WO2022053839A1 - Single domain antibodies that target sars-cov-2 - Google Patents

Single domain antibodies that target sars-cov-2 Download PDF

Info

Publication number
WO2022053839A1
WO2022053839A1 PCT/GB2021/052383 GB2021052383W WO2022053839A1 WO 2022053839 A1 WO2022053839 A1 WO 2022053839A1 GB 2021052383 W GB2021052383 W GB 2021052383W WO 2022053839 A1 WO2022053839 A1 WO 2022053839A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cdr3
single domain
cdr2
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2021/052383
Other languages
English (en)
French (fr)
Inventor
Jiangdong HUO
Raymond Owens
James Naismith
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Oxford
Oxford University Innovation Ltd
Rosalind Franklin Institute
Original Assignee
University of Oxford
Oxford University Innovation Ltd
Rosalind Franklin Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GBGB2014451.5A external-priority patent/GB202014451D0/en
Priority claimed from GBGB2014453.1A external-priority patent/GB202014453D0/en
Priority claimed from GBGB2108319.1A external-priority patent/GB202108319D0/en
Priority to US18/044,897 priority Critical patent/US20230374116A1/en
Priority to KR1020237012502A priority patent/KR20240102916A/ko
Priority to CA3192456A priority patent/CA3192456A1/en
Priority to EP21778541.9A priority patent/EP4211157A1/en
Priority to CN202180076660.6A priority patent/CN117042799A/zh
Application filed by University of Oxford, Oxford University Innovation Ltd, Rosalind Franklin Institute filed Critical University of Oxford
Priority to AU2021339978A priority patent/AU2021339978A1/en
Priority to JP2023516720A priority patent/JP2023542107A/ja
Publication of WO2022053839A1 publication Critical patent/WO2022053839A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/102Coronaviridae (F)
    • C07K16/104Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983Viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08RNA viruses
    • G01N2333/165Coronaviridae, e.g. avian infectious bronchitis virus

Definitions

  • the invention provides improved single domain antibodies that target SARS-CoV-2, multivalent polypeptides and fusion proteins comprising the single domain antibodies, the use of said single domain antibodies, multivalent polypeptides and fusion proteins in treating and/or preventing coronavirus, as well as the use of said single domain antibodies, multivalent polypeptides and fusion proteins in the detection and diagnosis of coronavirus using various methods, assays and kits.
  • the present invention also provides coronavirus binding molecules that bind two different epitopes on the receptor binding domain of a spike protein of a coronavirus, the use of said coronavirus binding molecules in treating and/or preventing coronavirus, as well as the use of said coronavirus binding molecules in the detection and diagnosis of coronavirus using various methods, assays and kits.
  • the coronavirus binding molecules are based on joining two antigen binding molecules together via a linker.
  • VHHs Very Heavy-chain domains of Heavy-chain antibodies
  • Single-domain antibodies can be manufactured with lower costs using microbial systems.
  • Their small molecular size and stability also means that nanobodies could be formulated for topical delivery directly to the airways of infected patients.
  • the potential of single-domain antibodies as inhibitors of SARS-CoV-2 infection has recently been demonstrated in cell-based assays (Huo, Le Bas et al. 2020, Wrapp, De Vlieger et al.2020).
  • COVID-19 the disease caused by SARS-CoV-2, is a major global health problem and therefore a critical need for effective treatments exists. Further, suitable tools for the rapid and efficient detection of SARS-CoV-2 are required to enable accurate diagnosis and monitoring of the virus.
  • the present invention describes the isolation of single-domain antibodies that bind different epitopes on the receptor-binding domain of SARS-CoV-2 with high affinity and are highly potent in wild-type virus neutralization assays.
  • the present invention provides coronavirus bidentate molecules that bind to two different epitopes on the receptor-binding domain of a coronavirus spike protein with high affinity. These demonstrate a surprisingly enhanced binding affinity over the separate components. Summary of the Invention The present invention provides single domain antibodies that specifically bind to the receptor biding domain of the S-protein of SARS-CoV-2.
  • a single domain antibody comprising a complementary determining region, complementary determining region 3 (CDR3), is provided.
  • CDR3 complementary determining region 3
  • a single domain antibody comprising a CDR2 and a CDR3 is provided.
