WO2022082059A1 - Chimeric receptors and methods of use thereof - Google Patents
Chimeric receptors and methods of use thereof Download PDFInfo
- Publication number
- WO2022082059A1 WO2022082059A1 PCT/US2021/055302 US2021055302W WO2022082059A1 WO 2022082059 A1 WO2022082059 A1 WO 2022082059A1 US 2021055302 W US2021055302 W US 2021055302W WO 2022082059 A1 WO2022082059 A1 WO 2022082059A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cdr
- amino acid
- cell
- seq
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/22—Immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4231—Cytokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4244—Enzymes
- A61K40/4251—Kinases, e.g. Raf or Src
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4256—Tumor associated carbohydrates
- A61K40/4257—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/22—Intracellular domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
- A61K2239/28—Expressing multiple CARs, TCRs or antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
- A61K2239/29—Multispecific CARs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- CAR Chimeric antigen receptor
- AML acute myeloid leukemia
- AML is a cancer of the myeloid line of blood cells and is characterized by the rapid growth of abnormal cells that build up in the bone marrow and blood and interfere with normal blood cells.
- AML can spread to the brain, skin, or gums.
- the standard chemotherapy treatments for AML have not changed substantially over the past 40 years (Pulte et al., 2008), and overall survival remains very poor.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: (a) the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR- H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complement
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR- H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4)
- the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4)
- the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) contained within the VH region amino acid sequence of SEQ ID NO: 1, a heavy chain complementarity determining region 2 (CDR-H2) contained within the VH region amino acid sequence of SEQ ID NO: 1, and a heavy chain complementarity determining region 3 (CDR-H3) contained within the VH region amino acid sequence of SEQ ID NO: 1
- the VL comprises: a light chain complementarity determining region 1 (CDR-L1) are contained within the VL region amino acid sequence of SEQ ID NO: 9, a light chain complementarity determining region 2 (CDR-L2) are contained within the VL region amino acid sequence of SEQ ID NO: 9, and a light chain complementarity determining region 3 (CDR-L3) are contained within the VL region amino acid sequence of SEQ ID NO: 9, and
- the VH region comprises the amino acid sequence of SEQ ID NO: 1. In some aspects, the VL region comprises the amino acid sequence of SEQ ID NO: 9.
- the antigen-binding domain comprises a single chain variable fragment (scFv).
- the VH and VL of the scFv are separated by a peptide linker.
- the antigen-binding domain comprises the structure VH-L-VL or VL- L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- the scFv comprises an amino acid sequence selected from the group consisting of: SEQ ID Nos: 17-22.
- the chimeric protein is a chimeric antigen receptor (CAR), and wherein the heterologous molecule or moiety comprises a polypeptide selected from the group consisting of: a transmembrane domain, one or more intracellular signaling domains, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof.
- CAR chimeric antigen receptor
- the CAR is an inhibitory CAR comprising one or more intracellular inhibitory domains that inhibit an immune response.
- the intracellular inhibitory domain comprises an enzymatic inhibitory domain or an intracellular inhibitory cosignaling domain.
- an engineered nucleic acid encoding the chimeric protein as previously described.
- an expression vector comprising an engineered nucleic acid as previously described.
- Also provided herein is a population of engineered cells expressing an engineered nucleic acid or an expression vector as previously described.
- the isolated cell or population of cells further comprises one or more tumor-targeting chimeric receptors expressed on the cell surface.
- the one or more tumor-targeting chimeric receptors is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
- the cell or population of cells is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an erythrocyte, a platelet cell, a human embryonic stem cell (ESC), an ESC- derived cell, a pluripotent stem cell, a mesenchymal stromal cell (MSC), an induced pluripotent stem cell (iPSC), and an iPS
- composition comprising an effective amount of a cell or population of engineered cells of as previously described and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- Also provided herein is a method of stimulating a cell-mediated immune response to a tumor cell in a subject, the method comprising administering to a subject having a tumor a therapeutically effective dose of any of the cells as previously described or a composition of as previously described.
- Also provided herein is a method of treating a subject having a tumor, the method comprising administering a therapeutically effective dose of any of the cells as previously described or the composition of as previously described.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4).
- VH heavy chain variable
- VL light chain variable
- CDR-H3 heavy chain complementarity determining region 3
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3), and wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- VH heavy chain variable
- VL light chain variable
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises: (a) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR- H3) having the amino acid sequence of RIKD (SEQ ID NO:4), or (b) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR- H2) having the amino amino acid sequence of RIKD (
- the VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NOV.
- the amino acid sequences of the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Kabat numbering scheme.
- the amino acid sequences of the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Chothia numbering scheme.
- the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR- L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 having the amino acid sequence of QVSKLDS
- CDR- L3 having the amino acid sequence of LQGIHLPWT
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VL comprises a light chain complementarity determining region 1 (CDR- Ll), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), and wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NOV.
- VH heavy chain variable
- VL light chain variable
- CDR- Ll light chain complementarity determining region 1
- CDR-L2 light chain complementarity determining region 2
- CDR-L3 light chain complementarity determining region 3
- the amino acid sequences of the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Kabat numbering scheme. In some aspects, the amino acid sequences of the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Chothia numbering scheme.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO:10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 light chain complementarity determining region 1
- CDR-L2 light chain complementarity determining region 2
- QVSKLDS QVSKLDSEQ ID NO: 11
- CDR-L3 light chain complementarity
- the VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3), wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO:1.
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4).
- CDR-H1 having the amino acid sequence of GFSLSRY
- CDR-H2 having the amino acid sequence of WGNGN
- CDR-H3 having the amino acid sequence of RIKD
- the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHS ALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- CDR-H1 having the amino acid sequence of RYDMH
- CDR-H2 having the amino acid sequence of VIWGNGNTHYHS ALKS
- CDR-H3 having the amino acid sequence of RIKD
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: (a) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NOV), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR- H3) having the amino acid sequence of RIKD (SEQ ID NO:4), or (b) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR- H2) having the amino acid sequence
- the VH region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO:1.
- the VH region comprises the amino acid sequence of SEQ ID NO: 1.
- the VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV. In some aspects, the VL region comprises the amino acid sequence of SEQ ID NOV.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- the VH region comprises the amino acid sequence of SEQ ID NO: 1.
- the VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO:9. In some aspects, the VL region comprises the amino acid sequence of SEQ ID NO:9.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain comprises an antibody or antigen-binding fragment thereof, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV.
- the VL region comprises the amino acid sequence of SEQ ID NOV.
- the VH region comprises the amino acid sequence of SEQ ID NO: 1.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain competes with a reference antibody or antigen-binding fragment thereof for binding to EMCN, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NOV), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NOV), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain binds essentially the same EMCN epitope as a reference antibody or antigenbinding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1)
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigenbinding domain binds an epitope of human EMCN that is the same as the EMCN epitope bound by a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and wherein the VL comprises: a light chain
- the VH region of the reference antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 1. In some aspects, the VL region of the reference antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NOV.
- the antigen-binding domain comprises a F(ab) fragment, a F(ab') fragment, or a single chain variable fragment (scFv).
- the antibody or antigen-binding fragment thereof comprises a single chain variable fragment (scFv).
- the VH and VL of the scFv are separated by a peptide linker.
- the antigen-binding domain comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- the peptide linker comprises an amino acid sequence selected from the group consisting of: SEQ ID Nos:23-39.
- the scFv comprises an amino acid sequence selected from the group consisting of: SEQ ID Nos: 17-22.
- the chimeric protein is an antibody-drug conjugate, and wherein the heterologous molecule or moiety comprises a therapeutic agent.
- the chimeric protein is a chimeric antigen receptor (CAR), and wherein the heterologous molecule or moiety comprises a polypeptide selected from the group consisting of: a transmembrane domain, one or more intracellular signaling domains, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof.
- the CAR comprises a transmembrane domain.
- the CAR comprises one or more intracellular signaling domains.
- the CAR is an activating CAR comprising one or more intracellular signaling domains that stimulate an immune response.
- the CAR is an inhibitory CAR comprising one or more intracellular inhibitory domains that inhibit an immune response.
- the intracellular inhibitory domain comprises an enzymatic inhibitory domain. In some aspects, the intracellular inhibitory domain comprises an intracellular inhibitory co-signaling domain. In some aspects, the CAR comprises a spacer region between the antigen-binding domain and the transmembrane domain. In some aspects, the spacer region has an amino acid sequence selected from the group consisting of SEQ ID NOs:40-48.
- a single chain variable fragment (scFv) specific for endomucin comprising a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- a single chain variable fragment (scFv)specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3)
- the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- the amino acid sequences of the CDR-H1, the CDR-H2, and the CDR-H3 of the reference antibody are defined based on the Kabat numbering scheme. In some aspects, the amino acid sequences of the CDR-H1, the CDR-H2, and the CDR-H3 of the reference antibody are defined based on the Chothia numbering scheme.
- a single chain variable fragment (scFv) specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VH comprises: (a) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), wherein the amino acid sequences of the CDR-H1, the CDR-H2, the CDR-H3, the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Kabat numbering scheme; or (b) a heavy chain complementarity determining region 1 (CDR
- the VL of the scFv comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR- L2), and a light chain complementarity determining region 3 (CDR-L3), wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- the VL of the scFv comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 having the amino acid sequence of QVSKLDS
- CDR-L3 light chain complementarity determining region 3
- a single chain variable fragment (scFv) specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- VH heavy chain variable
- VL light chain variable
- the VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3)
- the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- the amino acid sequences of the CDR-H1, the CDR-H2, the CDR-H3, the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Kabat numbering scheme. In some aspects, the amino acid sequences of the CDR-H1, the CDR-H2, the CDR-H3, the CDR-L1, the CDR-L2, and the CDR-L3 of the reference antibody are defined based on the Chothia numbering scheme.
- a single chain variable fragment (scFv) specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- the VH of the scFv comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR- H2), and a heavy chain complementarity determining region 3 (CDR-H3), wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- the amino acid sequences of the CDR-H1, the CDR-H2, and the CDR-H3 of the reference antibody are defined based on the Kabat numbering scheme.
- the amino acid sequences of the CDR-H1, the CDR-H2, and the CDR-H3 of the reference antibody are defined based on the Chothia numbering scheme.
- the VH of the scFv comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- CDR-H1 having the amino acid sequence of GFSLSRY
- CDR-H2 having the amino acid sequence of WGNGN
- CDR-H3 heavy chain complementarity determining region 3
- the VH of the scFv comprises: or a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- CDR-H1 having the amino acid sequence of RYDMH
- CDR-H2 having the amino acid sequence of VIWGNGNTHYHSALKS
- CDR-H3 heavy chain complementarity determining region 3
- a single chain variable fragment (scFV) specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the VH comprises: (a) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), or (b) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO:
- the VH of the scFv comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- the VH of the scFv comprises the amino acid sequence of SEQ ID NO: 1.
- the VL of the scFv comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- the VL of the scFv comprises the amino acid sequence of SEQ ID NO: 9.
- scFV single chain variable fragment
- EMCN single chain variable fragment
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- VH comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- the VH region of the scFv comprises the amino acid sequence of SEQ ID NO: 1.
- the VL region of the scFv comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- the VL region of the scFv comprises the amino acid sequence of SEQ ID NO: 9.
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain comprises an antibody or antigen-binding fragment thereof, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- VH heavy chain variable
- VL light chain variable
- the VH region of the scFv comprises the amino acid sequence of SEQ ID NO: 1.
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain competes with a reference antibody or antigen-binding fragment thereof for binding to EMCN, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSL
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain binds essentially the same EMCN epitope as a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR- H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain binds an epitope of human EMCN that is the same as the EMCN epitope bound by a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR- H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region
- the VL region of the reference antibody or antigen-binding fragment thereof comprises the amino acid sequence of SEQ ID NO: 9.
- composition comprising any of the chimeric proteins or scFvs provided herein and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- an engineered nucleic acid encoding any of the chimeric proteins or scFvs provided herein.
- an expression vector comprising any of the engineered nucleic acids provided herein.
- composition comprising any of the engineered nucleic acids provided herein or any of the expression vectors provided herein, and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- Also provided for herein is a method of making an engineered cell, comprising transducing an isolated cells with any of the engineered nucleic acids provided herein or any of the expression vectors provided herein.
- an isolated cell comprising any of the engineered nucleic acids provided herein, any of the expression vectors provided herein, or any of the compositions provided herein.
- Also provided for herein is a population of engineered cells expressing any of the engineered nucleic acids provided herein, any of the expression vectors provided herein. [0076] Also provided for herein is an isolated cell or population of cells comprising any of the chimeric proteins or scFvs provided herein.
- a population of engineered cells expressing any of the chimeric proteins provided herein is recombinantly expressed.
- the chimeric protein is expressed from a vector or a selected locus from the genome of the cell.
- the cell or population of cells further comprises one or more tumor-targeting chimeric receptors expressed on the cell surface.
- each of the one or more tumor-targeting chimeric receptors is a chimeric antigen receptors (CAR) or an engineered T cell receptor.
- CAR chimeric antigen receptors
- the cell or population of cells is selected from the group consisting of: a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral- specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumorinfiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an erythrocyte, a platelet cell, a human embryonic stem cell (ESC), an ESC-derived cell, a pluripotent stem cell, a mesenchymal stromal cell (MSC), an induced pluripotent stem cell (iPSC), and an iPSC-derived cell.
- CTL
- composition comprising an effective amount of any of the cells or population of engineered cells provided herein and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- composition comprising an effective amount of genetically modified cells expressing any of the chimeric proteins provided herein and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- the pharmaceutical composition is for treating and/or preventing a tumor.
- Also provided for herein is a method of treating a subject in need thereof, the method comprising administering a therapeutically effective dose of any of the compositions provided herein, or any of the cells provided herein.
- Also provided for herein is a method of stimulating a cell-mediated immune response to a tumor cell in a subject, the method comprising administering to a subject having a tumor a therapeutically effective dose of any of the compositions provided herein, or any of the cells provided herein.
- a method of treating a subject having a tumor the method comprising administering a therapeutically effective dose of any of the compositions provided herein, or any of the cells provided herein.
- the method includes administering a composition comprising an immunocompetent cell or population of cells expressing an inhibitory as described herein, and the cell or population of cells further express one or more tumor-targeting chimeric receptors.
- the method results in reduced off-target effects as compared to a method of admininstering an equivalent composition including a cell or population of cells comprising the one or more tumor-targeting chimeric receptors but lacking the inhibitory CAR.
- kits for treating and/or preventing a tumor comprising any of the chimeric proteins provided herein.
- the kit further comprises written instructions for using the chimeric protein for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- kits for treating and/or preventing a tumor comprising any of the cells or population of cells provided herein.
- the kit further comprises written instructions for using the cell for treating and/or preventing a tumor in a subject.
- kits for treating and/or preventing a tumor comprising any of the isolated nucleic acids provided herein.
- the kit further comprises written instructions for using the nucleic acid for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- kits for treating and/or preventing a tumor comprising any of the vectors provided herein.
- the kit further comprises written instructions for using the vector for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- kits for treating and/or preventing a tumor comprising any of the compositions provided herein.
- the kit further comprises written instructions for using the composition for treating and/or preventing a tumor in a subject.
- FIG. 1 Sequencing results for the light-chain variable regions of Antibody-1 (Abl) using Chothia naming scheme.
- FIG. 2 Sequencing results for the heavy-chain variable regions of Antibody-1 (Abl) using Chothia naming scheme.
- FIG. 3A Gating strategy for establishing EMCN expression baseline.
- FIG. 3B No Virus transduction control cell lines showing baseline EMCN expression.
- FIG. 3C Transduced cell lines showing EMCN expression on Day 3 following transduction.
- FIG. 4A Transduced cell lines showing EMCN expression on Day 24 posttransduction following 21 days of drug selection with Ipg/mL Puromycin.
- FIG. 4B Transduced cell lines showing EMCN expression on Day 24 posttransduction following 21 days of drug selection with 0.5pg/mL Puromycin.
- FIG. 5 Gating strategy for establishing EMCN expression baseline for analysis of cells engineered to express EMCN.
- FIG. 6A Gating strategy for establishing the CAR expression baseline was established using a No Virus transduction control.
- FIG. 6B CAR expression of transduced cells for CAR constructs SB00819, SB01052, SB02405, and SB02406.
- FIG. 6C CAR expression of transduced cells for CAR constructs SB02407, SB02408, SB02409, and SB02410.
- FIG. 7A Percent killing (normalized to a No Virus transduction T cell control) following co-incubation of FLT3 -specific or CD33-specific CAR T cells with parental Molml3 (top panel) or SEM (bottom panel).
- FIG. 7B Percent killing (normalized to a No Virus transduction T cell control) following co-incubation of FLT3-specific or CD33-specific CAR T cells with Molml3 (top panel) or SEM (bottom panel) target cells engineered to express EMCN.
- FIG. 8 shows expression profiles of an anti-FLT3 aCAR and various iCAR formats with an anti-EMCN binding domain, including co-expression, following transduction of NK cells as assessed by flow cytometry. Between 1 and 3 biological replicates per condition (indicated as separate points).
- FIG. 10 shows percent killing of hematopoietic stem and progenitor cells (HSPCs) co-cultured with NK cells expressing various chimeric antigen receptors.
- HSPCs hematopoietic stem and progenitor cells
- the term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value ⁇ 10%, ⁇ 5%, or ⁇ 1%. In certain embodiments, where applicable, the term “about” indicates the designated value(s) ⁇ one standard deviation of that value(s).
- the term "stimulating a cell-mediated immune response " or “stimulating an immune response” refers to generating a signal that results in an immune response by one or more cell types or cell populations. Immunostimulatory activity may include pro-inflammatory activity.
- the immune response occurs after immune cell (e.g., T-cell or NK cell) activation or concomitantly mediated through receptors including, but not limited to, CD28, CD137 (4-1BB), 0X40, CD40 and ICOS, and their corresponding ligands, including B7-1, B7-2, OX-40L, and 4-1BBL.
- Such polypeptides may be present in the tumor microenvironment and can activate immune responses to neoplastic cells.
- promoting, stimulating, or otherwise agonizing pro- inflammatory polypeptides and/or their ligands may enhance the immune response of an immunoresponsive cell.
- receiving multiple stimulatory signals e.g, co-stimulation
- T cell mediated immune response where T cells can become inhibited and unresponsive to antigen (also referred to as “T cell anergy”) in the absence of co-stimulatory signals.
- co-stimulation generally results in increasing gene expression in order to generate long-lived, proliferative, and apoptotic resistant cells, such as T cells or NK cells, that robustly respond to antigen, for example in meditating complete and/or sustained eradication of targets cells expressing a cognate antigen.
- chimeric antigen receptor or alternatively a “CAR” refers to a recombinant polypeptide construct comprising at least an extracellular antigen-binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to herein as "an intracellular signaling domain") comprising a functional signaling domain.
- activating CAR or “aCAR” refers to CAR constructs/architectures capable of inducing signal transduction or changes in protein expression in the activating CAR-expressing cell that initiatiate, activate, stimulate, or increase an immune response upon binding to a cognate aCAR ligand.
- inhibitory CAR or “iCAR” refers to CAR constructs/architectures capable of inducing signal transduction or changes in protein expression in the inhibitory CAR-expressing cell that prevent, attenuate, inhibit, reduce, decrease, inhibit, or suppress an immune response upon binding to a cognate iCAR ligand, such as reduced activation of immunoresponsive cells receiving or having received one or more stimulatory signals, including co-stimulatory signals.
- intracellular signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
- extracellular antigen-binding domain or “antigen-binding domain” (ABD) refers to a polypeptide sequence or polypeptide complex that specifically recognizes or binds to a given antigen or epitope, such as the polypeptide sequence or polypeptide complex portion of the chimeric proteins described herein that provide the EMCN-specific binding.
- An ABD or antibody, antigen-binding fragment, and/or the chimeric protein including the same
- the epitope is said to be the “recognition specificity” or “binding specificity” of the ABD.
- affinity refers to the strength of interaction of non-covalent intermolecular forces between one molecule and another.
- the affinity i.e., the strength of the interaction, can be expressed as a dissociation equilibrium constant (KD), wherein a lower KD value refers to a stronger interaction between molecules.
- KD values of antibody constructs are measured by methods well known in the art including, but not limited to, bio-layer interferometry (e.g. Octet/FORTEBIO®), surface plasmon resonance (SPR) technology (e.g. Biacore®), and cell binding assays (e.g., Flowcytometry).
- Specific binding can refer to a binding molecule with an affinity between an ABD and its cognate antigen or epitope in which the KD value is below 10 6 M. 10 7 M. 10 S M. 10 9 M. or 10 l0 M.
- Specific binding can also include recognition and binding of a biological molecule of interest (e.g., a polypeptide) while not specifically recognizing and binding other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the present disclosure.
- specific binding refers to binding between an ABD, antibody, or antigen-binding fragment to an epitope or antigen or antigenic determinant in such a manner that binding can be displaced or competed with a second preparation of identical or similar epitope, antigen or antigenic determinant.
- An ABD can be an antibody.
- antibody refers to a protein, or polypeptide sequence derived from an immunoglobulin molecule which specifically binds with an antigen.
- Antibodies can be polyclonal or monoclonal, multiple or single chain, or intact immunoglobulins, and may be derived from natural sources or from recombinant sources.
- Antibodies can be tetramers of immunoglobulin molecules.
