de réacteurs).
9. Kit de détection pour la mise en oeuvre d’une utilisation selon les revendications 1 à 8, comprenant les éléments suivants : au moins une néolectine telle que définie dans l’une des revendications 1 à 6, de préférence selon la revendication 6, ou un acide nucléique codant pour ladite néolectine; et des réactifs adaptés pour la détection de ladite néolectine.
10. Néolectine telle que définie selon l’une des revendications 1 à 6, couplée à un marqueur et/ou à une étiquette moléculaire.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FRFR2011444 | 2020-11-06 | ||
| FR2011444A FR3116062A1 (fr) | 2020-11-06 | 2020-11-06 | Neolectine specifique et son utilisation pour detecter des microorganismes |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022096829A1 true WO2022096829A1 (fr) | 2022-05-12 |
Family
ID=75850234
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/FR2021/051944 Ceased WO2022096829A1 (fr) | 2020-11-06 | 2021-11-04 | Utilisation d'une neolectine specifique pour detecter des microorganismes |
Country Status (2)
| Country | Link |
|---|---|
| FR (1) | FR3116062A1 (fr) |
| WO (1) | WO2022096829A1 (fr) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015132699A1 (fr) | 2014-03-04 | 2015-09-11 | Centre National De La Recherche Scientifique Cnrs | Nouvelles lectines et applications pour la détection de marqueurs d'états pathologiques |
| US10082506B2 (en) | 2014-11-05 | 2018-09-25 | Wisconsin Alumni Research Foundation | Microbial glycans as a target of human intelectin |
| WO2018208977A1 (fr) | 2017-05-09 | 2018-11-15 | The Johns Hopkins University | Optimisation de diagnostics pour antigènes contenant du galactofuranose |
-
2020
- 2020-11-06 FR FR2011444A patent/FR3116062A1/fr not_active Withdrawn
-
2021
- 2021-11-04 WO PCT/FR2021/051944 patent/WO2022096829A1/fr not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2015132699A1 (fr) | 2014-03-04 | 2015-09-11 | Centre National De La Recherche Scientifique Cnrs | Nouvelles lectines et applications pour la détection de marqueurs d'états pathologiques |
| US10082506B2 (en) | 2014-11-05 | 2018-09-25 | Wisconsin Alumni Research Foundation | Microbial glycans as a target of human intelectin |
| WO2018208977A1 (fr) | 2017-05-09 | 2018-11-15 | The Johns Hopkins University | Optimisation de diagnostics pour antigènes contenant du galactofuranose |
Non-Patent Citations (15)
| Title |
|---|
| "Carbohydrates in chemistry and biology - Pt. 2: Biology of saccharides - Vol. 4: Lectins and saccharide biology", 27 July 2000 (2000-07-27), Weinheim, pages 909 - 921, XP055850039, ISBN: 978-3-527-29511-1, Retrieved from the Internet <URL:http://dx.doi.org/10.1002/9783527618255.ch94> DOI: 10.1002/9783527618255.ch94 * |
| ARNAUD JULIE ET AL: "Binding sugars: from natural lectins to synthetic receptors and engineered neolectins", CHEMICAL SOCIETY REVIEWS, vol. 42, no. 11, 1 January 2013 (2013-01-01), UK, pages 4798, XP055850362, ISSN: 0306-0012, DOI: 10.1039/c2cs35435g * |
| ARNAUD, J.AUDFRAY, A.IMBERTY, A.: "Binding sugars: from natural lectins to synthetic receptors and engineered neolectins", CHEMICAL SOCIETY, vol. 42, no. 11, 2013, pages 4798 - 4813, XP055850362, DOI: 10.1039/c2cs35435g |
| CHIODO, F.MARRADI, M.TEFSEN, B.SNIPPE, H.VAN DIE, I.PENADÉS, S.: "High sensitive détection of carbohydrate binding proteins in an ELISA-solid phase assay based on multivalent glyconanoparticles", PLOS ONE, vol. 8, no. 8, 2013, pages e73027, XP055840779, DOI: 10.1371/journal.pone.0073027 |
| DANIELLOU, R.: "Enzymatic synthesis of glycosides: from natural 0-and N-glycosides to rare C- and S-glycosides", BEILSTEIN JOURNAL OF ORGANIC CHEMISTRY, vol. 13, 2017, pages 1857 - 1865 |
| LANDEMARRE, L.DUVERGER, E.: "Lectin glycoprofiling of recombinant therapeutic interleukin-7", METHODS IN MOLECULAR BIOLOGY (CLIFTON, N.J.), vol. 988, 2013, pages 221 - 226 |
| MATSUNAGA, E.HIGUCHI, Y.MORI, K.YAIRO, N.OKA, T.SHINOZUKA, S.TASHIRO, K.IZUMI, M.KUHARA, S.TAKEGAWA, K.: "Identification and Characterization of a Novel Galactofuranose-Specific B-D-Galactofuranosidase from Streptomyces Species", PLOS ONE, vol. 10, no. 9, 2015, pages e0137230, XP055849912, DOI: 10.1371/journal.pone.0137230 |
| PELTIER ET AL., MYCOBACTERIUM, TRYPANOSOMA, LEISHMANIA ET ASPERGILLUS, 2008 |
| PELTIER, P.EUZEN, R.DANIELLOU, R.NUGIER-CHAUVIN, C.FERRIÈRES, V.: "Recent knowledge and innovations related to hexofuranosides: structure, synthesis and applications", CARBOHYDRATE RESEARCH, vol. 343, no. 12, 2008, pages 1897 - 1923, XP022757829, DOI: 10.1016/j.carres.2008.02.010 |
| SENICAR MATEJA ET AL: "Galactofuranose-Related Enzymes: Challenges and Hopes", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 21, no. 10, 14 May 2020 (2020-05-14), Basel, CH, pages 3465, XP055850074, ISSN: 1661-6596, DOI: 10.3390/ijms21103465 * |