  • a single domain antibody comprising a CDR1, a CDR2 and a CDR3 is provided.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 213, 18, 16, 17, 20, 209, 211, 215, 217, 219, 220 and 239 is provided.
  • the present invention provides coronavirus binding molecules that bind two different epitopes on the receptor binding domain of the spike protein of a coronavirus, preferably a SARS-CoV-2 spike protein.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that binds to all or part of a first epitope comprised within a coronavirus protein; (b) a second antigen binding molecule that binds to all or part of a second epitope comprised within a coronavirus protein; and (c) a linker, wherein the linker comprises: (a) a ubiquitin or a ubiquitin-like protein; (b) a further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (c) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-
  • the coronavirus protein is the Spike Protein, optionally the Receptor Binding Domain (RBD) of the Spike Protein.
  • the coronavirus can be a coronavirus selected from the group consisting of SARS-CoV-1, SARS-CoV-2 and MERS, preferably SARS-CoV-2.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that binds to all or part of a first epitope comprised within SEQ ID NO: 232; (b) a second antigen binding molecule that binds to all or part of a second epitope comprised within SEQ ID NO: 233; and (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non-overlapping.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that competes with C5, H3, H11-D4, H11-H4, H11- A10, H11-B5, H11-H6 or VHH_H6 for binding to the SARS-CoV-2 receptor-binding domain; (b) a second antigen binding molecule that competes with A8, CR3022, VHH72 or EY6A, F2, C1 or B12 for binding to the SARS-CoV-2 receptor-binding domain; and (c) a linker, wherein the linker comprises: (a) a ubiquitin or a ubiquitin-like protein; (b) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (c) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker comprises: (a
  • a polynucleotide sequence is provided encoding a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention.
  • a multivalent polypeptide comprising one or optionally two or more of the single domain antibodies of the invention is provided.
  • an affinity matured mutant of a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention is provided.
  • a method for producing a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention is provided.
  • a pharmaceutical composition comprising a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention is provided.
  • a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention or a pharmaceutical composition of the invention for use in medicine is provided.
  • a method for the treatment of a coronavirus in a subject comprising administering to a subject a therapeutically active amount of a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention.
  • the use of a single domain antibody, multivalent polypeptide or coronavirus binding molecule of the invention in the manufacture of a medicament for use in the treatment and/or prevention of a coronavirus is provided.
  • methods for the detection of a coronavirus protein are provided.
  • Figure 1 Crystal structure of: (a) RBD bound to C5 (solved by molecular replacement using PDB id 6YZ5 as the search model); (b) RBD bound to F2. Contrasting (a) with (b) shows the binding location of F2 on RBD (b) to be distinct from that of C5 (a).
  • Figure 2. Electron microscopy structure showing three C5 bound each to one RBD of the S1 trimer complex.
  • Figure 3 Crystal structures of: (a) RBD bound to C5.
  • the C terminus of C1 is shown with a dark grey sphere and the N terminus of H3 with a light grey sphere.
  • the distance between the C terminus of C1 (dark grey sphere) and the N terminus of H3 (light grey sphere) is 63 ⁇ .
  • Figure 5. Composite crystal structure of: (a) RBD bound to C1 and C5, constructed by superimposing the RBD portions of C1-RBD-H3 ( Figure 4), C1-RBD and C5-RBD ( Figure 3a).
  • the C terminus of C1 is shown with a dark grey sphere and the N terminus of C5 with a light grey sphere.
  • Antibody refers to an immunogenic protein that recognizes a specific antigen. Each antibody has an antigen binding site that specifically binds an antigen. Antibodies can be natural or partly or wholly synthetic. The term antibody also encompasses any polypeptide or protein having an antigen binding site which is, or is homologous to, an antigen binding site of an antibody. Antibodies may be polyclonal or monoclonal. Traditional antibodies comprise two identical heavy chains and two identical light chains, each chain comprising a variable region and a constant region. Each of the variable regions of the heavy and light chains comprise three complementarity determining regions (CDRs), CDR1, CDR2 and CDR3.
  • CDRs complementarity determining regions
  • Antibody as used herein also encompasses antibody fragments comprising an antigen binding domain, such as Fab, F(ab')2, Fv, scFv, dAb, Fd; and diabodies.