- An ABD can be an antigen-binding fragment of an antibody.
- antigen-binding fragment refers to at least one portion of an intact antibody, or recombinant variants thereof, that is sufficient to confer recognition and specific binding of the antigenbinding fragment to a target, such as an antigen or epitope.
- antigen-binding fragments include, but are not limited to, Fab, Fab', F(ab')2, Fv, scFv, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, and multispecific antibodies formed from antigen-binding fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, and an isolated CDR or other epitope binding fragments of an antibody.
- An antigen-binding fragment can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23: 1126-1 136, 2005).
- Antigen binding fragments can also be grafted into scaffolds based on polypeptides such as a fibronectin type III (Fn3)(see U.S. Patent No. : 6,703,199, which describes fibronectin polypeptide minibodies).
- a binding molecule having a single ABD is “monovalent”.
- a binding molecule having a plurality of ABDs is said to be “multivalent”.
- a multivalent binding molecule having two ABDs is “bivalent.”
- a multivalent binding molecule having three ABDs is “trivalent.”
- a multivalent binding molecule having four ABDs is “tetraval ent.”
- all of the plurality of ABDs have the same recognition specificity and can be referred to as a “monospecific multivalent” binding molecule.
- binding molecules are multivalent and “multispecific.” In multivalent embodiments in which the ABDs collectively have two recognition specificities, the binding molecule is “bispecific.” In multivalent embodiments in which the ABDs collectively have three recognition specificities, the binding molecule is “trispecific.” In multivalent embodiments in which the ABDs collectively have a plurality of recognition specificities for different epitopes present on the same antigen, the binding molecule is “multiparatopic.” Multivalent embodiments in which the ABDs collectively recognize two epitopes on the same antigen are “biparatopic.”
- multivalency of the binding molecule improves the avidity of the binding molecule for a specific target.
- “avidity” refers to the overall strength of interaction between two or more molecules, e.g. a multivalent binding molecule for a specific target, wherein the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs. Avidity can be measured by the same methods as those used to determine affinity, as described above.
- the avidity of a binding molecule for a specific target is such that the interaction is a specific binding interaction, wherein the avidity between two molecules has a KD value below 10 6 M. 10 7 M. 10 S M. 10 9 M. or 10 l0 M.
- the avidity of a binding molecule for a specific target has a KD value such that the interaction is a specific binding interaction, wherein the one or more affinities of individual ABDs do not have has a KD value that qualifies as specifically binding their respective antigens or epitopes on their own.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs for separate antigens on a shared specific target or complex, such as separate antigens found on an individual cell.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs for separate epitopes on a shared individual antigen.
- single-chain variable fragment refers to a fusion protein comprising at least one antigen-binding fragment comprising a variable region of a light chain and at least one antigen-binding fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
- an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
- variable region refers to a variable sequence that arises from a recombination event, for example, following V, J, and/or D segment recombination in an immunoglobulin gene in a B cell or T cell receptor (TCR) gene in a T cell.
- variable regions are typically defined from the antibody chain from which they are derived, e.g., VH refers to the variable region of an antibody heavy chain and VL refers to the variable region of an antibody light chain.
- a select VH and select VL can associate together to form an antigen-binding domain that confers antigen specificity and binding affinity.
- CDR complementarity determining region
- the CDR amino acid residues in the heavy chain variable domain (VH) are numbered 31-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the light chain variable domain (VL) are numbered 24-34 (LCDR1 ), 50-56 (LCDR2), and 89-97 (LCDR3).
- the CDR amino acids in the VH are numbered 26-32 (HCDR1), 52-56 (HCDR2), and 95-102 (HCDR3); and the CDR amino acid residues in the VL are numbered 26-32 (LCDR1), 50-52 (LCDR2), and 91-96 (LCDR3).
- the CDRs correspond to the amino acid residues that are part of a Kabat CDR, a Chothia CDR, or both.
- the CDRs correspond to amino acid residues 26-35 (HCDR1), 50-65 (HCDR2), and 95-102 (HCDR3) in a VH, e.g., a mammalian VH, e.g., a human VH; and ammo acid residues 24-34 (LCDR1), 50-56 (LCDR2), and 89-97 (LCDR3) in a VL, e.g., a mammalian VL, e.g., a human VL.
- the CDRs are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CDRs are human sequences.
- the CDRs are naturally occurring sequences.
- FR framework region
- the FRs are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the FRs are human sequences.
- the FRs are naturally occurring sequences.
- the FRs are synthesized sequences including, but not limited, rationally designed sequences.
- antibody heavy chain refers to the larger of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations, and which normally determines the class to which the antibody belongs.
- antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations.
- Kappa (K) and lambda (/.) light chains refer to the two major antibody light chain isotypes.
- the term "recombinant antibody” refers to an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
- the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.
- the term "antigen” or “Ag” refers to a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen.
- anti-tumor effect refers to a biological effect which can be manifested by various means, including but not limited to, e.g., a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in the number of metastases, an increase in life expectancy, decrease in tumor cell proliferation, decrease in tumor cell survival, or amelioration of various physiological symptoms associated with the cancerous condition.
- An "anti -tumor effect” can also be manifested by the ability of the peptides, polynucleotides, cells and antibodies of the present disclosure in prevention of the occurrence of tumor in the first place, such as in a prophylactic therapy or treatment.
- autologous refers to any material derived from the same subject to whom it is later to be re-introduced into the subject.
- allogeneic refers to any material derived from a different animal of the same species as the subject to whom the material is introduced. Two or more subjects are said to be allogeneic to one another when the genes at one or more loci are not identical.
- allogeneic material from individuals of the same species may be sufficiently genetically distinct, e.g., at particular genes such as MHC alleles, to interact antigenically.
- allogeneic material from individuals of the same species may be sufficiently genetically similar, e.g, at particular genes such as MHC alleles, to not interact antigenically.
- Isolated nucleic acid molecules of the present disclosure include any nucleic acid molecule that encodes a polypeptide of the present disclosure, or fragment thereof. Such nucleic acid molecules need not be 100% homologous or identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Nucleic acids having "substantial identity” or “substantial homology” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. As used herein, “hybridize” refers to pairing to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- hybridize refers to pairing to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- stringent salt concentration may be less than about 750 mM NaCl and 75 mM trisodium citrate, less than about 500 mM NaCl and 50 mM trisodium citrate, or less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide or at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30°C, at least about 37°C, or at least about 42°C.
- Varying additional parameters such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency may be accomplished by combining these various conditions as needed.
- concentration of detergent e.g., sodium dodecyl sulfate (SDS)
- SDS sodium dodecyl sulfate
- substantially identical or “substantially homologous” is meant a polypeptide or nucleic acid molecule exhibiting at least about 50% homologous or identical to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- sequence is at least about 60%, about80%, about 85%, about 90%, about 95%, about 99%, or about 100% homologous or identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.
- BLAST Altschul et al.
- BESTFIT Altschul et al.
- GAP Garnier et al.
- PILEUP/PRETTYBOX programs Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
- the term "encoding" refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
- nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
- ligand refers to a molecule that binds to a receptor.
- the ligand binds a receptor on another cell, allowing for cell-to-cell recognition and/or interaction.
- an “effective amount” and “therapeutically effective amount” are used interchangeably herein, and refer to an amount of a compound, formulation, material, or composition, as described herein effective to achieve a particular biological result.
- an “effective amount” or a “therapeutically effective amount” is an amount sufficient to arrest, ameliorate, or inhibit the continued proliferation, growth, or metastasis of a disease or disorder of interest, e.g., a myeloid disorder.
- immunoresponsive cell refers to a cell that functions in an immune response (e.g., an immune effector response) or a progenitor, or progeny thereof.
- immune effector cells include, without limitation, alpha/beta T cells, gamma/delta T cells, B cells, natural killer (NK) cells, natural killer T (NKT) cells, mast cells, and myeloid-derived phagocytes.
- immune effector response refers to a function or response, e.g., of an immunoresponsive cell, that enhances or promotes an immune attack of a target cell.
- an immune effector function or response may refer to a property of a T cell or NK cell that promotes killing or the inhibition of growth or proliferation, of a target cell.
- primary stimulation and co-stimulation are examples of immune effector function or response.
- the term "flexible polypeptide linker” or “linker” refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together.
- the flexible polypeptide linkers include, but are not limited to, Gly4Ser or (Gly4Ser)3. In other embodiments, the linkers include multiple repeats of (Gly2Ser), (GlySer) or (GlysSer). In some embodiments, the flexible polypeptide linkers include a Whitlow linker (e.g., GSTSGSGKPGSGEGSTKG [SEQ ID NO:38]). Also included within the scope of the present disclosure are linkers described, for example, in WO2012/138475.
- the terms “treat”, “treatment” and “treating” refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder (e.g., cancer), or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of the present disclosure).
- a proliferative disorder e.g., cancer
- therapies e.g., one or more therapeutic agents such as a CAR of the present disclosure.
- reduction or amelioration refers to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient.
- the terms “treat”, “treatment”, and “treating” refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both.
- reduction or amelioration include reduction or stabilization of tumor size or cancerous cell count.
- the term "subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals, human).
- Ranges recited herein are understood to be shorthand for all of the values within the range, inclusive of the recited endpoints.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50.
- the present disclosure provides antigen-binding domains (e.g., single-chain variable fragments) that bind to endomucin (EMCN), chimeric proteins including antigen-binding domains that bind to EMCN, and nucleic acids encoding such antigen-binding domains and chimeric proteins.
- EMCN is a sialoglycoprotein that interferes with assembly of focal adhesion complexes and inhibits interaction between cells and extracellular matrix.
- EMCN-specific chimeric proteins bind to human EMCN (e.g., Uniprot Q9ULC0, herein incorporated by reference for all purposes) or an epitope fragment thereof.
- EMCN can be expressed on hematopoietic stem and progenitor cells (HSPCs). EMCN can be expressed on cells generally considered to be healthy, such as healthy HSPCs.
- HSPCs hematopoietic stem and progenitor cells
- EMCN-specific antibodies have been previously described, including CBFYE-0213, V.7.C7.1, L4B1, L5F12, L10B5, L3F12, L6H3, L6H10 (also referred to herein as Abl), L9H8, and L10F12, as described in Samulowitz U. et al., Am. J. Path., 2002 May, 160(5): 1669-1681, herein incorporated by reference for all purposes.
- the present disclosure provides an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A.
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which the VH includes a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4).
- VH heavy chain variable
- VL light chain variable
- CDR-H3 heavy chain complementarity determining region 3
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which the VH includes a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 contained within the VH region amino acid sequence of SEQ ID NO: 1.
- VH heavy chain variable
- VL light chain variable
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which the VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4).
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- WGNGNGN WGNGN
- CDR-H3 heavy chain complementarity determining region 3
- the EMCN-specific antigen-binding domain having the VH sequences above can have a light chain complementarity determining region 1 (CDR- Ll), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- CDR- Ll light chain complementarity determining region 1
- CDR-L2 light chain complementarity determining region 2
- CDR-L3 light chain complementarity determining region 3
- the EMCN-specific antigen-binding domain having the VH sequences above can have a heavy chain complementarity determining region 1 (CDR- Ll) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NOTO), aheavy chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and aheavy chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR- Ll heavy chain complementarity determining region 1
- CDR-L2 having the amino acid sequence of QVSKLDS
- CDR-L3 aheavy chain complementarity determining region 3
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which the VL includes a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 contained within the VL region amino acid sequence of SEQ ID NOV.
- VH heavy chain variable
- VL light chain variable
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which the VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- VH heavy chain variable
- VL light chain variable
- VL light chain variable region in which the VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (
- the EMCN-specific antigen-binding domain having the VL sequences above can have a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequences of CDR- Hl, CDR-H2, and CDR-H3 contained within the VH region amino acid sequence of SEQ ID NO: 1.
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- the EMCN-specific antigen-binding domain having the VL sequences above can have a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR- H3) having the amino acid sequence of RIKD (SEQ ID NO:4).
- CDR-H1 having the amino acid sequence of GFSLSRY
- CDR-H2 having the amino acid sequence of WGNGN
- CDR- H3 heavy chain complementarity determining region 3 having the amino acid sequence of RIKD
- the EMCN-specific antigen-binding domain has a heavy chain variable (VH) region and a light chain variable (VL) region in which; (1) the VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and (2) the VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NOTO), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L)
- the EMCN-specific antigen-binding domain has a VH region including the amino acid sequence of SEQ ID NO: 1. In some embodiments, the EMCN- specific antigen-binding domain has a VH region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- the EMCN-specific antigen-binding domain has a VL region including the amino acid sequence of SEQ ID NOV. In some embodiments, the EMCN- specific antigen-binding domain has a VL region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV.
- the EMCN-specific antigen-binding domain has a (1) VH region including the amino acid sequence of SEQ ID NO: 1, and (2) a VL region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV or a VL region including the amino acid sequence of SEQ ID NOV.
- the EMCN-specific antigen-binding domain has a (1) VH region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1, and (2) a VL region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV or a VL region including the amino acid sequence of SEQ ID NOV.
- the EMCN-specific antigen-binding domain has (1) a VL region including the amino acid sequence of SEQ ID NOV, and (2) a VH region including the amino acid sequence of SEQ ID NO: 1 or a VH region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- the EMCN-specific antigen-binding domain has a VL region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NOV and (2) a VH region including the amino acid sequence of SEQ ID NO: 1 or a VH region including an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO:1.
- the EMCN-specific antigen-binding domain competes with a reference antibody or antigen-binding fragment thereof having a heavy chain variable (VH) region and a light chain variable (VL) region in which; (1) the VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO:2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and (2) the VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and
- the EMCN-specific antigen-binding domain binds the same or essentially the same epitope (e.g, a distinct human EMCN epitope) as a reference antibody or antigen-binding fragment thereof having a heavy chain variable (VH) region and a light chain variable (VL) region in which; (1) the VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO:3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO:4), and (2) the VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NOTO), a light chain complementarity determining region 2
- CDR-H1 having
- the EMCN-specific antigen-binding domain binds the same or essentially the same epitope (e.g, a distinct human EMCN epitope) as a reference antibody or antigen-binding fragment thereof having a VH including the amino acid sequence of SEQ ID NO: 1.
- the EMCN- specific antigen-binding domain binds the same or essentially the same epitope (e.g, a distinct human EMCN epitope) as a reference antibody or antigen-binding fragment thereof having a VL including the amino acid sequence of SEQ ID NO: 9.
- the EMCN-specific antigen-binding domain can be in any of the formats described herein, such as a Fab, Fab', F(ab')2, Fv, scFv, linear antibody, single domain antibody such as sdAb (either VL or VH), camelid VHH, and multi-specific formats.
- the EMCN-specific antigen-binding domain is in a F(ab) format.
- the EMCN-specific antigen-binding domain is in a F(ab') format.
- the EMCN-specific antigen-binding domain is in a single chain variable fragment (scFv) format, including scFv formats having any of the peptide linkers described herein (e.g., see Table 1).
- the EMCN-specific antigen-binding domain has the structure VH-L-VL or VL-L-VH, where L is the peptide linker.
- the present disclosure also provides chimeric proteins, and nucleic acids that encode such chimeric proteins, that include an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A.
- the chimeric proteins may include any of the EMCN-specific antigen-binding domains as previously described.
- CARs are chimeric proteins that include an antigen-binding domain and polypeptide molecules that are heterologous to the antigen-binding domain, such as peptides heterologous to an antibody that an antigen-binding domain may be derived from.
- Polypeptide molecules that are heterologous to the antigen-binding domain can include, but are not limited to, a transmembrane domain, one or more intracellular signaling domains, a hinge domain, a spacer region, one or more peptide linkers, or combinations thereof.
- CARs are engineered receptors that graft or confer a specificity of interest (e.g, EMCN) onto an immune effector cell.
- CARs can be used to graft the specificity of an antibody onto an immunoresponsive cell, such as a T cell.
- CARs of the present disclosure comprise an extracellular antigen-binding domain (e.g., an scFv) fused to a transmembrane domain, fused to one or more intracellular signaling domains.
- the chimeric antigen receptor is an activating chimeric antigen receptor (aCAR and also generally refered to as CAR unless otherwise specified).
- binding of the chimeric antigen receptor to its cognate ligand is sufficient to induce activation of the immunoresponsive cell. In some embodiments, binding of the chimeric antigen receptor to its cognate ligand is sufficient to induce stimulation of the immunoresponsive cell. In some embodiments, activation of an immunoresponsive cell results in killing of target cells. In some embodiments, activation of an immunoresponsive cell results in cytokine or chemokine expression and/or secretion by the immunoresponsive cell. In some embodiments, stimulation of an immunoresponsive cell results in cytokine or chemokine expression and/or secretion by the immunoresponsive cell. In some embodiments, stimulation of an immunoresponsive cell induces differentiation of the immunoresponsive cell. In some embodiments, stimulation of an immunoresponsive cell induces proliferation of the immunoresponsive cell. In some embodiments, activation and/or stimulation of the immunoresponsive cell can be combinations of the above responses.
- a CAR of the present disclosure may be a first, second, or third generation CAR.
- First generation CARs comprise a single intracellular signaling domain, generally derived from a T cell receptor chain.
- First generation CARs generally have the intracellular signaling domain from the CD3-zeta (CD3Q chain, which is the primary transmitter of signals from endogenous TCRs.
- CD3Q chain CD3-zeta
- First generation CARs can provide de novo antigen recognition and cause activation of both CD4 + and CD8 + T cells through their CD3 ⁇ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.
- “Second generation” CARs add a second intracellular signaling domain from one of various co-stimulatory molecules (e.g., CD28, 4-1BB, ICOS, 0X40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.
- "Second generation” CARs provide both co-stimulation (e.g., CD28 or 4- IBB) and activation (CD3Q.
- Preclinical studies have indicated that "Second Generation” CARs can improve the anti -tumor activity of immunoresponsive cell, such as a T cell.
- “Third generation” CARs have multiple intracellular co-stimulation signaling domains (e.g., CD28 and 4-1BB) and an intracellular activation signaling domain (CD3Q.
- the chimeric antigen receptor is a chimeric inhibitory receptor (iCAR).
- the one or more chimeric inhibitory receptors bind antigens that are expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, bone, bone marrow, immune system, endothelial tissue, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
- a chimeric inhibitory receptor e.g. an EMCN-specific chimeric inhibitory receptor
- one or more activating chimeric receptors e.g., activating chimeric TCRs or CARs
- a cell of the present disclosure e.g., an immunoresponsive cell
- an immunoresponsive cell expressing the tumor-associated antigen may bind to the healthy cell.
- a chimeric inhibitory receptor of the present disclosure may inhibit one or more activities of a cell of the present disclosure (e.g., an immunoresponsive cell).
- an immunoresponsive cell may comprise one or more tumor-targeting chimeric receptors and one or more chimeric inhibitory receptors that targets an antigen that is not expressed, or generally considered to be expressed, on the tumor (e.g., EMCN). Combinations of tumor-targeting chimeric receptors and chimeric inhibitory receptors in the same immunoresponsive cell may be used to reduce on-target off-tumor toxicity.
- the extracellular antigen-binding domain of a CAR of the present disclosure binds to one or more antigens (e.g., EMCN) with a dissociation constant (Kd) of about 2 x 10' 7 M or less, about 1 x 10' 7 M or less, about 9 x 10' 8 M or less, about 1 x 10' 8 M or less, about 9 x 10' 9 M or less, about 5 x 10' 9 M or less, about 4 x 10' 9 M or less, about 3 x 10' 9 M or less, about 2 x 10' 9 M or less, or about 1 x 10' 9 M or less.
- the Kd ranges from about is about 2 x 10' 7 M to about 1 x 10' 9 M.
- Binding of the extracellular antigen-binding domain of a CAR of the present disclosure can be determined by, for example, an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA), FACS analysis, a bioassay (e.g., growth inhibition), bio-layer interferometry (e.g. Octet/FORTEBIO®), surface plasmon resonance (SPR) technology (e.g. Biacore®), or a Western Blot assay.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS analysis e.g., FACS analysis
- bioassay e.g., growth inhibition
- bio-layer interferometry e.g. Octet/FORTEBIO®
- SPR surface plasmon resonance
- Biacore® surface plasmon resonance
- the scFv can be radioactively labeled and used in an RIA assay.
- the radioactive isotope can be detected by such means as the use of a y counter or a scintillation counter or by autoradiography.
- the extracellular antigen-binding domain of the CAR is labeled with a fluorescent marker.
- fluorescent markers include green fluorescent protein (GFP), blue fluorescent protein (e.g., EBFP, EBFP2, Azurite, and mKalamal), cyan fluorescent protein (e.g., ECFP, Cerulean, and CyPet), and yellow fluorescent protein (e.g., YFP, Citrine, Venus, and YPet).
- the extracellular antigen-binding domain of the CAR is labeled with a secondary antibody specific for the extracellular antigen-binding domain and wherein the secondary antibody is labeled (e.g., radioactively or with a fluorescent marker).
- CARs of the present disclosure comprise an extracellular antigen-binding domain that binds to EMCN (e.g, a EMCN protein, a EMCN-derived antigen, or an EMCN-derived epitope), a transmembrane domain, and one or more intracellular signaling domains.
- the extracellular antigen-binding domain comprises an scFv.
- the extracellular antigen-binding domain comprises a Fab fragment, which may be crosslinked.
- the extracellular binding domain is a F(ab)2 fragment.