| SENICAR MATEJA ET AL: "Galactofuranosidase from JHA 19Streptomyces sp.: subcloning and biochemical characterization", CARBOHYDRATE RESEARCH, vol. 480, 2019, pages 35 - 41, XP085709841, ISSN: 0008-6215, DOI: 10.1016/J.CARRES.2019.05.011 * |
| SENICAR MATEJA: "Mise au point de NéoLectines spécifiques des furanosides : bioingénierie, diagnostic et imagerie", 13 December 2019 (2019-12-13), XP055850400, Retrieved from the Internet <URL:https://www.researchgate.net/publication/349066231_Mise_au_point_de_NeoLectines_specifiques_des_furanosides_bioingenierie_diagnostic_et_imagerie> [retrieved on 20211012] * |
| SENICAR, M., LEGENTIL, L., FERRIÈRES, V., ELISEEVA, S. V., PETOUD, S., TAKEGAWA, K., LAFITE, P,DANIELLOU, R.: "Galactofuranosidase from JHA 19 Streptomyces sp.: subcloning and biochemical characterization", CARBOHYDRATE RESEARCH, vol. 480, 2019, pages 35 - 41, XP085709841, DOI: 10.1016/j.carres.2019.05.011 |
| TSUJI, S.UEHORI, J.MATSUMOTO, M.SUZUKI, Y.MATSUHISA, A.TOYOSHIMA, K.SEYA, T.: "Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 276, no. 26, 2001, pages 23456 - 23463 |
| WESENER, D. A.WANGKANONT, K.MCBRIDE, R.SONG, X.KRAFT, M. B.HODGES, H. L.ZARLING, L. C.SPLAIN, R. A.SMITH, D. F.CUMMINGS, R. D.: "Récognition of microbial glycans by human intelectin-1", NATURE STRUCTURAL, vol. 22, no. 8, 2015, pages 603 - 610 |
Also Published As
| Publication number | Publication date |
|---|---|
| FR3116062A1 (fr) | 2022-05-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Nedashkovskaya et al. | Flavobacterium ahnfeltiae sp. nov., a new marine polysaccharide-degrading bacterium isolated from a Pacific red alga | |
| Domozych et al. | The extracellular polymeric substance of the green alga Penium margaritaceum and its role in biofilm formation | |
| FR2897069A1 (fr) | Construction de nouveaux variants de l'enzyme dextrane-saccharase dsr-s par ingienerie moleculaire. | |
| Infante et al. | Inhibition of Nitzschia ovalis biofilm settlement by a bacterial bioactive compound through alteration of EPS and epiphytic bacteria | |
| Al-Jwaid et al. | One-step formation of three-dimensional macroporous bacterial sponges as a novel approach for the preparation of bioreactors for bioremediation and green treatment of water | |
| FR2973032A1 (fr) | Peptides aptes a former un complexe covalent et leurs utilisations | |
| FR2915208A1 (fr) | Composition comprenant l'association d'edta et de pei pour augmenter la permeabilite des parois des microorganismes et utilisations de ladite composition | |
| EP3303689A1 (fr) | Procédé pour la fabrication de nanocelluloses à partir d'un substrat cellulosique | |
| Gopinath et al. | Disrupting Mycobacterium smegmatis biofilm using enzyme-immobilized rifampicin loaded silk fibroin nanoparticles for dual anti-bacterial and anti-biofilm action | |
| WO2022096829A1 (fr) | Utilisation d'une neolectine specifique pour detecter des microorganismes | |
| JP5314955B2 (ja) | 新規微生物、イヌリナーゼ、イヌリン分解剤、イヌロオリゴ糖の製造方法及びイヌリナーゼの製造方法 | |
| EP3512942B1 (fr) | Nouvelle ulvane lyase et son utilisation pour cliver des polysaccharides | |
| EP2582810B1 (fr) | Ulvane lyase, procede de fabrication et utilisations | |
| EP1171574B1 (fr) | Procede d'obtention de cultures d'aspergillus niger et leurs utilisations pour la production d'acide ferulique et d'acide vanillique | |
| Leiva-Sabadini et al. | Biofilm formation on collagen substrates modulates Streptococcus mutans bacterial extracellular nanovesicle production and cargo | |
| CA2367989C (fr) | Diagnostic de la maladie de whipple | |
| EP2376621A1 (fr) | Souche bacterienne et melange bacterien a activite fucanolytique | |
| FR2843029A1 (fr) | Solution de rincage pour lentilles de contact | |
| Watanabe et al. | Marine bacterium Cobetia sp. strain GM produces fucose-rich extracellular polymeric substance | |
| EP2730651A1 (fr) | Kappa carraghénane sulfatase, procédé de fabrication et utilisation | |
| CA2813572A1 (fr) | Procede de transformation du iota-carraghenane en alpha-carraghenane a l'aide d'une nouvelle classe de 4s-iota-carraghenane sulfatase | |
| EP3601587B1 (fr) | Méthode de détection électrochimique de mycobactéries | |
| FR3152813A1 (fr) | Nouveau procédé de synthèse d’oligosaccharides phosphate ou de polysaccharides phosphate | |
| FR2589881A1 (fr) | Procede bacterien pour la production d'agents de dispersion | |
| Zexer et al. | The Carbohydrate Binding Module of TrCel7A Aids in Navigating the Complexity of Plant Cell Walls |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21815239 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 21815239 Country of ref document: EP Kind code of ref document: A1 |