  • “Bidentate” as used herein refers to a polypeptide comprising two different single domain antibodies, i.e. two single domain antibodies having two different antigen binding sites. Preferably, the bidentate molecule is designed such that two different single domain antibodies bind two different epitopes on the same antigen.
  • “Monomer” as used herein refers to one single unit, for example a single domain antibody (either a known single domain antibody or a single domain antibody of the invention), fusion protein or antibody.
  • Polymer refers to molecule comprised of multiple monomers covalently and/or non-covalently bound together.
  • a single domain antibody of the invention can be covalently linked to one or more additional single domain antibodies, such as the single domain antibodies of the invention, within a single polypeptide chain.
  • a single gene can encode multiple linked single domain antibodies.
  • a polymer can be formed by linking two or more separate synthesised single domain antibodies with a covalent linkage and/or non-covalent linkages.
  • a synthesised single domain antibody fused to a Fc molecule can covalently link to a separate synthesised single domain antibody fused to a Fc molecules through the formation of disulphide bridges between the Fc molecules.
  • Single domain antibodies of the invention can also be non-covalently linked to other single domain antibodies (for example those of the invention) exclusively via non-covalent linkage, for example through the use of a dimerization or trimersation domain. An example of this would be fusing the single chain antibody to a collagen derived trimerisation domain .
  • a “Dimer” as used herein refers to two monomers covalently or non-covalently bound together.
  • a “homodimer” is formed of two identical monomers.
  • a “heterodimer” is formed of two different monomers.
  • a “trimer” as used herein refers to three monomers covalently or non-covalently bound together.
  • “Dimerization domain” or “trimerization domain” as used herein refers to a sequence protein or motif that permits dimerization, or trimerization respectively, between single domain antibodies. The sequence protein or motif can be fused to the single domain antibody. For example, fusing a single domain antibody sequence to a collagen-derived trimerisation domain yields a gene product which codes for polypeptide chain with a single antibody sequence, however, when the protein is synthesised, the actual product is a trimer ( Compte et al).
  • “Monospecific” as used herein refers to a polypeptide having antigen binding sites that all bind to the same epitope. “Multispecific” as used herein refers to the number of different antigen biding site specificities present. For example, a “bispecific” polypeptide has antigen binding sites that bind to two different epitopes (either on the same or on different antigens), a “trispecific” polypeptide has antigen binding sites that bind to three different epitopes (either on the same or on different antigens), a “tetraspecific” polypeptide has antigen binding sites that bind to four different epitopes (either on the same or on different antigens).
  • “Monovalent” as used herein refers to a single domain antibody having one antigen binding site. “Multivalent” as used herein refers to a polypeptide that has multiple antigen binding sites. The term multivalent is interchangeable for the term “polyvalent”. For example, “bivalent” as used herein refers to a polypeptide that has two antigen binding sites, “trivalent” as used herein refers to a polypeptide that has three antigen binding sites and “tetravalent” as used herein refers to a polypeptide that has four antigen binding sites.
  • a multivalent antibody can be monospecific, bispecific, trispecific, tetraspecific or multispecific, as defined herein.
  • a “monospecific multivalent” polypeptide has multiple antigen binding sites that all bind to the same epitope.
  • a “bispecific multivalent” polypeptide has multiple antigen binding sites, a number of the antigen binding sites bind to a first epitope and a number of the antigen binding sites bind to a second epitope (that is different to the first epitope).
  • Constant substitution refers to amino acid substitutions that do not materially affect the function of a protein (for example the ability to bind to a specific target, in particular the coronavirus spike protein of SARS-CoV-2 in the context of the invention, or the ability to elicit an immune response in a subject).
  • “Deletion” as used herein refers to the removal of an amino acid in a polypeptide sequence (i.e. the replacement of one amino acid with no amino acid such that the amino acid sequence is one amino acid shorter in length). Deletion can also refer to polynucleotide sequences and the removal of one nucleic acid from a polynucleotide sequence (the replacement of one nucleic acid with no nucleic acid such that the polynucleotide sequence is one nucleic acid shorter in length).