- the extracellular antigen-binding domain of a CAR of the present disclosure specifically binds to EMCN (e.g, an EMCN protein, an EMCN-derived antigen, or an EMCN-derived epitope).
- EMCN e.g, an EMCN protein, an EMCN-derived antigen, or an EMCN-derived epitope.
- the extracellular antigen-binding domain binds to EMCN expressed on a hematopoietic stem cell.
- the extracellular antigen-binding domain binds to EMCN expressed on cells generally considered to be healthy, such as healthy HSPCs.
- EMCN is human EMCN.
- Antigen-binding domains of the present disclosure can include any domain that binds to the antigen including, without limitation, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a bispecific antibody, a conjugated antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a singledomain antibody (sdAb) such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen-binding domain, such as a recombinant fibronectin domain, a T cell receptor (TCR), a recombinant TCR with enhanced affinity, or a fragment thereof, e.g., single chain TCR, and the like.
- sdAb singledomain antibody
- VH heavy chain variable domain
- VL light chain variable domain
- VHH variable domain
- the extracellular antigen-binding domain comprises an antibody.
- the antibody is a human antibody.
- the antibody is a chimeric antibody.
- the extracellular antigen-binding domain comprises an antigen-binding fragment of an antibody.
- the extracellular antigen-binding domain comprises a F(ab) fragment. In certain embodiments, the extracellular antigen-binding domain comprises a F(ab') fragment.
- the extracellular antigen-binding domain comprises an scFv. In some embodiments, the extracellular antigen-binding domain comprises two single chain variable fragments (scFvs). In some embodiments, each of the two scFvs binds to a distinct epitope on the same antigen. In some embodiments, the extracellular antigen-binding domain comprises a first scFv and a second scFv. In some embodiments, the first scFv and the second scFv bind distinct epitopes on the same antigen. In certain embodiments, the scFv is a mammalian scFv. In certain embodiments, the scFv is a chimeric scFv. In certain embodiments, the scFv comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
- VH heavy chain variable domain
- VL light chain variable domain
- the VH and VL are separated by a peptide linker.
- the peptide linker comprises any of the amino acid sequences shown in Table 1.
- the scFv comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- each of the one or more scFvs comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- each scFv can be linked to the next scFv with a peptide linked.
- each of the one or more scFvs is separated by a peptide linker.
- the immune effector cell comprises a first chimeric receptor and a second chimeric receptor.
- the antigen-binding domain of the first chimeric receptor and the antigen-binding domain of the second chimeric receptor can be an appropriate antigen-biding domain described herein or known in the art.
- the first or second antigen-binding domain can be one or more antibodies, antigen-binding fragments of an antibody, F(ab) fragments, F(ab') fragments, single chain variable fragments (scFvs), or single-domain antibodies (sdAbs).
- the antigen-binding domain of the first chimeric receptor and/or the second chimeric receptor comprises two single chain variable fragments (scFvs).
- each of the two scFvs binds to a distinct epitope on the same antigen.
- the antigen-binding domain of the first chimeric receptor can be specific for EMCN and the chimeric receptor can be specific for a second distinct antigen, such as a cancer antigen (e.g., an antigen expressed on a myeloid cell, such as an AML cell).
- the extracellular antigen-binding domain comprises a singledomain antibody (sdAb).
- the sdAb is a humanized sdAb.
- the sdAb is a chimeric sdAb.
- a CAR of the present disclosure may comprise two or more antigen-binding domains, three or more antigen-binding domains, four or more antigenbinding domains, five or more antigen-binding domains, six or more antigen-binding domains, seven or more antigen-binding domains, eight or more antigen-binding domains, nine or more antigen-binding domains, or ten or more antigen-binding domains.
- each of the two or more antigen-binding domains binds the same antigen.
- each of the two or more antigen-binding domains binds a different epitope of the same antigen.
- each of the two or more antigen-binding domains binds a different antigen.
- the CAR comprises two antigen-binding domains.
- the two antigen-binding domains are attached to one another via a flexible linker.
- each of the two-antigen-binding domains may be independently selected from an antibody, an antigen-binding fragment of an antibody, an scFv, a sdAb, a recombinant fibronectin domain, a T cell receptor (TCR), a recombinant TCR with enhanced affinity, and a single chain TCR.
- the CAR comprising two antigen-binding domains is a bispecific CAR or a tandem CAR (tanCAR).
- the bispecific CAR or tanCAR comprises an antigen-binding domain comprising a bispecific antibody or antibody fragment (e.g., scFv).
- a bispecific antibody or antibody fragment e.g., scFv
- the VH can be upstream or downstream of the VL.
- the upstream antibody or antibody fragment (e.g., scFv) is arranged with its VH (VHi) upstream of its VL (VLi) and the downstream antibody or antibody fragment (e.g., scFv) is arranged with its VL (VL2) upstream of its VH (VH2), such that the overall bispecific antibody molecule has the arrangement VH1-VL1-VL2-VH2.
- the upstream antibody or antibody fragment (e.g., scFv) is arranged with its VL (VLi) upstream of its VH (VHi) and the downstream antibody or antibody fragment (e.g., scFv) is arranged with its VH (VH2) upstream of its VL (VL2), such that the overall bispecific antibody molecule has the arrangement VLi VH1-VH2-VL2.
- a linker is disposed between the two antibodies or antibody fragments (e.g., scFvs), for example, between VLi and VL2 if the construct is arranged as VH1-VL1-VL2-VH2, or between VHi and VH2 if the construct is arranged as VL1-VH1-VH2-VL2.
- the linker may be a linker as described herein, e.g., a (Gly4- Ser)n linker, wherein n is 1 , 2, 3, 4, 5, or 6.
- the linker between the two scFvs should be long enough to avoid mispairing between the domains of the two scFvs.
- a linker is disposed between the VL and VH of the first scFv. In some embodiments, a linker is disposed between the VL and VH of the second scFv. In constructs that have multiple linkers, any two or more of the linkers may be the same or different. Accordingly, in some embodiments, a bispecific CAR or tanCAR comprises VLs, VHs, and may further comprise one or more linkers in an arrangement as described herein.
- chimeric receptors comprise a bivalent CAR.
- the bivalent CAR is an EMCN bivalent CAR.
- the bivalent EMCN CAR comprises one or more of the anti-EMCN sequences shown in Table A.
- the ABDs of the bivalent EMCN CAR each comprises the same ABD.
- chimeric receptors comprise a bicistronic chimeric antigen receptor.
- the bicistronic chimeric antigen receptor comprises an EMCN CAR.
- the bicistronic EMCN CAR comprises one or more of the anti-EMCN sequences shown in Table A.
- the transmembrane domain of a CAR of the present disclosure comprises a hydrophobic alpha helix that spans at least a portion of a cell membrane. It has been shown that different transmembrane domains can result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell.
- the transmembrane domain of a CAR of the present disclosure can comprise the transmembrane domain of a CD8 polypeptide, a CD28 polypeptide, a CD3-zeta polypeptide, a CD4 polypeptide, a 4- IBB polypeptide, an 0X40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a LIR-1 (LILRB1) polypeptide, or can be a synthetic peptide, or any combination thereof.
- a CD8 polypeptide a CD28 polypeptide, a CD3-zeta polypeptide, a CD4 polypeptide, a 4- IBB polypeptide, an 0X40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a
- the transmembrane domain is derived from a CD8 polypeptide. Any suitable CD8 polypeptide may be used. Exemplary CD8 polypeptides include, without limitation, NCBI Reference Nos. NP_001139345 and AAA92533.1. In some embodiments, the transmembrane domain is derived from a CD28 polypeptide. Any suitable CD28 polypeptide may be used. Exemplary CD28 polypeptides include, without limitation, NCBI Reference Nos. NP_006130.1 and NP_031668.3. In some embodiments, the transmembrane domain is derived from a CD3-zeta polypeptide. Any suitable CD3-zeta polypeptide may be used.
- Exemplary CD3-zeta polypeptides include, without limitation, NCBI Reference Nos. NP_932170.1 and NP_001106862.1.
- the transmembrane domain is derived from a CD4 polypeptide. Any suitable CD4 polypeptide may be used.
- Exemplary CD4 polypeptides include, without limitation, NCBI Reference Nos. NP_000607.1 and NP_038516.1.
- the transmembrane domain is derived from a 4-1BB polypeptide. Any suitable 4-1BB polypeptide may be used.
- Exemplary 4-1BB polypeptides include, without limitation, NCBI Reference Nos. NP_001552.2 and NP_001070977.1.
- the transmembrane domain is derived from an 0X40 polypeptide. Any suitable 0X40 polypeptide may be used. Exemplary 0X40 polypeptides include, without limitation, NCBI Reference Nos. NP_003318.1 and NP 035789.1. In some embodiments, the transmembrane domain is derived from an ICOS polypeptide. Any suitable ICOS polypeptide may be used. Exemplary ICOS polypeptides include, without limitation, NCBI Reference Nos. NP_036224 and NP_059508. In some embodiments, the transmembrane domain is derived from a CTLA-4 polypeptide. Any suitable CTLA-4 polypeptide may be used.
- Exemplary CTLA-4 polypeptides include, without limitation, NCBI Reference Nos. NP_005205.2 and NP_033973.2.
- the transmembrane domain is derived from a PD-1 polypeptide. Any suitable PD-1 polypeptide may be used. Exemplary PD-1 polypeptides include, without limitation, NCBI Reference Nos. NP_005009 and NP_032824.
- the transmembrane domain is derived from a LAG-3 polypeptide. Any suitable LAG-3 polypeptide may be used. Exemplary LAG-3 polypeptides include, without limitation, NCBI Reference Nos. NP_002277.4 and NP_032505.1.
- the transmembrane domain is derived from a 2B4 polypeptide. Any suitable 2B4 polypeptide may be used. Exemplary 2B4 polypeptides include, without limitation, NCBI Reference Nos.
- the transmembrane domain is derived from a BTLA polypeptide.
- Any suitable BTLA polypeptide may be used.
- Exemplary BTLA polypeptides include, without limitation, NCBI Reference Nos. NP_861445.4 and NP 001032808.2.
- Any suitable LIR-1 (LILRB1) polypeptide may be used.
- Exemplary LIR-1 (LILRB1) polypeptides include, without limitation, NCBI Reference Nos. NP_001075106.2 and NP_001075107.2.
- the transmembrane domain comprises a polypeptide comprising an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the sequence of NCBI Reference No.
- the homology may be determined using standard software such as BLAST or FASTA.
- the polypeptide may comprise one conservative amino acid substitution, up to two conservative amino acid substitutions, or up to three conservative amino acid substitutions.
- the polypeptide can have an amino acid sequence that is a consecutive portion of NCBI Reference No.
- transmembrane domain examples include, without limitation, the transmembrane region(s) of the alpha, beta or zeta chain of the T-cell receptor, CD27, CD3 epsilon, CD45, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, CD2, CD27, LFA-1 (CDlla, CD 18), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 160, CD 19, IL2R beta, IL2R gamma, IL7Ra, ITGA1, VLA1 , CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDlld, ITGAE, CD103, ITG
- the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 82). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 83). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 84).
- the transmembrane domain further comprises at least a portion of an extracellular domain of the same protein.
- a CAR of the present disclosure can also comprise a spacer region that links the extracellular antigenbinding domain to the transmembrane domain.
- the spacer region may be flexible enough to allow the antigen-binding domain to orient in different directions to facilitate antigen recognition.
- the spacer region may be a hinge from a human protein.
- the hinge may be a human Ig (immunoglobulin) hinge, including without limitation an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge.
- the spacer region may comprise an IgG4 hinge, an IgG2 hinge, an IgD hinge, a CD28 hinge, a KIR2DS2 hinge, an LNGFR hinge, or a PDGFR-beta extracellular linker.
- the spacer region is localized between the antigen-binding domain and the transmembrane domain.
- a spacer region may comprise any of the amino acid sequences listed in Table 2, or an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any of the amino acid sequences listed in Table 2.
- nucleic acids encoding any of the spacer regions of the present disclosure may comprise any of the nucleic acid sequences listed in Table 3, or a nucleic acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any of the nucleic acid sequences listed in Table 3.
- the spacer region comprises the sequence shown in SEQ ID NO:40. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:41. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:42. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:43. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:44. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:45. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:46. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:47.
- the spacer region comprises the sequence shown in SEQ ID NO:48. In some embodiments, the spacer region comprises the sequence shown in SEQ ID NO:49. In some embodiments, the spacer region comprises the sequence TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 85). In some embodiments, the spacer region comprises the sequence ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTR GLDFACD (SEQ ID NO: 86). In some embodiments, the spacer region comprises the sequence FVPVFLPAKPTTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 87).
- a CAR of the present disclosure may further include a short oligopeptide or polypeptide linker that is between 2 amino acid residues and 10 amino acid residues in length, and that may form the linkage between the transmembrane domain and the cytoplasmic region of the CAR.
- a suitable linker is a glycineserine doublet.
- the linker comprises the amino acid sequence of GGCKJSGGCKJS (SEQ ID NO: 88).
- a CAR of the present disclosure comprises one or more cytoplasmic domains or regions.
- the cytoplasmic domain or region of the CAR may include an intracellular signaling domain.
- suitable intracellular signaling domains include, without limitation, cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to modulate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
- T cell activation may be mediated by two distinct classes of cytoplasmic signaling sequences, those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic domain, e.g., a co-stimulatory domain).
- T cell signaling and function can be negatively regulated by inhibitory receptors present in a T cell through intracellular inhibitory co-signaling domains.
- the intracellular signaling domain of a CAR of the present disclosure can include an inhibitory intracellular signaling domains.
- inhibitory intracellular domains examples include PD-1, CTLA4, TIGIT, BTLA, and LIR-1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- the inhibitory intracellular signaling domain includes one or more intracellular inhibitory co-signaling domains.
- the one or more intracellular inhibitory co-signaling domains are linked to other domains (e.g, a transmembrane domain) through a peptide linker (e.g, see Table 2) or a spacer or hinge sequence (e.g, see Table 3).
- a peptide linker e.g, see Table 2
- a spacer or hinge sequence e.g, see Table 3
- the two or more intracellular inhibitory co-signaling domains can be linked through a peptide linker (e.g, see Table 2) or a spacer or hinge sequence (e.g, see Table 3).
- the intracellular inhibitory co-signaling domain is an inhibitory domain.
- the one or more intracellular inhibitory co-signaling domains of a chimeric protein comprises one or more ITIM- containing protein, or fragment(s) thereof.
- ITIMs are conserved amino acid sequences found in cytoplasmic tails of many inhibitory immune receptors.
- ITIM-containing proteins include PD-1, TIGIT, BTLA, and LIR-1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, LAIR1, SIRPa, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- the one or more intracellular inhibitory co-signaling domains comprise one or more non-ITIM scaffold proteins, or a fragment(s) thereof.
- the one or more non-ITIM scaffold proteins, or fragments thereof are selected from GRB-2, Dok-1, Dok-2, SLAP, LAG3, HAVR, GITR, and PD-L1.
- the inhibitory intracellular signaling domain can further include an enzymatic inhibitory domain.
- the enzymatic inhibitory domain comprises an enzyme catalytic domain.
- the enzyme catalytic domain is derived from an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c-CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
- an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c-CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
- Examples of enzymatic regulation of signaling is described in more detail in Pavel Otahal et al. (Biochim Biophys Acta. 2011 Feb;1813(2):367-76), Kosugi A., et al.
- the intracellular signaling domain of a CAR of the present disclosure can comprise a primary signaling domain regulates primary activation of the TCR complex either in a stimulatory way or in an inhibitory way.
- Primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs (ITAMs).
- ITAMs immunoreceptor tyrosine-based activation motifs
- ITAM- containing primary intracellular signaling domains examples include, without limitation, those of CD3-zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as "ICOS"), FcsRI, DAP10, DAP12, and CD66d.
- a CAR of the present disclosure comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta polypeptide.
- a CD3-zeta polypeptide of the present disclosure may have an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the sequence of NCBI Reference No. NP_932170 or NP_001106864.2, or fragments thereof.
- the CD3-zeta polypeptide may comprise one conservative amino acid substitution, up to two conservative amino acid substitutions, or up to three conservative amino acid substitutions.
- the polypeptide can have an amino acid sequence that is a consecutive portion of NCBI Reference No.
- NP_932170 or NP_001106864.2 that is at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, or at least 160, at least 170, or at least 180 amino acids in length.
- a primary signaling domain comprises a modified ITAM domain, e.g., a mutated ITAM domain which has altered (e.g., increased or decreased) activity as compared to the native ITAM domain.
- a primary signaling domain comprises a modified ITAM-containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM-containing primary intracellular signaling domain.
- a primary signaling domain comprises one, two, three, four or more ITAM motifs.
- the intracellular signaling domain of a CAR of the present disclosure can comprise the CD3-zeta signaling domain by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a CAR of the present disclosure.
- the intracellular signaling domain of the CAR can comprise a CD3-zeta chain portion and a costimulatory signaling domain.
- the costimulatory signaling domain may refer to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule of the present disclosure is a cell surface molecule other than an antigen receptor or its ligands that may be required for an efficient response of lymphocytes to an antigen.
- Suitable costimulatory molecules include, without limitation, CD97, CD2, ICOS, CD27, CD154, CD8, 0X40, 4-1BB, CD28, ZAP40, CD30, GITR, HVEM, DAP10, DAP12, MyD88, 2B4, CD40, PD-1, lymphocyte function-associated antigen-1 (LFA-1), CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecule (SLAM protein), an activating NK cell receptor, BTLA, a Toll ligand receptor, CDS, ICAM-1, (CDl la/CD18), BAFFR, KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD 19,
- the intracellular signaling sequences within the cytoplasmic portion of a CAR of the present disclosure may be linked to each other in a random or specified order.
- a short oligopeptide or polypeptide linker for example, between 2 amino acids and 10 amino acids (e.g., 2 amino acids, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, 8 amino acids, 9 amino acids, or 10 amino acids) in length may form the linkage between intracellular signaling sequences.
- a glycine-serine doublet can be used as a suitable linker.
- a single ammo acid e.g., an alanine or a glycine, can be used as a suitable linker.
- the intracellular signaling domain comprises two or more costimulatory signaling domains, e.g., two costimulatory signaling domains, three costimulatory signaling domains, four costimulatory signaling domains, five costimulatory signaling domains, six costimulatory signaling domains, seven costimulatory signaling domains, eight costimulatory signaling domains, nine costimulatory signaling domains, 10 costimulatory signaling domains, or more costimulatory signaling domains.
- the intracellular signaling domain comprises two costimulatory signaling domains.
- the two or more costimulatory signaling domains are separated by a linker of the present disclosure (e.g, any of the linkers described in Table 1).
- the linker is a glycine residue. In another embodiment, the linker is an alanine residue.
- a cell of the present disclosure expresses a CAR that includes an antigen-binding domain that binds a EMCN, a transmembrane domain of the present disclosure, a primary signaling domain, and one or more costimulatory signaling domains.
- a cell of the present disclosure expresses an iCAR that includes an antigen-binding domain that binds EMCN (e.g, an EMCN-specific antigenbinding domain having one or more of the amino acid sequences listed in Table A), a transmembrane domain of the present disclosure, and one or more intracellular inhibitory cosignaling domains.
- a cell of the present disclosure expresses (1) a CAR that includes an antigen-binding domain that binds EMCN (e.g, an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A), a transmembrane domain of the present disclosure, a primary signaling domain, and one or more costimulatory signaling domains.
- EMCN e.g, an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A
- a transmembrane domain of the present disclosure e.g, a transmembrane domain of the present disclosure, a primary signaling domain, and one or more costimulatory signaling domains.
- the transmembrane domain is derived from the same protein as one of the one or more intracellular signaling domains.
- the CAR is an inhibitory CAR and includes a transmembrane domain and at least one intracellular inhibitory co-signaling domain each derived from a protein selected from PD-1, CTLA4, TIGIT, BTLA, and LIR-1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRPa, HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- the transmembrane domain is derived from a first protein and the one or more intracellular signaling domain
- a CAR of the present disclosure comprises one or more components of a natural killer cell receptor (NKR), thereby forming an NKR-CAR.
- the NKR component may be a transmembrane domain, a hinge domain, or a cytoplasmic domain from any suitable natural killer cell receptor, including without limitation, a killer cell immunoglobulin-like receptor (KIR), such as KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, DIR2DS5, KIR3DL1/S1, KIR3DL2, KIR3DL3, KIR2DP1, and KIRS DPI; a natural cytotoxicity receptor (NCR), such as NKp30, NKp44, NKp46; a signaling lymphocyte activation molecule (SLAM) family of immune cell receptor, such
- the NKR-CAR may interact with an adaptor molecule or intracellular signaling domain, such as DAP 12.
- an adaptor molecule or intracellular signaling domain such as DAP 12.
- Certain aspects of the present disclosure relate to chimeric receptors and nucleic acids that encode such chimeric receptors that bind to an antigen of interest in addition to EMCN. Certain aspects of the present disclosure relate to chimeric receptors and cells, such as immunoresponsive cells, that have been genetically modified to express one or more of such chimeric receptors that bind to an antigen of interest in addition to EMCN, and to methods of using such receptors and cells to treat and/or prevent myeloid malignancies, such as AML, and other pathologies where an antigen-specific immune response is desired. Malignant cells have developed a series of mechanisms to protect themselves from immune recognition and elimination. The present disclosure provides immunogenicity within the tumor microenvironment for treating such malignant cells.
- a first chimeric receptor includes an antigen-binding domain that binds EMCN (e.g., an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A) and a second chimeric receptor includes an additional antigen-binding domain that binds a second antigen, such as a tumor-associated antigen (e.g., an AML-associated antigen).
- EMCN e.g., an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A
- a second chimeric receptor includes an additional antigen-binding domain that binds a second antigen, such as a tumor-associated antigen (e.g., an AML-associated antigen).
- a cell can express a first chimeric receptor specific for EMCN (e.g., a CAR including an EMCN-specific antigenbinding domain having one or more of the amino acid sequences listed in Table A) and a second chimeric receptor specific for a second antigen, such as a tumor-associated antigen (e.g., an AML-associated antigen).
- EMCN e.g., a CAR including an EMCN-specific antigenbinding domain having one or more of the amino acid sequences listed in Table A
- a second chimeric receptor specific for a second antigen such as a tumor-associated antigen (e.g., an AML-associated antigen).
- a cell can express a first chimeric inhibitory receptor specific for EMCN (e.g., an inhibitory CAR including an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A) and a second chimeric receptor specific for a second antigen, such as a tumor-associated antigen (e.g., an AML-associated antigen).
- EMCN e.g., an inhibitory CAR including an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A
- a second chimeric receptor specific for a second antigen such as a tumor-associated antigen (e.g., an AML-associated antigen).
- a cell e.g., an immunoresponsive cell
- an iCAR that includes an antigen-binding domain that binds EMCN (e.g., an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A) and an aCAR that targets a tumor-associated antigen (e.g., an AML-associated antigen).
- EMCN e.g., an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A
- an aCAR that targets a tumor-associated antigen e.g., an AML-associated antigen
- Suitable antibodies that bind to an antigen in addition to EMCN include any antibody, whether natural or synthetic, full length or a fragment thereof, monoclonal or polyclonal, that binds sufficiently strongly and specifically to a second antigen, such a tumor-associated antigen (e.g., an AML-associated antigen).
- a tumor-associated antigen e.g., an AML-associated antigen
- commercially available antibodies may be used for binding to a second antigen, such a tumor-associated antigen (e.g., an AML-associated antigen).
- the CDRs of the commercially available antibodies are readily accessible by one skilled in the art using conventional sequencing technology. Further, one skilled in the art is able to construct nucleic acids encoding scFvs and chimeric receptors (e.g., CARs and TCRs) based on the CDRs of such commercially available antibodies.
- TCR T cell receptor
- TCRs of the present disclosure are disulfide-linked heterodimeric proteins containing two variable chains expressed as part of a complex with the invariant CD3 chain molecules. TCRs are found on the surface of T cells, and are responsible for recognizing antigens as peptides bound to major histocompatibility complex (MHC) molecules.
- MHC major histocompatibility complex
- a TCR of the present disclosure comprises an alpha chain encoded by TRA and a beta chain encoded by TRB.
- a TCR comprises a gamma chain and a delta chain (encoded by TRG and TRD, respectively).
- Each chain of a TCR is composed of two extracellular domains: a variable (V) region and a constant (C) region.
- the constant region is proximal to the cell membrane, followed by a transmembrane region and a short cytoplasmic tail.
- the variable region binds to the peptide/MHC complex.
- Each of the variable regions has three complementarity determining regions (CDRs).
- CDRs complementarity determining regions
- a TCR can form a receptor complex with three dimeric signaling modules CD38/s, CDSy/s, and CD247 / or CD247 ⁇ /r
- a TCR of the present disclosure is a recombinant TCR.
- the TCR is a non-naturally occurring TCR.
- the TCR differs from a naturally occurring TCR by at least one amino acid residue.
- the TCR differs from a naturally occurring TCR by at least 2 amino acid residues, at least 3 amino acid residues, at least 4 amino acid residues, at least 5 amino acid residues, at least 6 amino acid residues, at least 7 amino acid residues, at least 8 amino acid residues, at least 9 amino acid residues, at least 10 amino acid residues, at least 11 amino acid residues, at least 12 amino acid residues, at least 13 amino acid residues, at least 14 amino acid residues, at least 15 amino acid residues, at least 20 amino acid residues, at least 25 amino acid residues, at least 30 amino acid residues, at least 40 amino acid residues, at least 50 amino acid residues, at least 60 amino acid residues, at least 70 amino acid residues, at least 80 amino acid residues, at least 90 amino acid residues, at least 100 amino acid residues, or more amino acid residues.
- the TCR is modified from a naturally occurring TCR by at least one amino acid residue. In some embodiments, the TCR is modified from a naturally occurring TCR by at least 2 amino acid residues, at least 3 amino acid residues, at least 4 amino acid residues, at least 5 amino acid residues, at least 6 amino acid residues, at least 7 amino acid residues, at least 8 amino acid residues, at least 9 amino acid residues, at least 10 amino acid residues, at least 11 amino acid residues, at least 12 amino acid residues, at least 13 amino acid residues, at least 14 amino acid residues, at least 15 amino acid residues, at least 20 amino acid residues, at least 25 amino acid residues, at least 30 amino acid residues, at least 40 amino acid residues, at least 50 amino acid residues, at least 60 amino acid residues, at least 70 amino acid residues, at least 80 amino acid residues, at least 90 amino acid residues, at least 100 amino acid residues, or more amino acid residues.
- a TCR of the present disclosure comprises one or more antigen-binding domains that may be grafted to one or more constant domain of a TCR chain, for example a TCR alpha chain or TCR beta chain, to create a chimeric TCR that binds specifically to a second antigen of interest, such a tumor-associated antigen (e.g., an AML- associated antigen).
- a tumor-associated antigen e.g., an AML- associated antigen
- an antibody or antibody fragment e.g., scFv
- a TCR chain such as the TCR alpha chain and/or the TCR beta chain.
- the CDRs of an antibody or antibody fragment may be grafted into a TCR alpha chain and/or beta chain to create a chimeric TCR that binds specifically to a second antigen, such a tumor- associated antigen (e.g., an AML-associated antigen).
- Such chimeric TCRs may be produced by methods known in the art (e.g., Willemsen RA et al., Gene Therapy 2000; 7:1369-1377; Zhang T et al., Cancer Gene Ther 2004 11: 487-496; and Aggen et al., Gene Then 2012 Apr; 19(4): 365-74).
- Certain aspects of the present disclosure relate to a cell, such as an immunoresponsive cell, that has been genetically engineered to comprise one or more chimeric receptors of the present disclosure or one or more nucleic acids encoding such chimeric receptors, and to methods of using such cells for treating myeloid malignancies (e.g., AML).
- a cell such as an immunoresponsive cell
- AML myeloid malignancies
- the cell is a mammalian cell.
- the mammalian cell is a primary cell.
- the mammalian cell is a cell line.
- the mammalian cell a bone marrow cell, a blood cell, a skin cell, bone cell, a muscle cell, a neuronal cell, a fat cell, a liver cell, or a heart cell.
- the cell is a stem cell.
- Exemplary stem cells include, without limitation embryonic stem cells (ESCs), induced pluripotent stem cells (iPSCs), adult stem cells, and tissue-specific stem cells, such as hematopoietic stem cells (blood stem cells), mesenchymal stem cells (MSC), neural stem cells, epithelial stem cells, or skin stem cells.
- the cell is a cell that is derived or differentiated from a stem cell of the present disclosure.
- the cell is an immune cell. Immune cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- Exemplary immune cells include, without limitation, T cells (e.g., helper T cells, cytotoxic T cells, memory T cells, regulatory T cells, natural killer T cells, alpha beta T cells, and gamma delta T cells), B cells, natural killer (NK) cells, dendritic cells, myeloid cells, macrophages, and monocytes.
- T cells e.g., helper T cells, cytotoxic T cells, memory T cells, regulatory T cells, natural killer T cells, alpha beta T cells, and gamma delta T cells
- B cells natural killer (NK) cells
- dendritic cells myeloid cells
- macrophages macrophages
- monocytes e.g., monocytes.
- the cell is a neuronal cell.
- Neuronal cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- neuronal cells include, without limitation, neural progenitor cells, neurons (e.g., sensory neurons, motor neurons, cholinergic neurons, GABAergic neurons, glutamatergic neurons, dopaminergic neurons, or serotonergic neurons), astrocytes, oligodendrocytes, and microglia.
- neurons e.g., sensory neurons, motor neurons, cholinergic neurons, GABAergic neurons, glutamatergic neurons, dopaminergic neurons, or serotonergic neurons
- astrocytes e.g., oligodendrocytes
- microglia e.g., glia.
- the cell is an immunoresponsive cell.
- Immunoresponsive cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- Exemplary immunoresponsive cells of the present disclosure include, without limitation, cells of the lymphoid lineage.
- the lymphoid lineage comprising B cells, T cells, and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the like.
- immunoresponsive cells of the lymphoid lineage include, without limitation, T cells, Natural Killer (NK) cells, embryonic stem cells, pluripotent stem cells, and induced pluripotent stem cells (e.g., those from which lymphoid cells may be derived or differentiated).
- T cells can be lymphocytes that mature in the thymus and are chiefly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system.
- T cells of the present disclosure can be any type of T cells, including, without limitation, T helper cells, cytotoxic T cells, memory T cells (including central memory T cells, stem-cell-like memory T cells (or stem-like memory T cells), and two types of effector memory T cells: e.g., TEM cells and TEMRA cells, regulatory T cells (also known as suppressor T cells), natural killer T cells, mucosal associated invariant T cells, and y6 T cells.
- Cytotoxic T cells CTL or killer T cells
- a patient's own T cells may be genetically modified to target specific antigens through the introduction of one or more chimeric receptors, such as a chimeric TCRs or CARs.
- Natural killer (NK) cells can be lymphocytes that are part of cell-mediated immunity and act during the innate immune response. NK cells do not require prior activation in order to perform their cytotoxic effect on target cells.
- an immunoresponsive cell of the present disclosure is a T cell.
- T cells of the present disclosure may be autologous, allogeneic, or derived in vitro from engineered progenitor or stem cells.
- an immunoresponsive cell of the present disclosure is a universal T cell with deficient TCR-a[3. Methods of developing universal T cells are described in the art, for example, in Valton et al., Molecular Therapy (2015); 23 9, 1507- 1518, and Torikai et al., Blood 2012 119:5697-5705.
- an immunoresponsive cell of the present disclosure is an isolated immunoresponsive cell comprising one or more chimeric receptors of the present disclosure.
- the immunoresponsive cell comprises one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more chimeric receptors of the present disclosure.
- an immunoresponsive cell is a T cell. In some embodiments, an immunoresponsive cell is a Natural Killer (NK) cell.
- NK Natural Killer
- an immunoresponsive cell express or is capable of expressing an immune receptor.
- Immune receptors generally are capable of inducing signal transduction or changes in protein expression in the immune receptor-expressing cell that results in the modulation of an immune response upon binding to a cognate ligand (e.g, regulate, activate, initiate, stimulate, increase, prevent, attenuate, inhibit, reduce, decrease, inhibit, or suppress an immune response).
- a cognate ligand e.g, regulate, activate, initiate, stimulate, increase, prevent, attenuate, inhibit, reduce, decrease, inhibit, or suppress an immune response.
- ITAMs immunoreceptor tyrosine-based activation motifs
- an endogenous TCR, exogenous TCR, chimeric TCR, or a CAR specifically an activating CAR
- a formation of an immunological synapse occurs that includes clustering of many molecules near the bound receptor (e.g. CD4 or CD8, CDSy/S/s/ ⁇ , etc.).
- This clustering of membrane bound signaling molecules allows for ITAM motifs contained within the CD3 chains to become phosphorylated that in turn can initiate a T cell activation pathway and ultimately activates transcription factors, such as NF-KB and AP- 1.
- transcription factors are capable of inducing global gene expression of the T cell to increase IL-2 production for proliferation and expression of master regulator T cell proteins in order to initiate a T cell mediated immune response, such as cytokine production and/or T cell mediated killing.
- a cell of the present disclosure comprises two or more chimeric receptors of the present disclosure.
- the cell comprises two or more chimeric receptors, wherein one of the two or more chimeric receptors is a chimeric inhibitory receptor.
- the cell comprises three or more chimeric receptors, wherein at least one of the three or more chimeric receptors is a chimeric inhibitory receptor.
- the cell comprises four or more chimeric receptors, wherein at least one of the four or more chimeric receptors is a chimeric inhibitory receptor.
- the cell comprises five or more chimeric receptors, wherein at least one of the five or more chimeric receptors is a chimeric inhibitory receptor.
- each of the two or more chimeric receptors comprise a different antigen-binding domain, e.g., that binds to the same antigen or to a different antigen.
- each antigen bound by the two or more chimeric receptors are expressed on the same cell, such as a myeloid cell type (e.g., same AML cell type).
- a cell of the present disclosure expresses two or more distinct chimeric receptors
- the antigen-binding domain of each of the different chimeric receptors may be designed such that the antigen-binding domains do not interact with one another.
- a cell of the present disclosure e.g., an immunoresponsive cell
- expressing a first chimeric receptor e.g., an EMCN-specific chimeric receptor
- a second chimeric receptor may comprise a first chimeric receptor that comprises an antigen-binding domain that does not form an association with the antigenbinding domain of the second chimeric receptor.
- the antigen-binding domain of the first chimeric receptor may comprise an antibody fragment, such as an scFv
- the antigen-binding domain of the second chimeric receptor may comprise a VHH.
- the antigen-binding domain of one chimeric receptor comprises an scFv and the antigen-binding domain of the second chimeric receptor comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- binding of the antigen-binding domain of the first chimeric receptor to its cognate antigen is not substantially reduced by the presence of the second chimeric receptor.
- binding of the antigen-binding domain of the first chimeric receptor to its cognate antigen in the presence of the second chimeric receptor is 85%, 90%, 95%, 96%, 97%, 98%, or 99% of binding of the antigen-binding domain of the first chimeric receptor to its cognate antigen in the absence of the second chimeric receptor.
- the antigen-binding domains of the first chimeric receptor and the second chimeric receptor when present on the surface of a cell, associate with one another less than if both were scFv antigen-binding domains. In some embodiments, the antigen-binding domains of the first chimeric receptor and the second chimeric receptor associate with one another 85%, 90%, 95%, 96%, 97%, 98%, or 99% less than if both were scFv antigenbinding domains.
- a cell of the present disclosure comprises one or more chimeric inhibitory receptors of the present disclosure.
- each of the one or more chimeric inhibitory receptors comprises an antigenbinding domain that binds an antigen generally expressed on normal cells (e.g., cells generally considered to be healthy) but not on tumor cells, such as AML cells.
- a chimeric inhibitory receptor includes an antigen-binding domain that binds EMCN (e.g, an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table A).
- the one or more chimeric inhibitory receptors bind antigens that are expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, bone, bone marrow, immune system, endothelial tissue, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
- a chimeric inhibitory receptor e.g. an EMCN-specific chimeric inhibitory receptor
- one or more activating chimeric receptors e.g., activating chimeric TCRs or CARs
- a cell of the present disclosure e.g., an immunoresponsive cell
- a chimeric inhibitory receptor of the present disclosure may inhibit one or more activities of a cell of the present disclosure (e.g., an immunoresponsive cell).
- a cell of the present disclosure comprises one or more chimeric inhibitory receptors of the present disclosure and further comprises a tumor-targeting chimeric receptor that binds to one or more tumor-associated antigens.
- the one or more tumor-associated antigens include an AML-associated antigen.
- the one or more tumor-associated antigens include CD33.
- the one or more tumor-associated antigens include FLT3.
- the one or more tumor-associated antigens include CD33 and FLT3.
- off-target effects refers to killing of off-target cells (i. e. , non-tumor cells that also express the tumor-associated antigen) by an immunocomptent cell expressing a tumor-targeting chimeric receptor.
- the reduced off-target effects is reduced killing of healthy HSPCs.
- the reduced off-target effects are at least 5% less, at least 10% less, at least 15% less, at least 20% less, at least 25% less, at least 30% less, at least 35% less, at least 40% less, at least 45% less, or at least 50% less killing of off-target cells, as compared to an equivalent immunocompetent cell expressing the tumor-targeting antigen but not expressing the chimeric inhibitory receptor as disclosed herein.
- a cell of the present disclosure can further include one or more recombinant or exogenous co-stimulatory ligands.
- the cell can be further transduced with one or more co-stimulatory ligands, such that the cell co-expresses or is induced to co-express one or more chimeric receptors of the present disclosure (e.g., the EMCN-specific CARs described herein) and one or more co- stimulatory ligands.
- TNF tumor necrosis factor
- Ig immunoglobulin
- TNF superfamily members are synthesized as type II transmembrane proteins (extracellular C-terminus) containing a short cytoplasmic segment and a relatively long extracellular region.
- suitable TNF superfamily members include, without limitation, nerve growth factor (NGF), CD40L (CD40L)/CD 154, CD137L/4-1BBL, TNF-a, CD134L/OX40L/CD252, CD27L/CD70, Fas ligand (FasL), CD30L/CD153, tumor necrosis factor beta (TNFP)/lymphotoxin- alpha (LTa), lymphotoxin- beta (LTP), CD257/B cell-activating factor (B AFF)/Bly s/THANK/Tall- 1, glucocorticoid- induced TNF Receptor ligand (GITRL), and TNF -related apoptosis-inducing ligand (TRAIL), LIGHT (TNFSF 14).
- NGF nerve growth factor
- immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. These proteins share structural features with immunoglobulins and possess an immunoglobulin domain (fold).
- suitable immunoglobulin superfamily ligands include, without limitation, CD80 and CD86, both ligands for CD28, PD-L1/(B7-H1) that ligands for PD-1.
- the one or more co-stimulatory ligands are selected from 4-1BBL, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, PD-L1, and combinations thereof.
- a cell of the present disclosure comprises one or more chimeric receptors (e.g., the EMCN-specific CARs described herein) and may further include one or more chemokine receptors.
- chemokine receptor CCR2b or CXCR2 in cells such as T cells
- transgenic expression of chemokine receptor CCR2b or CXCR2 in cells enhances trafficking to CCL2-secreting or CXCL1 -secreting solid tumors (Craddock et al, J Immunother. 2010 Oct; 33(8):780-8 and Kershaw et al. Hum Gene Ther. 2002 Nov 1; 13(16): 1971 -80).
- chemokine receptors expressed on chimeric receptor-expressing cells of the present disclosure may recognize chemokines secreted by tumors and improve targeting of the cell to the tumor, which may facilitate the infiltration of the cell to the tumor and enhance the antitumor efficacy of the cell.
- Chemokine receptors of the present disclosure may include a naturally occurring chemokine receptor, a recombinant chemokine receptor, or a chemokine-binding fragment thereof.
- the chemokine receptor to be expressed on the cell is chosen based on the chemokines secreted by the tumor. Chimeric Receptor Regulation
- Some embodiments of the present disclosure relate to regulating one or more chimeric receptor activities of chimeric receptor-expressing cells of the present disclosure (e.g. the EMCN-specific CARs described herein).
- chimeric receptor activities can be regulated.
- a regulatable chimeric receptor wherein one or more chimeric receptor activities can be controlled, may be desirable to optimize the safety and/or efficacy of the chimeric receptor therapy. For example, inducing apoptosis using a caspase fused to a dimerization domain (see, e.g., Di et al., N Engl. J. Med. 2011 Nov.
- a chimeric receptor-expressing cell of the present disclosure can also express an inducible Caspase-9 (iCaspase-9) that, upon administration of a dimerizer drug, such as rimiducid (IUPAC name: [(!R)-3-(3,4-dimethoxyphenyl)-l-[3-[2-[[2-[3-[(lR)-3-(3,4- dimethoxyphenyl)-l-[(2S)-l-[(2S)-2-(3,4,5-trimethoxyphenyl)butanoyl]piperidine-2- carbonyl] oxypropy 1] phenoxy] acetyl] amino] ethylamino] -2-oxoethoxy] phenyl] propyl] (2S)-1- [(2S)-2-(3,4,5-trimeth
- the iCaspase-9 contains a binding domain that comprises a chemical inducer of dimerization (CID) that mediates dimerization in the presence of the CID, which results in inducible and selective depletion of the chimeric receptor-expressing cells.
- CID chemical inducer of dimerization
- a chimeric receptor of the present disclosure may be regulated by utilizing a small molecule or an antibody that deactivates or otherwise inhibits chimeric receptor activity.
- an antibody may delete the chimeric receptor-expressing cells by inducing antibody dependent cell-mediated cytotoxicity (ADCC).
- a chimeric receptor-expressing cell of the present disclosure may further express an antigen that is recognized by a molecule that is capable of inducing cell death by ADCC or complement-induced cell death.
- a chimeric receptorexpressing cell of the present disclosure may further express a receptor capable of being targeted by an antibody or antibody fragment.
- Suitable receptors include, without limitation, EpCAM, VEGFR, integrins (e.g., av[33, a4, al%[33, a4[37, a5[31 , av[33, av), members of the TNF receptor superfamily (e.g., TRAIL-R1 and TRAIL-R2), PDGF receptor, interferon receptor, folate receptor, GPNMB, ICAM-1 , HLA-DR, CEA, CA-125, MUC1, TAG-72, IL-6 receptor, 5T4, GD2, GD3, CD2, CD3, CD4, CD5, CD11, CDlla/LFA-1, CD15, CD18/ITGB2, CD19, CD20, CD22, CD23/IgE Receptor, CD25, CD28, CD30, CD33, CD38, CD40, CD41 , CD44, CD51, CD52, CD62L, CD74, CD80, CD125, CD147/basigi
- TNF receptor superfamily e.