  • Identity is the degree to which two sequences are related, as determined by comparing two or more polypeptide of polynucleotide sequences. Identity can be determined using the degree of relatedness of two sequences to provide a measurement of to what extent the two sequences match. Numerous programs are well known by the skilled person for comparing polypeptide or polynucleotide sequences, for example (but not limited to the various BLAST and CLUSTAL programs. Percentage identity can be used to quantify sequence identity. To calculate percentage identity, two sequences (polypeptide or nucleotide) are optimally aligned (i.e.
  • amino acid or nucleic acid residue at each position is compared with the corresponding amino acid or nucleic acid at that position.
  • optimal sequence alignment can be achieved by inserting space(s) in a sequence to best fit it to a second sequence.
  • the number of identical amino acid residues or nucleotides provides the percentage identity, i.e. if 9 residues of a 10 residue long sequence are identical between the two sequences being compared then the % identity is 90%. Percentage identity is generally calculated along the full length of the two sequences being compared. “Insertion” refers the addition of an amino acid in a polypeptide sequence (i.e.
  • Insertion can also refer to polynucleotide sequences and the addition of one nucleic acid to a polynucleotide sequence (i.e. insertion of one nucleic acid means one new nucleic acid is added into in an existing polynucleotide sequence such that the nucleic acid sequence is one amino acid longer in length).
  • “Modification” as used herein refers to an alteration of an amino acid residue in a polypeptide sequence. The modification can be a substitution, deletion or insertion, as defined herein. Modification can also refer to polynucleotide sequences.
  • Single domain antibody refers to a variable region of a heavy chain of an antibody, wherein the variable region is derived from a heavy chain only (i.e. devoid of a light chain) subset of camelid immunoglobulins.
  • the term single domain antibody can be used interchangeably with (variable domain of camelid heavy-chain-only antibody, VHH) and Nanobody®.
  • a single domain antibody is used to refer to a single heavy chain variable region that can bind the spike protein of a coronavirus, preferably SAR- CoV-2.
  • the antibody can be affinity matured, humanized or modified, as described herein. This single domain antibody can be conjugated to other components.
  • substitution refers the replacement of amino acid with a different amino acid. Substitution can also refer to polynucleotide sequences, i.e. the replacement of one nucleic acid with a different nucleic acid. A substitution can be a conservative substitution, as defined above. “Tetravalent” as used herein refers to a polypeptide that has four antigen binding sites.
  • the single domain antibodies of the invention are based on 12 VHH sequences having positive binding to the receptor binding domain (“RBD”) of the S protein of SARS-CoV-2, namely B12, F2, C1, C5 H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G1, 12_F11 and VH_H6 (amino acid sequences provided as SEQ ID NOs: 16-20, 209-220 and 239), polynucleotide sequences provided as SEQ ID NOs: 21-25, 208-218 and 238 respectively).
  • Specific amino acid sequences are provided herein to define the amino acid sequences of specified CDRs. For convenience, these are listed in the table below.
  • Single domain antibodies of the invention comprising these specified CDR sequences can comprise one or more modifications, as detailed herein, and will retain binding affinity for a coronavirus peptide, preferably the receptor binding domain of the S protein of SARS-CoV-2.
  • CDR alignments of nanobodies Amino acid and nucleotide sequences of B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 and VHH_H6 (CDR highlighted in bold) > B12 (SEQ ID NO: 21) CAGGTGCAGCTGGTGGAGTCTGGAGGAGGCTTCGTGCAGCCTGGGGGCTCTCTGAGACTCTCCTGCGCCGTTTCT GGAGGCACCTTCAGTACCTATGGCATGGGCTGGTTCCGCCAGGCTCCAGGGAAGGAGCGTGAGATTGTAGCAGCG ATTAGACGGAGTGGTAGCACATACTATGCAGACTCCGTGAGGGGCCGATTCACCATCTCCAGACAAC
  • a single domain antibody comprises a complementary determining region selected from CDR1, complementary determining region 2 (CDR2) or complementary determining region 3 (CDR3) is provided. In one embodiment, a single domain antibody comprises at least one complementary determining region selected from CDR1, CDR2 or CDR3 is provided. In one embodiment, a single domain antibody comprises at least two complementary determining regions selected from CDR1, CDR2 or CDR3. In one embodiment, single domain antibody comprises three complementary determining regions: CDR1, CDR2, and CDR3 is provided.