- a chimeric receptor-expressing cell of the present disclosure may also express a truncated epidermal growth factor receptor (EGFR) that lacks signaling capacity but retains an epitope that is recognized by molecules capable of inducing ADCC (e.g., WO2011/056894).
- EGFR epidermal growth factor receptor
- a chimeric receptor-expressing cell of the present disclosure further includes a highly expressing compact marker/suicide gene that combines target epitopes from both CD32 and CD20 antigens in the chimeric receptor-expressing cell, which binds an anti-CD20 antibody (e.g., rituximab) resulting in selective depletion of the chimeric receptor-expressing cell by ADCC.
- an anti-CD20 antibody e.g., rituximab
- Other methods for depleting chimeric receptor-expressing cells of the present disclosure my include, without limitation, administration of a monoclonal anti-CD52 antibody that selectively binds and targets the chimeric receptor-expressing cell for destruction by inducing ADCC.
- the chimeric receptor-expressing cell can be selectively targeted using a chimeric receptor ligand, such as an anti-idiotypic antibody.
- the anti-idiotypic antibody can cause effector cell activity, such as ADCC or ADC activity.
- the chimeric receptor ligand can be further coupled to an agent that induces cell killing, such as a toxin.
- a chimeric receptor-expressing cell of the present disclosure may further express a target protein recognized by a cell depleting agent of the present disclosure.
- the target protein is CD20 and the cell depleting agent is an anti-CD20 antibody.
- the cell depleting agent is administered once it is desirable to reduce or eliminate the chimeric receptor-expressing cell.
- the cell depleting agent is an anti-CD52 antibody.
- a regulated chimeric receptor comprises a set of polypeptides, in which the components of a chimeric receptor of the present disclosure are partitioned on separate polypeptides or members.
- the set of polypeptides may include a dimerization switch that, when in the presence of a dimerization molecule, can couple the polypeptides to one another to form a functional chimeric receptor.
- nucleic acids e.g., isolated nucleic acids
- the nucleic acid is an RNA construct, such as a messenger RNA (mRNA) transcript or a modified RNA.
- mRNA messenger RNA
- the nucleic acid is a DNA construct.
- a nucleic acid of the present disclosure encodes a chimeric receptor that comprises one or more antigen-binding domain, where each domain binds to a target antigen (e.g., EMCN), a transmembrane domain, and one or more intracellular signaling domains.
- EMCN target antigen
- the nucleic acid encodes a chimeric receptor that comprises an antigen-binding domain, a transmembrane domain, a primary signaling domain (e.g., CD3-zeta domain), and one or more costimulatory signaling domains.
- the nucleic acid further comprises a nucleotide sequence encoding a spacer region.
- the antigen-binding domain is connected to the transmembrane domain by the spacer region.
- the spacer region comprises a nucleic acid sequence selected from any of the nucleic acid sequences listed in Table 3.
- the nucleic acid further comprises a nucleotide sequence encoding a leader sequence.
- nucleic acids of the present disclosure may be obtained using any suitable recombinant methods known in the art, including, without limitation, by screening libraries from cells expressing the gene of interest, by deriving the gene of interest from a vector known to include the gene, or by isolating the gene of interest directly from cells and tissues containing the gene using standard techniques. Alternatively, the gene of interest may be produced synthetically.
- a nucleic acid of the present disclosure in comprised within a vector.
- a nucleic acid of the present disclosure is expressed in a cell via transposons, a CRISPR/Cas9 system, a TALEN, or a zinc finger nuclease.
- expression of a nucleic acid encoding a chimeric receptor of the present disclosure may be achieved by operably linking the nucleic acid to a promoter and incorporating the construct into an expression vector.
- a suitable vector can replicate and integrate in eukaryotic cells.
- Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulating expression of the desired nucleic acid.
- expression constructs of the present disclosure may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols (e.g., US5399346, US5580859, and US5589466).
- a vector of the present disclosure is a gene therapy vector.
- a nucleic acid of the present disclosure can be cloned into a number of types of vectors.
- the nucleic acid can be cloned into a vector including, without limitation, a plasmid, a phagemid, a phage derivative, an animal virus, or a cosmid.
- the vector may be an expression vector, a replication vector, a probe generation vector, or a sequencing vector.
- the plasmid vector comprises a transposon/transposase system to incorporate the nucleic acids of the present disclosure into the host cell genome.
- Methods of expressing proteins in immune cells using a transposon and transposase plasmid system are generally described in Chicaybam L, Hum Gene Ther. 2019 Apr;30(4):511-522. doi: 10.1089/hum.2018.218; and Ptackova P, Cytotherapy. 2018 Apr;20(4):507-520. doi: 10.1016/j .jcyt.2017.10.001, each of which are hereby incorporated by reference in their entirety.
- the transposon system is the Sleeping Beauty transposon/transposase or the piggyBac transposon/transposase.
- an expression vector of the present disclosure may be provided to a cell in the form of a viral vector.
- Suitable viral vector systems are well known in the art.
- viral vectors may be derived from retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
- a vector of the present disclosure is a lentiviral vector. Lentiviral vectors are suitable for long-term gene transfer as such vectors allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors are also advantageous over vectors derived from onco-retroviruses (e.g., murine leukemia viruses) in that lentiviral vectors can transduce non-proliferating cells.
- a vector of the present disclosure is an adenoviral vector (A5/35).
- a vector of the present disclosure contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers (e.g., WOOl/96584; W001/29058; and US6326193).
- selectable markers e.g., WOOl/96584; W001/29058; and US6326193
- a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
- the recombinant virus can then be isolated and delivered to mammalian cells either in vivo or ex vivo.
- a number of retroviral systems are known in the art.
- vectors of the present disclosure include additional promoter elements, such as enhancers that regulate the frequency of transcriptional initiation.
- Enhancers are typically located in a region that is 30 bp to 110 bp upstream of the start site, although a number of promoters have been shown to contain functional elements downstream of the start site as well.
- the spacing between promoter elements may be flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. For example, in the thymidine kinase (tk) promoter the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- individual elements may function either cooperatively or independently to activate transcription.
- Exemplary promoters may include, without limitation, the SFFV gene promoter, the EFS gene promoter, the CMV IE gene promoter, the EFla promoter, the ubiquitin C promoter, and the phosphoglycerokinase (PGK) promoter.
- SFFV gene promoter the EFS gene promoter
- CMV IE gene promoter the CMV IE gene promoter
- EFla promoter the EFla promoter
- the ubiquitin C promoter the ubiquitin C promoter
- PGK phosphoglycerokinase
- a promoter that is capable of expressing a nucleic acid of the present disclosure in a mammalian cell, such as an immunoresponsive cell of the present disclosure is the EFla promoter.
- the native EFla promoter drives expression of the alpha subunit of the elongation factor- 1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome.
- the EFla promoter has been widely used in mammalian expression plasmids and has been shown to be effective in driving chimeric receptor expression from nucleic acids cloned into a lentiviral vector.
- a promoter that is capable of expressing a nucleic acid of the present disclosure in a mammalian cell, such as an immunoresponsive cell of the present disclosure is a constitutive promoter.
- a suitable constitutive promoter is the immediate early cytomegalovirus (CMV) promoter.
- the CMV promoter is a strong constitutive promoter that is capable of driving high levels of expression of any polynucleotide sequence operatively linked to the promoter.
- ubiquitin C (UbiC) promoter a ubiquitin C (UbiC) promoter, a simian virus 40 (SV40) early promoter, a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, a MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, an actin promoter, a myosin promoter, an elongation factor-la promoter, a hemoglobin promoter, and a creatine kinase promoter.
- UbiC ubiquitin C
- SV40 simian virus 40
- MMTV mouse mammary tumor virus
- HV human immunodeficiency virus
- LTR human immunodeficiency virus
- MoMuLV promoter avian leukemia virus promoter
- a promoter that is capable of expressing a nucleic acid of the present disclosure in a mammalian cell, such as an immunoresponsive cell of the present disclosure is an inducible promoter.
- Use of an inducible promoter may provide a molecular switch that is capable of inducing or repressing expression of a nucleic acid of the present disclosure when the promoter is operatively linked to the nucleic acid.
- inducible promoters include, without limitation, a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
- a vector of the present disclosure may further comprise a signal sequence to facilitate secretion, a polyadenylation signal and transcription terminator, an element allowing episomal replication, and/or elements allowing for selection.
- a vector of the present disclosure can further comprise a selectable marker gene and/or reporter gene to facilitate identification and selection of chimeric receptor-expressing cells from a population of cells that have been transduced with the vector.
- the selectable marker may be encoded by a nucleic acid that is separate from the vector and used in a co-transfection procedure. Either selectable marker or reporter gene may be flanked with appropriate regulator sequences to allow expression in host cells. Examples of selectable markers include, without limitation, antibiotic-resistance genes, such as neo and the like.
- reporter genes may be used for identifying transduced cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression results in an easily detectable property, such as enzymatic activity. Expression of the reporter gene can be assayed at a suitable time after the nucleic acid has been introduced into the recipient cells.
- reporter genes include, without limitation, genes encoding for luciferase, genes encoding for beta- galactosidase, genes encoding for chloramphenicol acetyl transferase, genes encoding for secreted alkaline phosphatase, and genes encoding for green fluorescent protein.
- Suitable expression systems are well known in the art and may be prepared using known techniques or obtained commercially.
- a construct with a minimal 5' flanking region showing the highest level of expression of the reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
- a vector comprising a nucleic acid sequence encoding a chimeric receptor of the present disclosure further comprises a second nucleic acid encoding a polypeptide that increases the activity of the chimeric receptor.
- an EMCN-specific protein-expressing cell comprises two or more heterologous proteins (e.g., two or more chimeric receptors)
- a single nucleic acid may encode the two or more proteins under a single regulatory control element (e.g., promoter) or under separate regulatory control elements for each protein-encoding nucleotide sequence comprised in the nucleic acid.
- each heterologous protein may be encoded by a separate nucleic acid.
- each separate nucleic acid comprises its own control element (e.g., promoter).
- a single nucleic acid encodes the two or more chimeric receptors and the chimeric receptor-encoding nucleotide sequences are in the same reading frame and are expressed as a single polypeptide chain.
- the two or more chimeric receptors may be separated by one or more peptide cleavage sites, such as auto-cleavage sites or substrates for an intracellular protease.
- Suitable peptide cleavage sites may include, without limitation, a T2A peptide cleavage site, a P2A peptide cleavage site, an E2A peptide cleavage sire, and an F2A peptide cleavage site.
- the two or more chimeric receptors comprise a T2A peptide cleavage site. In some embodiments, the two or more chimeric receptors comprise an E2A peptide cleavage site. In some embodiments, the two or more chimeric receptors comprise a T2A and an E2A peptide cleavage site.
- an expression vector can be transferred into a host cell by physical, chemical, or biological means.
- physical means for introducing a nucleic acid into a host cell include, without limitation, calcium phosphate precipitation, lipofection, particle bombardment, microinjection, and electroporation.
- chemical means for introducing a nucleic acid into a host cell include, without limitation, colloidal dispersion systems, macromolecule complexes, nanocapsules, microspheres, beads, and lipid- based systems including oil-in- water emulsions, micelles, mixed micelles, and liposomes.
- biological means for introducing a nucleic acid into a host cell include, without limitation, the use of DNA and RNA vectors.
- liposomes may be used as a non-viral delivery system to introduce a nucleic acid or vector of the present disclosure into a host cell in vitro, ex vivo, or in vivo.
- the nucleic acid may be associated with a lipid, for example by being encapsulated in the aqueous interior of a liposome, being interspersed within the lipid bilayer of a liposome, being attached to a liposome via a linking molecule that is associated with both the liposome and the nucleic acid, being entrapped in a liposome, being complexed with a liposome, being dispersed in a solution containing a lipid, being mixed with a lipid, being combined with a lipid, being contained as a suspension in a lipid, being contained or complexed with a micelle, or otherwise being associated with a lipid.
- lipid-associated nucleic acid or vector compositions are not limited to any particular structure in solution.
- such compositions may be present in a bilayer structure, as micelles or with a "collapsed" structure. Such compositions may also be interspersed in a solution, forming aggregates that are not uniform in size or shape.
- lipids are fatty substances that may be naturally occurring or synthetic.
- lipids can include the fatty droplets that naturally occur in the cytoplasm or the class of compounds that contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- Suitable lipids may be obtained from commercial sources and include, without limitation, dimyristyl phosphatidylcholine (“DMPC”), dicetylphosphate (“DCP”), cholesterol, and dimyristylphosphatidylglycerol (“DMPG”).
- DMPC dimyristyl phosphatidylcholine
- DCP dicetylphosphate
- DMPG dimyristylphosphatidylglycerol
- Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about - 20°C. Chloroform is used as the solvent, as it is more readily evaporated than methanol.
- a "liposome” may encompass a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates.
- liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium.
- multilamellar liposomes may have multiple lipid layers separated by aqueous medium. Multilamellar liposomes can form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- lipid components may undergo self-rearrangement before the formation of closed structures and can entrap water and dissolved solutes between the lipid bilayers.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- a nucleic acid or vector of the present disclosure is introduced into a mammalian host cell, such as an immunoresponsive cell of the present disclosure.
- a mammalian host cell such as an immunoresponsive cell of the present disclosure.
- the presence of a nucleic acid or vector of the present disclosure in a host cell may be confirmed by any suitable assay known in the art, including without limitation Southern blot assays, Northern blot assays, RT-PCR, PCR, ELISA assays, and Western blot assays.
- a nucleic acid or vector of the present disclosure is stably transduced into an immunoresponsive cell of the present disclosure.
- cells that exhibit stable expression of the nucleic acid or vector express the encoded chimeric receptor for at least 1 week, at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 5 weeks, at least 6 weeks, at least 7 weeks, at least 8 weeks, at least 3 months, at least 6 months, at least 9 months, or at least 12 months after transduction.
- an EMCN-specific protein (e.g., chimeric receptor) of the present disclosure is transiently expressed in a cell
- an EMCN-specific protein-encoding nucleic acid or vector of the present disclosure is transfected into an immunoresponsive cell of the present disclosure.
- the immunoresponsive cell expresses the EMCN-specific protein for about 4 days, about 5 days, about 6 days, about 7 days, about 8 days, about 9 days, about 10 days, about 11 days, about 12 days, about 13 days, about 14 days, or about 15 days after transfection.
- the nucleic acid construct encodes a bicistronically encoded chimeric antigen receptors.
- the encoded bicistronic chimeric antigen receptors comprise an EMCN CAR (such as an EMCN inhibitory CAR) and a CAR specific for a second antigen (such as a tumor-targeting chimeric receptor).
- the nucleic acid construct encodes a bivalent chimeric antigen receptor.
- the encoded bivalent chimeric antigen receptor comprises an EMCN antigen-binding domain and a second antigen-binding domain.
- compositions comprising one or more EMCN-specific proteins (e.g., chimeric receptors) of the present disclosure or immunoresponsive cells of the present disclosure that express such one or more EMCN-specific proteins.
- compositions comprising EMCN-specific proteins (e.g., chimeric receptors) or genetically modified immunoresponsive cells that express such EMCN-specific proteins can be provided systemically or directly to a subject for the treatment of a proliferative disorder, such as a myeloid disorder.
- the composition is directly injected into an organ of interest (e.g., an organ affected by a disorder).
- the composition may be provided indirectly to the organ of interest, for example, by administration into the circulatory system (e.g., the tumor vasculature).
- Expansion and differentiation agents can be provided prior to, during, or after administration of the composition to increase production of T cells, NK cells, or CTL cells in vitro or in vivo.
- compositions comprising genetically modified cells of the present disclosure may be administered in any physiologically acceptable vehicle, for example intravascularly, although they may also be introduced into bone or other convenient sites where the genetically modified cells may find an appropriate site for regeneration and differentiation (e.g., thymus).
- at least IxlO 5 cells may be administered, eventually reaching IxlO 10 or more cells.
- Compositions comprising genetically modified cells of the present disclosure can comprise a purified population of cells. Methods for determining the percentage of genetically modified cells in a population of cells are well known in the art and include, without limitation, fluorescence activated cell sorting (FACS).
- FACS fluorescence activated cell sorting
- the purity of genetically modified cells in a population of cells may be about 50%, about 55%, about 60%, or about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 97%, about 98%, about 99%, or more of the cells in the population of cells. Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage).
- the cells can be introduced by injection, catheter, or the like.
- factors can also be included, for example, IL-2, IL-3, IL-6, IL-11, IL-7, IL-12, IL-15, IL-21, G-CSF, MCSF, GM-CSF, gamma-interferon, and erythropoietin.
- the compositions are pharmaceutical compositions comprising genetically modified cells, such as immunoresponsive cells or their progenitors and a pharmaceutically acceptable carrier.
- Administration can be autologous or heterologous.
- immunoresponsive cells, or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
- immunoresponsive cells of the present disclosure or their progeny may be derived from peripheral blood cells (e.g., in vivo, ex vivo, or in vitro derived) and may be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration.
- a therapeutic composition of the present disclosure e.g., a pharmaceutical composition containing a genetically modified cell of the present disclosure
- it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
- compositions of the present disclosure relate to formulations of compositions comprising EMCN-specific proteins (e.g., chimeric receptors) of the present disclosure or genetically modified cells (e.g., immunoresponsive cells of the present disclosure) expressing such proteins.
- compositions of the present disclosure comprising genetically modified cells may be provided as sterile liquid preparations, including without limitation isotonic aqueous solutions, suspensions, emulsions, dispersions, and viscous compositions, which may be buffered to a selected pH. Liquid preparations are typically easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions may be more convenient to administer, especially by injection.
- viscous compositions can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
- Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol, etc.) and suitable mixtures thereof.
- sterile injectable solutions can be prepared by incorporating genetically modified cells of the present disclosure in a sufficient amount of the appropriate solvent with various amounts of any other ingredients, as desired.
- Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
- the compositions can also be lyophilized.
- the compositions can contain auxiliary substances such as wetting, dispersing agents, pH buffering agents, and antimicrobials depending upon the route of administration and the preparation desired.
- compositions of the present disclosure may further include various additives that may enhance the stability and sterility of the compositions.
- additives include, without limitation, antimicrobial preservatives, antioxidants, chelating agents, and buffers.
- microbial contamination may be prevented by the inclusions of any of various antibacterial and antifungal agents, including without limitation parabens, chlorobutanol, phenol, sorbic acid, and the like.
- Prolonged absorption of an injectable pharmaceutical formulation of the present disclosure can be brought about by the use of suitable agents that delay absorption, such as aluminum monostearate and gelatin.
- compositions of the present disclosure can be isotonic, i.e., having the same osmotic pressure as blood and lacrimal fluid.
- the desired isotonicity may be achieved using, for example, sodium chloride, dextrose, boric acid, sodium tartrate, propylene glycol, or other inorganic or organic solutes.
- the components of the formulations of the present disclosure are selected to be chemically inert and to not affect the viability or efficacy of the genetically modified cells of the present disclosure.
- the quantity of cells needed to achieve optimal efficacy is the quantity of cells needed to achieve optimal efficacy.
- the quantity of cells to be administered will vary for the subject being treated.
- the quantity of genetically modified cells that are administered to a subject in need thereof may range from 1 x 10 4 cells to 1 x 10 10 cells.
- the precise quantity of cells that would be considered an effective dose may be based on factors individual to each subject, including their size, age, sex, weight, and condition of the particular subject. Dosages can be readily ascertained by those skilled in the art based on the present disclosure and the knowledge in the art.
- the EMCN-specific proteins herein include additional moieties and/or modifications.
- the protein including the EMCN-specific antigen-binding domain as described herein is conjugated to a therapeutic agent (i.e. drug) to form an antibody-drug conjugate.
- therapeutic agents include, but are not limited to, chemotherapeutic agents, imaging agents (e.g., radioisotopes), immune modulators (e.g., cytokines, chemokines, or checkpoint inhibitors), and toxins (e.g., cytotoxic agents).
- the therapeutic agents are attached to the antigen-binding domain through a linker peptide, as discussed in more detail herein.
- ADCs antibody-drug conjugates
- the EMCN-specific chimeric protein includes an antigenbinding domain having one or more of the amino acid sequences listed in Table A and one or more additional binding moieties.
- the binding moieties are antibody fragments or antibody formats including, but not limited to, full-length antibodies, Fab fragments, Fvs, scFvs, tandem scFvs, Diabodies, scDiabodies, DARTs, tandAbs, minibodies, camelid VHH, and other antibody fragments or formats known to those skilled in the art. Exemplary antibody and antibody fragment formats are described in detail in Brinkmann et al. (MABS, 2017, Vol. 9, No. 2, 182-212), herein incorporated by reference for all that it teaches.
- the one or more additional binding moieties are attached to the C-terminus of one or more peptides of the EMCN-specific antigen-binding domain, such as the VH and/or VL, Fab heavy and/or light-chain fragment, or scFv.
- the one or more additional binding moieties are attached to the N-terminus of one or more peptides of the EMCN-specific antigen-binding domain, such as the VH and/or VL, Fab heavy and/or light-chain fragment, or scFv.
- the one or more additional binding moieties are specific for a different antigen or epitope than EMCN. In certain embodiments, the one or more additional binding moieties are specific for EMCN.
- the one or more additional binding moieties are attached to the antigen-binding domains described herein (e.g., having one or more of the amino acid sequences listed in Table A) using in vitro methods including, but not limited to, reactive chemistry (e.g., Click-chemistry) and affinity tagging systems.
- the one or more additional binding moieties are attached to the antigen-binding domains described herein (e.g., having one or more of the amino acid sequences listed in Table A) through Fc-mediated binding (e.g., Protein A/G).
- the one or more additional binding moieties are attached to the antigen-binding domains described herein (e.g., having one or more of the amino acid sequences listed in Table A) using recombinant DNA techniques, such as encoding the nucleotide sequence of the fusion product between the antigen-binding domains described herein and the additional binding moieties on the same expression vector e.g., plasmid).
- the antigen-binding domains described herein e.g., having one or more of the amino acid sequences listed in Table A
- modifications that comprise functional groups or chemically reactive groups that can be used in downstream processes such as linking to additional moieties (e.g., drug conjugates and additional binding moieties) and downstream purification processes.
- the modifications are chemically reactive groups including, but not limited to, reactive thiols (e.g., mal eimide based reactive groups), reactive amines (e.g., N-hydroxysuccinimide based reactive groups), “click chemistry” groups (e.g. reactive alkyne groups), and aldehydes bearing formylglycine (FGly).
- the modifications are functional groups including, but not limited to, affinity peptide sequences (e.g., HA, HIS, FLAG, GST, MBP, and Strep systems etc.).
- the functional groups or chemically reactive groups have a cleavable peptide sequence.
- the cleavable peptide is cleaved by means including, but not limited to, photocleavage, chemical cleavage, protease cleavage, reducing conditions, and pH conditions.
- protease cleavage is carried out by intracellular proteases.
- protease cleavage is carried out by extracellular or membrane associated proteases.
- ADC therapies adopting protease cleavage are described in more detail in Choi et al. (Theranostics, 2012; 2(2): 156-178.), the entirety of which is hereby incorporated by reference for all it teaches.
- Certain aspects of the present disclosure relate to methods of using the proteins (e.g., chimeric receptors) and genetically modified cells of the present disclosure (e.g., immunoresponsive cells) that express such proteins (e.g., chimeric receptors) to treat subjects in need thereof.
- the methods of the present disclosure are useful for treating cancer in a subject, such as a myeloid disorder.
- the myeloid disorder is a myelodysplastic syndrome, a myeloproliferative neoplasm, a chronic myelomonocytic leukemia, acute myeloid leukemia (AML), acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, chronic myelocytic leukemia, or polycythemia vera.
- the myeloid disorder is AML.
- the methods of the present disclosure may comprise administering genetically modified cells of the present disclosure in an amount effective to achieve the desired effect, including without limitation palliation of an existing condition, prevention of a condition, treatment an existing condition, management of an existing condition, or prevention of recurrence or relapse of a condition.
- the effective amount can be provided in one or a series of administrations of the genetically modified cells of the present disclosure (e.g., immunoresponsive cells).
- an effective amount can be provided in a bolus or by continuous perfusion.
- an "effective amount” or “therapeutically effective amount” is an amount sufficient to affect a beneficial or desired clinical result upon treatment.
- An effective amount can be administered to a subject in one or more doses.
- an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease.
- the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the immunoresponsive cells administered.
- cell doses in the range of about 1 x 10 6 to 1 xlO 10 cells are typically infused.
- immunoresponsive cells are induced that are specifically directed against the specific antigen.
- induction of immunoresponsive cells can include, without limitation, inactivation of antigen-specific cells such as by deletion or anergy. Inactivation is particularly useful to establish or reestablish tolerance such as in autoimmune disorders.
- the genetically modified cells can be administered by any method known in the art including, but not limited to, intravenous, subcutaneous, intranodal, intratumoral, intrathecal, intrapleural, intraperitoneal and directly to the thymus.
- methods of use encompass methods of inhibiting an immune response.
- Inhibiting an immune response can refer to preventing, attenuating, or inhibiting a cell-mediated immune response, such as, for example, induced by a chimeric receptor expressed on the surface of an immunomodulatory cell.
- the methods include preventing, attenuating, or inhibiting activation of an activating chimeric receptor expressed on the surface of an immunomodulatory cell.
- a chimeric inhibitory receptor of the present disclosure is used to prevent, attenuate, inhibit, or suppress an immune response initiated by a tumor targeting chimeric receptor (e.g., an activating CAR).
- a tumor targeting chimeric receptor e.g., an activating CAR
- an immunomodulatory cell expresses an inhibitory chimeric antigen that recognizes an antigen target 1 (e.g., a non-tumor antigen) and a tumor-targeting chimeric receptor that recognizes a different antigen target 2 (e.g. , a tumor target).
- an antigen target 1 e.g., a non-tumor antigen
- a tumor-targeting chimeric receptor that recognizes a different antigen target 2
- the inhibitory and tumor targeting chimeric receptors may or may not bind to their cognate antigen.
- both the inhibitory chimeric receptor and the tumor-targeting receptor can be activated.
- the activation of the inhibitory chimeric receptor results in the prevention, attenuation, or inhibition of the tumor targeting chimeric receptor signaling and the immunomodulatory cell is not activated.
- the target cell is a non-tumor cell that expresses only antigen target 1
- only the inhibitory chimeric receptor can be activated.
- the inhibitory chimeric receptor cannot be activated while the tumor-targeting chimeric receptor can be activated, resulting in signal transduction that results in activation of the immunomodulatory cell.
- Inhibition of an immune response initiated by a tumor targeting chimeric receptor can be an inhibition or reduction in the activation of the tumor targeting chimeric receptor, an inhibition or reduction in the signal transduction of a tumor targeting chimeric receptor, or an inhibition or reduction in the activation of the immunomodulatory cell.
- the inhibitory chimeric receptor can inhibit activation of the tumor targeting chimeric receptor, signal transduction by the tumor targeting chimeric receptor, or activation of the immunomodulatory cell by the tumor targeting chimeric receptor by about 1-fold, 2-fold, 3- fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, 20-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold or more as compared to the activation of the tumor targeting chimeric receptor, signal transduction, or activation of the immunomodulatory cell as compared to an immunomodulatory cell lacking an inhibitory chimeric receptor.
- inhibition refers to a decrease or reduction of the activity of a tumor targeting chimeric receptor before or after it has been activated.
- the immune response can be cytokine or chemokine production and secretion from an activated immunomodulatory cell.
- the immune response can be a cell-mediated immune response to a target cell.
- the chimeric inhibitory receptor is capable of suppressing cytokine production from an activated immunomodulatory cell. In some embodiments, the chimeric inhibitory receptor is capable of suppressing a cell-mediated immune response to a target cell, wherein the immune response is induced by activation of the immunomodulatory cell.
- the methods of the present disclosure increase an immune response in a subject in need thereof.
- the methods of the present disclosure include methods for treating and/or preventing a myeloid disorder in a subject.
- the subject is a human.
- suitable human subjects for therapy may comprise two treatment groups that can be distinguished by clinical criteria. Subjects with "advanced disease" or "high tumor burden” are those who bear a clinically measurable tumor.
- a clinically measurable tumor is one that can be detected on the basis of tumor mass (e.g., based on percentage of leukemic cells, by palpation, CAT scan, sonogram, mammogram or X-ray; positive biochemical or histopathologic markers on their own are insufficient to identify this population).
- a pharmaceutical composition of the present disclosure is administered to these subjects to elicit an anti -tumor response, with the objective of palliating their condition.
- reduction in tumor mass occurs as a result of administration of the pharmaceutical composition, but any clinical improvement will constitute a benefit.
- clinical improvement includes decreased risk or rate of progression or reduction in pathological consequences of the tumor.
- a second group of suitable human subjects are "adjuvant group" subjects. These subjects are individuals who have had ahistory of a myeloid disorder, but have been responsive to another mode of therapy.
- the prior therapy may have included, without limitation, surgical resection, radiotherapy, and/or traditional chemotherapy.
- these individuals have no clinically measurable tumor. However, they are suspected of being at risk for progression of the disease, either near the original tumor site, or by metastases.
- this group can be further subdivided into high-risk and low-risk individuals. The subdivision can be made on the basis of features observed before or after the initial treatment. These features are known in the clinical arts, and are suitably defined for each different myeloid disorder.
- Features typical of high-risk subgroups are those in which the tumor has invaded neighboring tissues, or who show involvement of lymph nodes.
- any increase or decrease or alteration of an aspect of characteristic(s) or function(s) is as compared to a cell not contacted with an immunoresponsive cell as described herein.
- Increasing an immune response can be both enhancing an immune response or inducing an immune response. For instance, increasing an immune response encompasses both the start or initiation of an immune response, or ramping up or amplifying an on-going or existing immune response.
- the treatment induces an immune response.
- the induced immune response is an adaptive immune response.
- the induced immune response is an innate immune response.
- the treatment enhances an immune response.
- the enhanced immune response is an adaptive immune response. In some embodiments, the enhanced immune response is an innate immune response. In some embodiments, the treatment increases an immune response. In some embodiments, the increased immune response is an adaptive immune response. In some embodiments, the increased immune response is an innate immune response.
- a further group of subjects are those having a genetic predisposition to a myeloid disorder, but that have not yet evidenced clinical signs of the myeloid disorder.
- women testing positive for a genetic mutation associated with AML, but still of childbearing age may benefit from receiving one or more of the cells of the present disclosure (e.g., immunoresponsive cells) in treatment prophylactically to prevent the occurrence of AML until it is suitable to perform preventive surgery.
- the subjects can have an advanced form of disease, in which case the treatment objective can include mitigation or reversal of disease progression, and/or amelioration of side effects.
- the subjects may have a history of the condition, for which they have already been treated, in which case the therapeutic objective may typically include a decrease or delay in the risk of recurrence.
- genetically modified cells of the present disclosure e.g., immunoresponsive ells
- a combination therapy of the present disclosure comprises a genetically modified cells of the present disclosure that can be administered in combination with one or more additional therapeutic agents.
- the genetically modified cell and the one or more additional therapeutic agents can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the genetically modified can be administered first, and the one or more additional agents can be administered second, or the order of administration can be reversed.
- the genetically modified cells are further modified to express one or more additional therapeutic agents.
- a genetically modified cell of the present disclosure may be used in a treatment regimen in combination with surgery, chemotherapy, radiation, immunosuppressive agents (e.g., cyclosporin, azathioprine, methotrexate, my cophenolate, and FK506), antibodies, or other immunoablative agents (e.g., CAMPATH or anti-CD3 antibodies), cytoxin, fludarabme, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, irradiation, and peptide vaccines.
- immunosuppressive agents e.g., cyclosporin, azathioprine, methotrexate, my cophenolate, and FK506
- antibodies or other immunoablative agents
- CAMPATH or anti-CD3 antibodies e.g., CAMPATH or anti-CD3 antibodies
- a genetically modified cell of the present disclosure may be used in combination with a lymphodepleting agent.
- Suitable lymphodepleting agents reduce or decrease lymphocytes, e.g., B cell lymphocytes and/or T cell lymphocytes, prior to immunotherapy.
- suitable lymphodepleting agents include, without limitation, fludarabine, cyclophosphamide, corticosteroids, alemtuzumab, total body irradiation (TBI), and any combination thereof.
- a genetically modified cell of the present disclosure may be used in combination with a chemotherapeutic agent.
- chemotherapeutic agents include, without limitation, an anthracy cline (e.g., doxorubicin), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors, such as fludarabine), an mTOR inhibitor, a TNFR glucocortic , a TNFR
- Examples of general chemotherapeutic agents suitable for use in combination therapies include, without limitation, anastrozole (Arimidex®), bicalutamide (Casodex®), bleomycin sulfate (Blenoxane®), busulfan (Myleran®), busulfan injection (Busulfex®), capecitabine (Xeloda®), N4-pentoxy carbonyl-5- deoxy-5-fluorocytidine, carboplatin (Paraplatin®), carmustine (BiCNU®), chlorambucil (Leukeran®), cisplatin (Piatinol®), cladribine (Leustatin®), cyclophosphamide (Cytoxan® or Neosar®), cytarabine, cytosine arabinoside (Cytosar-U®), cytarabine liposome injection (DepoCyt®), dacarbazine (D
- alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®.
- nitrogen mustards ethylenimine derivatives
- alkyl sulfonates alkyl sulfonates
- nitrosoureas and triazenes triazenes
- uracil mustard Amouracil Mustard®, Chlorethaminacil®, Demethyldopan®, Desmethyldopan®, Haemanthamine®, Nordopan®, Uracil nitrogen mustard®.
- Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin®); Temozolomide (Temodar® and Temodal®); Dactinomycin (also known as actinomycin-D, Cosmegen®); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran®); Altretamme (also known as hexamethylmelamine (HMM), Hexalen®); Carmustine (BiCNU®); Bendamustine (Treanda®); Busulfan (Busulfex® and Myleran®); Carboplatin (Paraplatin®); Lomustine (also known as CCNU, CeeNU®); Cisplatin (also known as CDDP, Platinol® and Platinol®-AQ); Chlorambucil (Leukeran®); Cyclophosphamide (Cytoxan® and Neosar®); dacarbazine (also
- Suitable mTOR inhibitors include, without limitation, temsirolimus, ridaforolimus (deferolimus), AP23573, MK8669, everolimus (Afimtor® or RADOO1), rapamycin (AY22989, Sirolmius®), and XL765.
- immunomodulators include, without limitation, afutuzumab, pegfilgrastim (Neulasta®), lenalidomide (CC-5013, Revlimid®), thalidomide (Thalomid®), actimid (CC4047), and IRX-2.
- anthracyclines include, without limitation, doxorubicin (Adriamycin® and Rubex®); bleomycin (lenoxane®); daunorubicin (dauorubicin hydrochloride, daunomyem, and rubidomycin hydrochloride, Cerubidine®); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome®); mitoxantrone (DHAD, Novantrone®); epirubicin (EllenceTM); idarubicin (Idamycin®, Idamycin PES®); mitomycin C (Mutamycin®); geldanamycin; herbimycin; ravidomycin; and desacet Iravidomycin.
- doxorubicin Adriamycin® and Rubex®
- bleomycin lenoxane®
- daunorubicin daunorubicin hydrochloride, daunomyem, and rubi
- vinca alkaloids examples include, without limitation, vinorelbine tartrate (Navelbine®), Vincristine (Oncovin®), and Vindesine (Eldisine®)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ® and Velban®); and vinorelbine (Navelbme®).
- proteosome inhibitors include, without limitation, bortezomib (Velcade®); carfilzomib; marizomib (NPI-0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and ONX-0912.
- a genetically modified cell of the present disclosure is administered in combination with a CD20 inhibitor, e.g., an anti-CD20 antibody, or fragment thereof.
- a CD20 inhibitor e.g., an anti-CD20 antibody, or fragment thereof.
- anti-CD20 antibodies include, without limitation, rituximab, ofatumumab, ocrelizumab, veltuzumab, obinutuzumab, TRU- 015 (Trubion Pharmaceuticals), ocaratuzumab, and Prol31921.
- a genetically modified cell of the present disclosure is administered in combination with an oncolytic virus.
- oncolytic viruses are capable of selectively replicating in and triggering the death of or slowing the growth of a cancer cell. In some cases, oncolytic viruses have no effect or a minimal effect on non-cancer cells.
- Suitable oncolytic viruses include, without limitation, an oncolytic adenovirus, oncolytic Herpes Simplex Viruses, oncolytic retrovirus, oncolytic parvovirus, oncolytic vaccinia virus, oncolytic Sinbis virus, oncolytic influenza virus, or oncolytic RNA virus (e.g., oncolytic reovirus, oncolytic Newcastle Disease Virus (NDV), oncolytic measles virus, or oncolytic vesicular stomatitis virus (VSV)).
- the oncolytic virus is a recombinant oncolytic virus.
- a genetically modified cell of the present disclosure is administered to a subject in combination with a protein tyrosine phosphatase inhibitor, e.g., a SHP-I inhibitor or a SHP-2 inhibitor.
- a genetically modified cell of the present disclosure can be used in combination with a kinase inhibitor.
- suitable kinase inhibitors include, without limitation, CDK4 inhibitors, CDK4/6 inhibitors, BTK inhibitors, phosphatidylinositol 3 -kinase (PI3K) inhibitors, mTOR inhibitors, MNK inhibitors, and anaplastic lymphoma kinase (ALK) inhibitors.
- a genetically modified cell of the present disclosure is administered to a subject in combination with a modulator of myeloid-derived suppressor cells (MDSCs).
- MDSCs accumulate in the periphery and at the tumor site of many solid tumors. These cells suppress T cell responses, thereby hindering the efficacy of chimeric receptor-expressing cell therapy.
- suitable modulators of MDSCs include, without limitation, MCS110 and BLZ945.
- a genetically modified cell of the present disclosure is administered to a subject in combination with an agent that inhibits or reduces the activity of immunosuppressive plasma cells.
- Immunosuppressive plasma cells have been shown to impede T cell-dependent immunogenic chemotherapy, such as oxaliplatin (Shalapour et al., Nature 2015, 521 :94- 101).
- immunosuppressive plasma cells can express one or more of IgA, interleukin (IL)- 10, and PD-L1.
- a genetically modified cell of the present disclosure is administered to a subject in combination with an interleukin- 15 (IL- 15) polypeptide, an interleukin- 15 receptor alpha (IL-I5Ra) polypeptide, or a combination of both an IL- 15 polypeptide and an IL-15Ra polypeptide.
- a genetically modified cell of the present disclosure is further modified to express an interleukin- 15 (IL-15) polypeptide, an interleukin- 15 receptor alpha (IL-I5Ra) polypeptide, or a combination of both an IL- 15 polypeptide and an IL-15Ra polypeptide.
- a subject having a myeloid disorder is administered a genetically modified cell of the present disclosure in combination with an agent, e.g., cytotoxic or chemotherapy agent, a biologic therapy (e.g., antibody, e.g., monoclonal antibody, or cellular therapy), or an inhibitor (e.g., kinase inhibitor).
- an agent e.g., cytotoxic or chemotherapy agent, a biologic therapy (e.g., antibody, e.g., monoclonal antibody, or cellular therapy), or an inhibitor (e.g., kinase inhibitor).
- the subject is administered a genetically modified cell of the present disclosure in combination with a cytotoxic agent, e.g., CPX-351 (Celator Pharmaceuticals), cytarabme, daunorubicin, vosaroxin (Sunesis Pharmaceuticals), sapacitabine (Cyclacel Pharmaceuticals), idarubicin, or mitoxantrone.
- a cytotoxic agent e.g., CPX-351 (Celator Pharmaceuticals), cytarabme, daunorubicin, vosaroxin (Sunesis Pharmaceuticals), sapacitabine (Cyclacel Pharmaceuticals), idarubicin, or mitoxantrone.
- CPX-351 is a liposomal formulation comprising cytarabine and daunorubicin at a 5: 1 molar ratio.
- the subject is administered a chimeric receptor- expressing cell described herein in combination with a hypomethylating agent, e.g., a DNA methyltransferase inhibitor, e.g., azacytidine or decitabine.
- a hypomethylating agent e.g., a DNA methyltransferase inhibitor, e.g., azacytidine or decitabine.
- the subject is administered a genetically modified cell of the present disclosure in combination with a biologic therapy, e.g., an antibody or cellular therapy, e.g., 225 Ac- lintuzumab (Actimab-A; Actinium Pharmaceuticals), IPH2102 (Innate Pharma/Bristol Myers Squibb), SGN-CD33A (Seattle Genetics), or gemtuzumab ozogamicin (Mylotarg; Pfizer).
- a biologic therapy e.g., an antibody or cellular therapy, e.g., 225 Ac- lintuzumab (Actimab-A; Actinium Pharmaceuticals), IPH2102 (Innate Pharma/Bristol Myers Squibb), SGN-CD33A (Seattle Genetics), or gemtuzumab ozogamicin (Mylotarg; Pfizer).
- a biologic therapy e.g., an antibody or cellular therapy, e.g.,
- the subject is administered a genetically modified cell of the present disclosure in combination a FLT3 inhibitor, e.g., sorafenib (Bayer), midostaurin (Novartis), quizartinib (Daiichi Sankyo), crenoianib (Arog Pharmaceuticals), PLX3397 (Daiichi Sankyo), AKN-028 (Akinion Pharmaceuticals), or ASP2215 (Astelias).
- a FLT3 inhibitor e.g., sorafenib (Bayer), midostaurin (Novartis), quizartinib (Daiichi Sankyo), crenoianib (Arog Pharmaceuticals), PLX3397 (Daiichi Sankyo), AKN-028 (Akinion Pharmaceuticals), or ASP2215 (Astelias).
- the subject is administered a genetically modified cell of the present disclosure in combination with an isocitrate dehydrogenase (IDH) inhibitor, e.g., AG-221 (Celgene/ Agios) or AG- 120 (Agios/Celgene).
- IDH isocitrate dehydrogenase
- the subject is administered a genetically modified cell of the present disclosure in combination with a cell cycle regulator, e.g., inhibitor of polo-like kinase 1 (Plkl), e.g., volasertib (Boehringer Ingelheim); or an inhibitor of cyclin-dependent kinase 9 (Cdk9), e.g., alvocidib (Tolero Pharmaceuticals/Sanofi Aventis).
- a cell cycle regulator e.g., inhibitor of polo-like kinase 1 (Plkl), e.g., volasertib (Boehringer Ingelheim); or an inhibitor of cyclin-dependent kinase 9 (Cdk9), e.g., alvocidib (Tolero Pharmaceuticals/Sanofi Aventis).
- the subject is administered a genetically modified cell of the present disclosure in combination with a B cell receptor signaling network inhibitor, e.g., an inhibitor of B-cell lymphoma 2 (Bel- 2), e.g., venetoclax (Abbvie/Roche); or an inhibitor of Buton's tyrosine kinase (Btk), e.g., ibrutinib (Pharmacyclics/Johnson & Johnson Janssen Pharmaceutical).
- a B cell receptor signaling network inhibitor e.g., an inhibitor of B-cell lymphoma 2 (Bel- 2), e.g., venetoclax (Abbvie/Roche); or an inhibitor of Buton's tyrosine kinase (Btk), e.g., ibrutinib (Pharmacyclics/Johnson & Johnson Janssen Pharmaceutical).
- a B cell receptor signaling network inhibitor e.g., an inhibitor of B-cell lymphoma 2
- the subject is administered a genetically modified cell of the present disclosure in combination with an inhibitor of Ml aminopeptidase; an inhibitor of histone deacetylase (HD AC), e.g., pracinostat (MEI Pharma); a multi-kinase inhibitor, e.g., rigosertib (Onconova Therapeutics/Baxter/SymBio); or a peptidic CXCR4 inverse agonist, e.g., BL-8040 (BioLineRx).
- HD AC histone deacetylase
- MEI Pharma histone deacetylase
- MEI Pharma histone deacetylase
- a multi-kinase inhibitor e.g., rigosertib (Onconova Therapeutics/Baxter/SymBio
- a peptidic CXCR4 inverse agonist e.g., BL-8040 (BioLineRx).
- a subject can be administered an agent which enhances the activity or fitness of a genetically modified cell of the present disclosure.
- the agent may inhibit a molecule that modulates or regulates, e.g., inhibits, T cell function.
- the molecule that modulates or regulates T cell function is an inhibitory molecule.
- inhibitory molecules such as Programmed Death 1 (PD-1) can decrease the ability of the genetically modified cell to mount an immune effector response.
- inhibitory molecules include, without limitation, PD-1, PD- Ll, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD 160, 2B4, CD80, CD86, B7-H3 (CD276), B7-H4 (VTCN1), HVEM (TNFRSF14 or CD270), KIR, A2aR, MHC class I, MHC class II, GAL9, adenosine, and TGF beta.
- an agent e.g., an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), can be used to inhibit expression of an inhibitory molecule in the genetically modified cell.
- an inhibitory nucleic acid e.g., an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonu
- the inhibitor is an shRNA.
- a genetically modified cell of the present disclosure may be further modified to express an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger endonuclease (ZFN), can be used to inhibit expression of an inhibitory molecule in the genetically modified cell.
- an inhibitory nucleic acid e.g., an inhibitory nucleic acid, e.g., a dsRNA, e.g., an siRNA or shRNA, a clustered regularly interspaced short palindromic repeats (CRISPR), a transcription-activator like effector nuclease (TALEN), or a zinc finger
- the agent that modulates or regulates, e.g., inhibits, T-cell function is inhibited within a genetically modified cell of the present disclosure.
- a dsRNA molecule that inhibits expression of a molecule that modulates or regulates, e.g., inhibits, T-cell function is linked to the nucleic acid that encodes a component, e.g., all of the components, of a chimeric receptor of the present disclosure.
- a nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is operably linked to a promoter, e.g., a HI- or a U6-derived promoter such that the dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is expressed, e.g., is expressed within a the genetically modified cell.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is present on the same vector, e.g., a lentiviral vector, that comprises a nucleic acid molecule that encodes a component, e.g., all of the components, of the chimeric receptor.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is located on the vector, e.g., the lentiviral vector, 5'- or 3'- to the nucleic acid that encodes a component, e.g., all of the components, of the chimeric receptor.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T- cell function can be transcribed in the same or different direction as the nucleic acid that encodes a component, e.g., all of the components, of the chimeric receptor.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is present on a vector other than the vector that comprises a nucleic acid molecule that encodes a component, e.g., all of the components, of the chimeric receptor.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function it transiently expressed within the genetically modified cell.
- the nucleic acid molecule that encodes a dsRNA molecule that inhibits expression of the molecule that modulates or regulates, e.g., inhibits, T-cell function is stably integrated into the genome of a genetically modified cell of the present disclosure.
- an agent that modulates or regulates, e.g., inhibits, T-cell function can be an antibody or antibody fragment that binds to an inhibitory molecule.
- the agent can be an antibody or antibody fragment that binds to PD-1 , PD-L1, PD-L2 or CTLA4.
- the agent is an antibody or antibody fragment that binds to TIM3.
- the agent is an antibody or antibody fragment that binds to LAG3.
- the agent which enhances the activity of the genetically modified cell is a CEACAM inhibitor (e.g., CEACAM-1, CEACAM-3, and/or CEACAM-5 inhibitor).
- the inhibitor of CEACAM is an anti-CEACAM antibody molecule.
- the agent which enhances activity of a genetically modified cell of the present disclosure is miR-17-92.
- the agent which enhances the activity of the genetically modified cell is CD40L.
- the agent which enhances the activity of the genetically modified cell is GM-CSF.
- a genetically modified cell of the present disclosure is further modified to express an antibody or antibody fragment that binds to an inhibitory molecule of the present disclosure.
- the agent which enhances activity of a genetically modified cell of the present disclosure is a cytokine.
- Cytokines have important functions related to immunoresponsive cell expansion, differentiation, survival, and homeostats.
- Cytokines that can be administered to the subject receiving a genetically modified cell of the present disclosure include, without limitation, IL-2, IL-4, IL-7, IL-9, IIL-12, L-15, IL-18, and IL-21, or a combination thereof.
- the cytokine can be administered once a day or more than once a day, e.g., twice a day, three times a day, or four times a day.
- the cytokine can be administered for more than one day, e.g., the cytokine is administered for 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, or 4 weeks. For example, the cytokine is administered once a day for 7 days.
- a genetically modified cell of the present disclosure is further modified to express one or more cytokines, such as IL-2, IL-4, IL-7, IL-9, IL-12, L-15, IL-18, and IL-21.
- the cytokine can be administered simultaneously or concurrently with the genetically modified cells, e.g., administered on the same day.
- the cytokine may be prepared in the same pharmaceutical composition as the genetically modified cells, or may be prepared in a separate pharmaceutical composition.
- the cytokine can be administered shortly after administration of the genetically modified cells, e.g., 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days after administration of the genetically modified cells.
- the first day of the cytokine dosing regimen can be on the same day as administration with the genetically modified cells, or the first day of the cytokine dosing regimen can be 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days after administration of the genetically modified cells.
- the genetically modified cells are administered to the subject, and on the second day, a cytokine is administered once a day for the next 7 days.
- the cytokine is administered for a period of time after administration of the genetically modified cells, e.g., at least 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, 12 weeks, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, or 1 year or more after administration of the genetically modified cells.
- the cytokine is administered after assessment of the subject's response to the genetically modified cells.
- kits for the treatment and/or prevention of a cancer e.g., AML
- the kit includes a therapeutic or prophylactic composition comprising an effective amount of one or more proteins including an antigen-binding domain (e.g., scFv) of the present disclosure, such as a chimeric receptor of the present disclosure, isolated nucleic acids of the present disclosure, vectors of the present disclosure, and/or cells of the present disclosure (e.g., immunoresponsive cells).
- the kit comprises a sterile container.
- such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
- the container may be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
- therapeutic or prophylactic composition is provided together with instructions for administering the therapeutic or prophylactic composition to a subject having or at risk of developing cancer (e.g., AML).
- the instructions may include information about the use of the composition for the treatment and/or prevention of the disorder.
- the instructions include, without limitation, a description of the therapeutic or prophylactic composition, a dosage schedule, an administration schedule for treatment or prevention of the disorder or a symptom thereof, precautions, warnings, indications, counter-indications, over-dosage information, adverse reactions, animal pharmacology, clinical studies, and/or references.
- the instructions can be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- VH heavy chain variable
- VL light chain variable
- CDR-H3 heavy chain complementarity determining region 3
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3), and wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1, and optionally wherein the amino acid sequences of the CDR-H1, the CDR-H2, and the CDR-H3 of the reference antibody are defined based on the Kabat or Chothia numbering scheme.
- VH heavy chain variable
- VL light chain variable
- CDR-H1 heavy chain complementarity determining region 1
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises:
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 having the amino acid sequence of QVSKLDS
- CDR-L3 having the amino acid sequence of LQGIHLPWT
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), and wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- VH heavy chain variable
- VL light chain variable
- CDR-L1 light chain complementarity determining region 1
- CDR-L2 light chain complementarity determining region 2
- CDR-L3 light chain complementarity determining region 3
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 light chain complementarity determining region 2
- QVSKLDS QVSKLDSEQ ID NO: 11
- VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3), wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- VH comprises:
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises:
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or
- a heavy chain complementarity determining region 1 having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- VH region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- VH region comprises the amino acid sequence of SEQ ID NO: 1.
- VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- VL region comprises the amino acid sequence of SEQ ID NO: 9.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- VH heavy chain variable
- VL light chain variable
- VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- VL region comprises the amino acid sequence of SEQ ID NO: 9.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain comprises an antibody or antigen-binding fragment thereof, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- VH heavy chain variable
- VL light chain variable
- VL region comprises the amino acid sequence of SEQ ID NO: 9.
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain competes with a reference antibody or antigen-binding fragment thereof for binding to EMCN, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASD
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain binds essentially the same EMCN epitope as a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of K
- a chimeric protein comprising an antigen-binding domain specific for endomucin (EMCN) and a heterologous molecule or moiety, wherein the antigen-binding domain binds an epitope of human EMCN that is the same as the EMCN epitope bound by a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (C
- the antigen-binding domain comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- scFv comprises an amino acid sequence selected from the group consisting of: SEQ ID Nos: 17- 22.
- chimeric protein of any one of embodiments 1 -32 wherein the chimeric protein is a chimeric antigen receptor (CAR), and wherein the heterologous molecule or moiety comprises a polypeptide selected from the group consisting of: a transmembrane domain, one or more intracellular signaling domains, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof.
- CAR chimeric antigen receptor
- a single chain variable fragment (scFv) specific for endomucin comprising a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- a single chain variable fragment (scFv)specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3)
- the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- a single chain variable fragment (scFv) specific for endomucin (EMCN), wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises:
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4).
- VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3), wherein the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 having the amino acid sequence of QVSKLDS
- CDR-L3 having the amino acid sequence of LQGIHLPWT
- a single chain variable fragment (scFv) specific for endomucin EMCN
- the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- VL comprises a light chain complementarity determining region 1 (CDR-L1), a light chain complementarity determining region 2 (CDR-L2), and a light chain complementarity determining region 3 (CDR-L3)
- the amino acid sequences of CDR-L1, CDR-L2, and CDR-L3 are contained within the VL region amino acid sequence of SEQ ID NO: 9.
- a single chain variable fragment (scFv) specific for endomucin (EMCN), wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- CDR-L1 having the amino acid sequence of KSSQSLVASDENTYLN
- CDR-L2 light chain complementarity determining region 2
- QVSKLDS QVSKLDSEQ ID NO: 11
- CDR-L3 light chain complementarity determining region 3
- VH comprises a heavy chain complementarity determining region 1 (CDR-H1), a heavy chain complementarity determining region 2 (CDR-H2), and a heavy chain complementarity determining region 3 (CDR-H3), wherein the amino acid sequences of CDR-H1, CDR-H2, and CDR-H3 are contained within the VH region amino acid sequence of SEQ ID NO: 1.
- CDR-H1 heavy chain complementarity determining region 1
- CDR-H2 heavy chain complementarity determining region 2
- CDR-H3 heavy chain complementarity determining region 3
- a heavy chain complementarity determining region 1 having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or (b) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4)
- a single chain variable fragment (scFv) specific for endomucin (EMCN), wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises:
- CDR-H1 a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4); or
- a heavy chain complementarity determining region 1 having the amino acid sequence of RYDMH (SEQ ID NO: 102), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 103), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 10), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 11), and a light chain complementarity determining region 3 (CDR-L3) having the amino acid sequence of LQGIHLPWT (SEQ ID NO: 12).
- VH region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- a single chain variable fragment (scFv) specific for endomucin (EMCN), wherein the antigen-binding domain comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VH comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 1.
- VL region comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain comprises an antibody or antigen-binding fragment thereof, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, and wherein the VL comprises an amino acid sequence with at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 9.
- VH heavy chain variable
- VL light chain variable
- scFv of any one of embodiments 43-63, wherein the scFv comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 17-22.
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain competes with a reference antibody or antigen-binding fragment thereof for binding to EMCN, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (S
- a single chain variable fragment comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain binds essentially the same EMCN epitope as a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASD
- a single chain variable fragment (scFv) comprising an antigen-binding domain specific for endomucin (EMCN), wherein the antigen-binding domain binds an epitope of human EMCN that is the same as the EMCN epitope bound by a reference antibody or antigen-binding fragment thereof, wherein the reference antibody or antigen-binding fragment thereof comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GFSLSRY (SEQ ID NO: 2), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of WGNGN (SEQ ID NO: 3), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 4), and wherein the VL comprises: a light chain complementarity determining region 1 (CDR-L1)
- composition comprising the chimeric protein of any one of embodiments 1 -42 and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- composition comprising the scFv of any one of embodiments 43-69 and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- An expression vector comprising the engineered nucleic acid of embodiment 72.
- An expression vector comprising the engineered nucleic acid of embodiment 73.
- a composition comprising the engineered nucleic acid of embodiment 72 or the expression vector of embodiment 74, and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- composition comprising the engineered nucleic acid of embodiment 73 or the expression vector of embodiment 75, and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- a method of making an engineered cell comprising transducing an isolated cell or population of cells with the engineered nucleic acid of embodiment 72 or the expression vector of embodiment 74.
- a method of making an engineered cell comprising transducing an isolated cell or population of cells with the engineered nucleic acid of embodiment 73 or the expression vector of embodiment 75.
- An isolated cell comprising the engineered nucleic acid of embodiment 72, the expression vector of embodiment 74, or the composition of embodiment 76.
- An isolated cell comprising the engineered nucleic acid of embodiment 73, the expression vector of embodiment 75, or the composition of embodiment 77.
- each of the one or more tumor-targeting chimeric receptors is a chimeric antigen receptor (CAR) or an engineered T cell receptor.
- CAR chimeric antigen receptor
- T cell receptor a chimeric antigen receptor
- the cell or population of cells of embodiment 94 or 95, wherein the one or more tumor-targeting chimeric receptors comprises a tumor-targeting chimeric receptor that targets CD33 and FLT3.
- a T cell a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, a dendritic cell, an erythrocyte, a platelet cell, a human embryonic stem cell (ESC), an ESC-derived cell, a pluripotent stem cell, a T cell, a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a
- a pharmaceutical composition comprising an effective amount of the cell or population of engineered cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94- 102 and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- a pharmaceutical composition comprising an effective amount of genetically modified cells expressing the chimeric protein of any one of embodiments 1-42 and a pharmaceutically acceptable carrier, pharmaceutically acceptable excipient, or a combination thereof.
- embodiment 105 The pharmaceutical composition of embodiment 103 or embodiment 104, which is for treating and/or preventing a tumor.
- a method of treating a subject in need thereof comprising administering a therapeutically effective dose of the composition of embodiment 70 or embodiment 76, or any of the cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102, or the composition of embodiment 103 or embodiment 104.
- a method of stimulating a cell-mediated immune response to a tumor cell in a subject comprising administering to a subject having a tumor a therapeutically effective dose of the composition of embodiment 70 or embodiment 76, or any of the cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102, or the composition of embodiment 103 or embodiment 104.
- a method of inhibiting a cell-mediated immune response to a tumor cell in a subject comprising administering to a subject having a tumor a therapeutically effective dose of the composition of embodiment 70 or embodiment 76, or any of the cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102, or the composition of embodiment 103 or embodiment 104.
- invention 109 comprising administering to the subject any of the cell of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102, wherein the isolated cell or population of cells express the chimeric protein comprising the inhibitory CAR of embodiment 38.
- a method of treating a subject having a tumor comprising administering a therapeutically effective dose of the composition of embodiment 76 or embodiment 76, or any of the cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102, or the composition of embodiment 103 or embodiment 104.
- kits for treating and/or preventing a tumor comprising the chimeric protein of any one of embodiments 1-42.
- kit of embodiment 113 wherein the kit further comprises written instructions for using the chimeric protein for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- a kit for treating and/or preventing a tumor comprising the cell or population of cells of any one of embodiments 80, 82, 84, 86, 88, 90, 92, and 94-102.
- kit of embodiment 115 wherein the kit further comprises written instructions for using the cell for treating and/or preventing a tumor in a subject.
- a kit for treating and/or preventing a tumor comprising the engineered nucleic acid of embodiment 72.
- kit of embodiment 117 wherein the kit further comprises written instructions for using the nucleic acid for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- a kit for treating and/or preventing a tumor comprising the vector of embodiment 74.
- kit of embodiment 119 wherein the kit further comprises written instructions for using the vector for producing one or more antigen-specific cells for treating and/or preventing a tumor in a subject.
- a kit for treating and/or preventing a tumor comprising the composition of any one of embodiments 74, 76, and 103-105. 122. The kit of embodiment 121, wherein the kit further comprises written instructions for using the composition for treating and/or preventing a tumor in a subject.
- Rat anti -human EMCN monoclonal antibody clone Abl was sequenced. Briefly, samples containing each of the immunoglobulin chains were digested by various enzymes then analyzed by LC-MS/MS. Peptides were characterized from LC-MS/MS data using de novo peptide sequencing and then assembled into antibody sequences.
- the Abl anti-EMCN antibody was peptide sequenced. LC-MS/MS data of multiple enzyme digestions were mapped to the assembled antibody sequences. In the heavy chain and light chain, 100% of amino acid residues were covered by at least 5 peptide scans, with significant supporting fragment ions (data not shown).
- a lentiviral vector encoding human endomucin (Origene Cat. No. RC215698L4;
- Lenti ORF clone of Human endomucin (EMCN), transcript variant 1, mGFP) was used to generate EMCN expressing cell lines.
- Lentivirus was produced using: Lenti-X 293T packaging cell line (Clontech, Cat# 632180); LX293T Complete growth medium, without antibiotics; DMEM, hi-glucose; ImM Sodium Pyruvate; 10% FBS, heat-inactivated; Opti- Mem I Reduced Serum Media (Gibco/Thermo Fisher; Cat# 31985); FuGene HD (Promega, Cat#E2311); Envelope, Packaging, and Transfer Vector plasmids; VSV-G-pseudotyped envelope vector (pMD2.G); Packaging vector that contains Gag, Pol, Rev, and Tat that can be used with 2nd and 3rd generation transfer vectors (psMAX2).
- 293T(FT) cells from 90% confluent 10cm dishes were lifted and dispensed at 1 :3 dilution late in the afternoon the day before transfection and incubated cells as normal overnight at 37°C, 5% CO2 (cells should be 60-85% confluent the next day at time of transfection).
- Viral supernatants were harvested on days 2 and 3 using a serological pipette.
- a Lenti-X Concentrator (Cat. Nos. 631231 & 631232) was used according to the protocol: 1) Combine 1 volume of Lenti-X Concentrator with 3 volumes of clarified supernatant. Mix by gentle inversion; 2) Incubate mixture on ice or at 4°C for 30 minutes to overnight; (3) Centrifuge sample at 1,500 x g for 45 minutes at 4°C; (4) Carefully remove and discard supernatant, taking care not to disturb the pellet; (5) Gently resuspend the pellet in 1/10 to 1/100th of the original volume using sterile PBS + 0.1% BSA.
- the Molml3 cell line was obtained from AddexBio (Cat. No. C0003003) and the SEM cell line was obtained from the German Collection of Microorganisms and Cell Culture GmbH (DSMZ No. ACC 546).
- Lentiviral transduction of cell lines was performed according to the protocol below: 1. Plate 0.5-1 million cells (500uL) in a 24-well plate for each cell line and condition (in RPMI+1%FBS)
- Transduced cells were selected in 0.5-3.33pg/mL Puromycin in 10% FBS+RPMI media. Puromycin was added three days after transduction and refreshed every 2-4 days.
- EMCN expressing cell lines were generated. Specifically, cells lines known to express potential cancer targets of interest for CAR meditated killing (e.g., FLT3 (CD135) and CD33 (SIGLEC3)). Following lentiviral transduction and drug-selection, engineered cells were evaluated for EMCN expression by flow cytometry. The gating strategy for establishing EMCN expression baseline was established using a secondary-only control (FIG. 3A). As shown in FIG. 3B, none of the No Virus transduction control cell lines demonstrated EMCN expression. As shown in FIG. 3C, transduced cell lines demonstrated low levels of expression on Day 3 following transduction.
- Transduced cells were then drug-selected for 21 days (Day 24 post transduction).
- engineered Molml3, Molml4, MV4-11, and SEM cells demonstrated between 83-99% of cells expressing EMCN by flow cytometry following culturing with Ipg/mL Puromycin or 0.5pg/mL Puromycin, respectively.
- Transduced PL-21 selected in 0.5pg/mL Puromycin demonstrated greater than 50% of cells expressing EMCN (PL-21 were not viable following selection with Ipg/mL Puromycin).
- CAR constructs were cloned into a lentiviral vector.
- Lentivirus was produced using the Lenti-X 293T system, as described above.
- the antigen specificity and domain organization for the CAR constructs examined are described in Table C below, and scFv amino acid sequences and nucleotide sequences are presented in Table D and Table E, respectively.
- T cells Primary T cells were isolated from human donor PBMCs and frozen. Prior to transduction, T cells were thawed and activated with Human T-Activator CD3/CD28 Dynabeads and cultured in CTS OpTmizer T Cell Expansion medium with IL-2 overnight. Next, T cells were transduced with a CAR lentivirus containing a selected CAR vector by removing a portion of the media and adding drop-wise the appropriate amount of lentiviral supematent then gently mixed by pipetting. The cells were placed in an incubator overnight and the next day additional media was added to dilute the virus. The cells were then cultured as normal. Day 4 post-transduction, CAR expression was assessed via antibody staining and flow cytometry.
- T cells and target cells were mixed together and co-cultured (ET ratio: 1:1, 96-well plate, 200ul total medium volume). To distinguish targets cells and T cells, target cells were stained with CellTrace Violet dye.
- cytotoxicity assays cells were collected after an 18-hour co-incubation and stained with Sytox Red cell viability dye to distinguish live/dead target cells. T cell cytotoxicity against the target cells was assessed by flow cytometry (analysis performed using FlowJo software) and presented as percent killing normalized to a No Virus transduction T cell control.
- CAR T cells specific for FLT3, CD33, or various constructs for EMCN were generated. Each receptor included a cytoplasmic signaling domain such that binding to a target antigen should stimulate an immune response, such as cytokine production and/or target cell killing.
- a target antigen such as cytokine production and/or target cell killing.
- VH and VL orientations together with various scFv linkers were also assessed.
- FIG. 5C and FIG. 5D Co-incubation of FLT3-specific or CD33-specific CAR T cells with parental Molml3 (FIG. 7A; top panel) or SEM (FIG. 7A; bottom panel) target cells led to target cell killing (second and third columns, respectively), while co-incubation with EMCN-specific CAR T cells did not demonstrate detectable levels of target cell killing (columns 4-9). In contrast, co-incubation of CAR T cells with Molml3 (FIG. 7B; top panel) or SEM (FIG.
- CAR constructs are cloned into a lentiviral vector.
- Lentivirus is produced using the Lenti-X 293T system, as described above.
- the antigen specificity and domain organization for the CAR constructs examined are described in Table F below.
- T cells are isolated from human donor PBMCs and frozen. Prior to transduction, T cells are thawed and activated with Human T-Activator CD3/CD28 Dynabeads and are cultured in CTS OpTmizer T Cell Expansion medium with IL-2 overnight. Next, T cells are transduced with CAR lentiviruses containing a selected EMCN- specific inhibitory CAR vector together with CAR lentiviruses containing either a FLT3- specific or CD33-specific activating CAR vector by removing a portion of the media and adding drop-wise the appropriate amount of lentiviral supematent then gently mixed by pipetting. The cells were placed in an incubator overnight and the next day additional media was added to dilute the virus. The cells were then cultured as normal. Day 4 post-transduction, CAR expression was assessed via antibody staining and flow cytometry.
- T cells and target cells are co-cultured on day 9 after transduction (ET ratio: 1:1, 96-well plate, 200ul total medium volume). To distinguish targets cells and T cells, target cells are stained with CellTrace Violet dye.
- cytotoxicity assays cells are collected after an 18-hour co-incubation and stained with Sytox Red cell viability dye to distinguish live/dead target cells. Cytotoxicity is assessed by flow cytometry (FlowJo) and presented as percent killing normalized to a No Virus transduction T cell control.
- CAR T cells specific for EMCN and FLT3 or specific for EMCN and CD33 are generated.
- FLT3 and CD33 CARs include a cytoplasmic signaling domain such that binding to a target antigen should stimulate an immune response, such as cytokine production and/or target cell killing.
- EMCN CARs include an inhibitory cytoplasmic domain such that binding to a target antigen should inhibit an immune response, such as that stimulated by the FLT3- specific or CD33-specific CARs binding to their respective targets.
- Such a system is referred to as a “NOT gate.”
- NOT gate For EMCN-specific CAR constructs, different VH and VL orientations together with various scFv linkers (G4S, (G4S)3, and Whitlow) are also assessed.
- CAR T cells engineered with an EMCN-specific CAR with an inhibitory cytoplasmic domain demonstrates the ability to reduce or minimize killing of EMCN-expressing cells establishing an effective NOT gate system to avoid undesired killing of EMCN-positive cells.
- Example 5 Assessment of Various Chimeric Inhibitory Receptors In Reducing NK Cell Activation
- iCAR and aCAR constructs were packaged into lentiviral particles and used to transduce primary NK cells after 10 d expansion with K562 feeder cells with 500 U/mL IL-2 and 20 ng/uL IL-15. Virus amounts were set by p24 titer (750,000 pg per transduction). iCAR constructs contained puroR cassettes, so puromycin was added to NK cell cultures from day 4 to 7 post transduction, at which time expression was assessed by flow cytometry and NK cells were transferred to a microwell plate for killing assays with 12,500 NK cells and 50,000 total tumor cells.
- NK cells were cultured with (1) tumor cells expressing aCAR antigen FLT3 only, (2) tumor cells expressing both aCAR antigen FLT3 and iCAR antigen EMCN, or (3) both tumor cell types mixed. After 16-18 hrs, cultures were analyzed by flow cytometry and remaining live targets cells of each type were counted.
- aCAR-mediated killing (basal subtracted) of a given NK cell type was quantified by first calculating total killing (reduction of targets compared to a target-only condition), and then subtracting total killing by control (iCAR-only) NK cells.
- iCAR-mediated protection was quantified as the change in aCAR-mediated killing between targets with or without iCAR antigen.
- Killing assay supernatant was analyzed for TNFa secretion, and aCAR and iCAR performance metrics were calculated analogously to killing.
- iCARs were stained with aV5-Al exafluor 647 and aCARs with aFLAG-BV-421. Cells were assigned to 4 quadrants based on iCAR+Z- and aCAR+Z- expression states, allowing us to assess “%aCAR+iCAR+” and “% not aCAR+iCAR-” (aCAR+iCAR- are ungated and potentially toxic CAR-NK cells and are to be avoided).
- MFI median fluorescence intensity
- the anti-EMCN iCAR constructs assessed used the formats shown in Table G with reference to the intracellular domain.
- the anti-FLT3 aCAR construct assessed is also shown in Table G.
- NK cells were engineered to express activating chimeric antigen receptors (aCARS) and inhibitory chimeric antigen receptors (iCARs) having various inhibitory domain formats derived from different inhibitory receptors. NK cells were virally transduced with aCAR only or in combination with iCARs having the various inhibitory domains indicated.
- aCARS chimeric antigen receptors
- iCARs inhibitory chimeric antigen receptors
- Engineered NK cells were assessed for CAR expression. As shown in FIG. 8, among aCAR+iCAR+ NK cells (top panel), anti-FLT3 aCAR expression was generally greater than 10-fold above background and the anti-EMCN iCAR was generally greater than 100-fold. LIR family constructs demonstrated notably high expression relative to other constructs. The profile of CAR expressing populations was also assessed (bottom panel) and demonstrated the total population contained fewer than 5% aCAR+iCAR- cells and had varying percentages of aCAR+iCAR+ populations for the various iCAR formats, with KLRG1, LIR2, LIR3, LIR5, and SIGLEC-2 formats having consistently greater than 50% of cells being aCAR+iCAR+. Again, LIR family iCARs notably generally demonstrated a greater proportion of aCAR+iCAR+ cells relative to other constructs.
- NK cells expressing LIR2, LIR3, LIR5, KIR2DL1, LAIR1, and SIGLEC-2 anti-EMCN iCAR formats demonstrated consistent aCAR-mediated performance in killing (top panels) and iCAR-mediated protection in both killing (top panels) and cytokine reduction (bottom panel), with SIGLEC-10 and KLRG1 constructs varying more in their performance.
- NK cells were successfully engineered to co-express aCARs and iCARs, in particular anti-EMCN iCARS, successfully kill target cells and produce cytokines in the absence of an iCAR ligand in an aCAR ligand dependent manner, and successfully reduce NK-mediated killing and cytokine production in an iCAR ligand (anti- EMCN) dependent manner.
- Example 6 Assessment of Protection of Healthy HSPC Populations by an EMCN iCAR
- Human hematopoietic stem and progenitor cells express both CD33 and EMCN, and thus, the ability of an anti-endomucin (aEMCN)-targeting inhibitory CAR (iCAR) to protect HSPCs from anti-CD33 activating CAR killing is assessed.
- Human CD34+ bone marrow-derived hemaotopietic stem and progenitor cells were sourced from AllCells.
- Viability dye and antibodies for flow cytometry, including lineage cocktail, CD34, CD38, and CD45RA, were purchased from BD biosciences or Biolegend.
- NK cells were purified in house from donors using CD3 depletion and CD56 positive selection.
- NK cells were expanded by co-culturing with K562 cells expressing membrane tethered IL-15 and IL-21. NK cells were transduced using synthetic constructs encoding CARs in a gamma retroviral backbone by spinduction on retronectin-coated plates. To prepare the CAR-encoding retroviruses, GP2 packaging cells were transfected with the synthetic constructs. aCARs were second generation CARs with an anti-CD33 antigen-binding domain, and iCARs were constructed analogously but with two inhibitory intracellular domains instead of an activating intracellular domain. An off-target inhibitory CAR (iCAR) used as a control included an anti- HER2 binding domain.
- iCAR off-target inhibitory CAR
- the anti-EMCN iCAR included an anti-EMCN scFV of SEQ ID NO: 17, a CD8 hinge, a LIR1 transmembrane domain, a first intracellular domain of LIR1, and a second intracellular domain of KIR3DL1.
- HSPCs were thawed and washed once with RPMI.
- CAR-expressing NK cells were washed once with RPMI and then arrayed in various combinations with HSPCs at 4: 1 E:T ratio in microwell plates and incubated overnight at 37 degrees C with 5% CO2.
- Assay plates were centrifuged, stained with the antibody cocktail and viability dye, and analyzed by flow cytometry. A fixed volume from every well was acquired and the counts of the various subpopulations in each volume were tallied and used to calculate killing relative to a condition with no NK cells (FIG. 10).
- NK cells expressing an aCD33 aCAR and an iCAR specific to an off-target antigen resulted in more killing than co-culture with NK cells expressing an aCD33 aCAR and an aEMCN iCAR.
- the dual-CAR transduced NK cell conditions resulted in elevated baseline killing
- the NK cells expressing an aEMCN iCAR and an aCD33 aCAR resulted in reduced killing of HSPCs as compared to NK cells expressing an off-target iCAR and an aCD33 aCAR, indicating aEMCN iCAR- mediated protection of HSPCs.
- a B cell precursor leukemia cell line (NALM6) cells are used as target cells and are genetically modified to express either FLT3 (the activating antigen) only (“cancer model cell”) or both FLT3 and EMCN (the safety antigen) together (“healthy model cell”).
- the mouse model consists of Jax hIL-15 mice (NSG background) injected with a 1:1 mixture of these two NALM6 cell types (5e5 cells total) via tail vein route.
- mice are divided into 3 groups of 6 mice, each of which receiving one of 3 NK cell treatments, including (Group A) No NK cells (PBS control), (Group B) NK cells expressing aFLT3 aCAR, or (Group C) NK cells expressing both aFLT3 aCAR and aEMCN iCAR.
- NK cell treatments including (Group A) No NK cells (PBS control), (Group B) NK cells expressing aFLT3 aCAR, or (Group C) NK cells expressing both aFLT3 aCAR and aEMCN iCAR.
- Peripheral blood are collected from these mice weekly and prepared for flow cytometry analysis with red blood cell lysis and staining with antibodies and viability dyes to discriminate NALM6 cells that do or do not express the safety antigen.
- NK cells in Group B express the aCAR and reduce target cell number
- both NK cells in Groups A and B do not have the iCAR or recognize the safety antigen, so in both groups the % of target cells that express EMCN remain at 50% as initially injected.
- NK cells in Group C recognize the safety antigen on the EMCN+ NALM6 subpopulation, reducomg the NK cell- mediated killing of the target cells.
- the results demonstrate successful NOT gate circuit function based on an elevation in the % of target cells in peripheral blood that are EMCN+ as compared to the two control groups.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Engineering & Computer Science (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Mycology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021361993A AU2021361993A1 (en) | 2020-10-16 | 2021-10-15 | Chimeric receptors and methods of use thereof |
| IL302148A IL302148A (en) | 2020-10-16 | 2021-10-15 | Chimeric receptors and methods of use thereof |
| JP2023523050A JP2023545517A (ja) | 2020-10-16 | 2021-10-15 | キメラ受容体およびその使用方法 |
| EP21881235.2A EP4228682A4 (en) | 2020-10-16 | 2021-10-15 | Chimeric receptors and methods of use thereof |
| KR1020237016201A KR20230109138A (ko) | 2020-10-16 | 2021-10-15 | 키메라 수용체 및 이의 사용 방법 |
| CA3195817A CA3195817A1 (en) | 2020-10-16 | 2021-10-15 | Chimeric receptors and methods of use thereof |
| CN202180084959.6A CN116635423A (zh) | 2020-10-16 | 2021-10-15 | 嵌合受体及其使用方法 |
| TW110138533A TWI907544B (zh) | 2020-10-16 | 2021-10-18 | 嵌合受體及其使用方法 |
| US18/300,981 US12611458B2 (en) | 2020-10-16 | 2023-04-14 | Chimeric receptors and methods of use thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063092736P | 2020-10-16 | 2020-10-16 | |
| US63/092,736 | 2020-10-16 | ||
| US202163151483P | 2021-02-19 | 2021-02-19 | |
| US63/151,483 | 2021-02-19 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/300,981 Continuation US12611458B2 (en) | 2020-10-16 | 2023-04-14 | Chimeric receptors and methods of use thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022082059A1 true WO2022082059A1 (en) | 2022-04-21 |
| WO2022082059A8 WO2022082059A8 (en) | 2023-04-06 |
Family
ID=81209346
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/055302 Ceased WO2022082059A1 (en) | 2020-10-16 | 2021-10-15 | Chimeric receptors and methods of use thereof |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US12611458B2 (https=) |
| EP (1) | EP4228682A4 (https=) |
| JP (1) | JP2023545517A (https=) |
| KR (1) | KR20230109138A (https=) |
| AU (1) | AU2021361993A1 (https=) |
| CA (1) | CA3195817A1 (https=) |
| IL (1) | IL302148A (https=) |
| TW (1) | TWI907544B (https=) |
| WO (1) | WO2022082059A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023205739A3 (en) * | 2022-04-20 | 2024-01-04 | Senti Biosciences, Inc. | Antigen-binding domains and methods of use thereof |
| WO2025085867A1 (en) * | 2023-10-20 | 2025-04-24 | A2 Biotherapeutics, Inc. | Compositions and methods for treating blood cancers |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160272728A1 (en) * | 2013-03-19 | 2016-09-22 | Kazusa Dna Research Institute | ANTI-DOG IgE MONOCLONAL ANTIBODY, AND LIGHT-CHAIN VARIABLE REGION AND HEAVY-CHAIN VARIABLE REGION OF ANTI-DOG IgE MONOCLONAL ANTIBODY |
| US20170166634A1 (en) * | 2014-05-02 | 2017-06-15 | Medimmune Limited | Ion channel modulators and uses thereof |
| US20190112610A1 (en) * | 2016-03-31 | 2019-04-18 | The Schepens Eye Research Institute, Inc. | Endomucin Inhibitor as an Anti-Angiogenic Agent |
| US20200316120A1 (en) * | 2018-09-28 | 2020-10-08 | Immpact-Bio Ltd. | METHODS FOR IDENTIFYING ACTIVATING ANTIGEN RECEPTOR (aCAR)/INHIBITORY CHIMERIC ANTIGEN RECEPTOR (iCAR) PAIRS FOR USE IN CANCER THERAPIES |
| WO2021168298A1 (en) * | 2020-02-20 | 2021-08-26 | Senti Biosciences, Inc. | Inhibitory chimeric receptor architectures |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7214786B2 (en) * | 2000-12-14 | 2007-05-08 | Kovalic David K | Nucleic acid molecules and other molecules associated with plants and uses thereof for plant improvement |
| TW202110873A (zh) * | 2019-04-30 | 2021-03-16 | 美商聖堤生物科技股份有限公司 | 嵌合受體及其使用方法 |
| WO2021157601A1 (ja) * | 2020-02-03 | 2021-08-12 | 国立大学法人東海国立大学機構 | がんを有する対象においてがんを処置することに用いるための抗meflin抗体、および当該抗体を含む医薬組成物 |
-
2021
- 2021-10-15 KR KR1020237016201A patent/KR20230109138A/ko active Pending
- 2021-10-15 WO PCT/US2021/055302 patent/WO2022082059A1/en not_active Ceased
- 2021-10-15 CA CA3195817A patent/CA3195817A1/en active Pending
- 2021-10-15 EP EP21881235.2A patent/EP4228682A4/en active Pending
- 2021-10-15 IL IL302148A patent/IL302148A/en unknown
- 2021-10-15 JP JP2023523050A patent/JP2023545517A/ja active Pending
- 2021-10-15 AU AU2021361993A patent/AU2021361993A1/en active Pending
- 2021-10-18 TW TW110138533A patent/TWI907544B/zh active
-
2023
- 2023-04-14 US US18/300,981 patent/US12611458B2/en active Active
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160272728A1 (en) * | 2013-03-19 | 2016-09-22 | Kazusa Dna Research Institute | ANTI-DOG IgE MONOCLONAL ANTIBODY, AND LIGHT-CHAIN VARIABLE REGION AND HEAVY-CHAIN VARIABLE REGION OF ANTI-DOG IgE MONOCLONAL ANTIBODY |
| US20170166634A1 (en) * | 2014-05-02 | 2017-06-15 | Medimmune Limited | Ion channel modulators and uses thereof |
| US20190112610A1 (en) * | 2016-03-31 | 2019-04-18 | The Schepens Eye Research Institute, Inc. | Endomucin Inhibitor as an Anti-Angiogenic Agent |
| US20200316120A1 (en) * | 2018-09-28 | 2020-10-08 | Immpact-Bio Ltd. | METHODS FOR IDENTIFYING ACTIVATING ANTIGEN RECEPTOR (aCAR)/INHIBITORY CHIMERIC ANTIGEN RECEPTOR (iCAR) PAIRS FOR USE IN CANCER THERAPIES |
| WO2021168298A1 (en) * | 2020-02-20 | 2021-08-26 | Senti Biosciences, Inc. | Inhibitory chimeric receptor architectures |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4228682A4 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023205739A3 (en) * | 2022-04-20 | 2024-01-04 | Senti Biosciences, Inc. | Antigen-binding domains and methods of use thereof |
| EP4511403A4 (en) * | 2022-04-20 | 2026-04-15 | Senti Biosciences Inc | DOMAINS OF BINDING TO AN ANTIGEN AND THEIR METHODS OF USE |
| WO2025085867A1 (en) * | 2023-10-20 | 2025-04-24 | A2 Biotherapeutics, Inc. | Compositions and methods for treating blood cancers |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20230109138A (ko) | 2023-07-19 |
| TWI907544B (zh) | 2025-12-11 |
| EP4228682A1 (en) | 2023-08-23 |
| AU2021361993A9 (en) | 2024-06-20 |
| IL302148A (en) | 2023-06-01 |
| US20230372486A1 (en) | 2023-11-23 |
| WO2022082059A8 (en) | 2023-04-06 |
| AU2021361993A1 (en) | 2023-06-15 |
| EP4228682A4 (en) | 2024-11-13 |
| TW202222843A (zh) | 2022-06-16 |
| CA3195817A1 (en) | 2022-04-21 |
| JP2023545517A (ja) | 2023-10-30 |
| US12611458B2 (en) | 2026-04-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12005081B2 (en) | Chimeric receptors and methods of use thereof | |
| US20240173410A1 (en) | Chimeric receptors and methods of use thereof | |
| US12611458B2 (en) | Chimeric receptors and methods of use thereof | |
| AU2021386746A9 (en) | Chimeric receptors and methods of use thereof | |
| AU2023375543A1 (en) | Antigen-binding domains and methods of use thereof | |
| US20250032548A1 (en) | Antigen-binding domains and methods of use thereof | |
| CN116635423A (zh) | 嵌合受体及其使用方法 | |
| CN117529498A (zh) | 嵌合受体及其使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21881235 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3195817 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023523050 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021881235 Country of ref document: EP Effective date: 20230516 |
|
| ENP | Entry into the national phase |
Ref document number: 2021361993 Country of ref document: AU Date of ref document: 20211015 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180084959.6 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523440364 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523440364 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523440364 Country of ref document: SA |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 302148 Country of ref document: IL |
|
| WWR | Wipo information: refused in national office |
Ref document number: 523440364 Country of ref document: SA |