  • a single domain antibody comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 198, 9, 3, 6, 15, 192, 195, 201, 204, 207 and 237 is provided, wherein the amino acid sequences of CDR3 comprise between 0 and 7 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 and 0 and 1 amino acid modifications.
  • the modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions.
  • a single domain antibody comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 9, 3, 6 and 15 is provided, wherein the CDR3 regions of amino acid sequences of SEQ ID NOs: 6, 9 and 15 comprise between 0 and 7 amino acid modifications, optionally between 0 and 2 modifications; and wherein the CDR3 regions of amino acid sequences of SEQ ID Nos: 3 and 12 comprise between 0 and 5 amino acid modifications, optionally between 0 and 2 amino acid modifications.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 3.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 6.
  • the complementary determining region 3 is SEQ ID NO: 15. In a preferred embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 12 or 198. In a most preferred embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 12. In one embodiment the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications. The modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions. In one embodiment the single domain antibody of the invention may further comprise a CDR2 region. The CDR2 region may be defined according to a SEQ ID NO disclosed herein.
  • the single domain antibody of the invention may further comprise a CDR1 region and CDR2 region.
  • the CDR1 region and the CDR2 region may be defined according to a SEQ ID NO disclosed herein.
  • the single domain antibody may further comprise four framework regions (FR1, FR2, FR3 and FR4).
  • an anti-SARS-CoV-2 single domain antibody comprising (a) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (b) a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; (c) a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9; (d) a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3; (e) a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6; (f) a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (g) a CDR2 comprising SEQ ID NO:191 and a CDR3 comprising SEQ ID NO:192; (h) a CDR2 comprising SEQ ID NO:15; (g) a
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications. In one embodiment the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • an anti-SARS-CoV-2 single domain antibody is provided, wherein the single antibody domain comprises a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • an anti-SARS- CoV-2 single domain antibody comprising a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the single domain antibody of the invention may further comprise a CDR1 region.
  • the CDR1 region may be defined according to a SEQ ID NO disclosed herein.
  • the single domain antibody may further comprise four framework regions (FR1, FR2, FR3 and FR4).
  • an anti-SARS-CoV-2 single domain antibody comprises (a) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (b) a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; (c) a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9; (d) CDR1 comprising SEQ ID NO:1, a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3; (e) a CDR1 comprising SEQ ID NO:4, a CDR2 comprising SEQ ID NO:
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the CDR1 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • an anti-SARS-CoV-2 single domain antibody comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • an anti-SARS-CoV-2 single domain antibody comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the single chain antibody or antigen binding molecule comprises four framework regions.
  • the framework regions separate the CDR sequences.
  • the four framework regions are framework region 1 (FR1), framework region 2 (FR2), framework region 3 (FR3) and framework region 4 (FR4) and are interspersed between the CDR1, CDR2 and CDR3 (i.e FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4).
  • the single domain antibody or antigen binding molecule of the invention comprises or essentially consists of four framework regions (FR1, FR2, FR3 and FR4) and three CDRs (CDR1, CDR2 and CDR3).
  • the single domain antibody or antigen binding molecule of the invention consists of four framework regions (FR1, FR2, FR3 and FR4) and three CDRs (CDR1, CDR2 and CDR3).
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 213, 18, 16, 17, 20, 209, 211, 215, 217, 219, 220 and 239 is provided.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 18, 16, 17 and 20 is provided.
  • each of these sequences comprises three CDR regions (CDR1, CDR2 and CDR3) and four framework regions (FR1, FR2, FR3 and FR4).
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 213, 18, 16, 17, 20, 209, 211, 215, 217, 219, 220 and 239.
  • an anti-SARS-CoV-2 single domain antibody comprising a sequence selected from the group consisting of SEQ ID NO: 19, 213, 18, 16, 17, 20, 209, 211, 215, 217, 219,220 and 239 is provided. In one embodiment, an anti-SARS-CoV-2 single domain antibody comprising a sequence selected from the group consisting of SEQ ID NO: 19, 18, 16, 17 and 20 is provided. In one embodiment, an anti-SARS- CoV-2 single domain antibody consisting or essentially consisting a sequence selected from the group consisting of SEQ ID NO: 19, 213, 18, 16, 17, 20, 209, 211, 215, 217, 219, 220 and 239 is provided.
  • an anti-SARS-CoV-2 single domain antibody consisting or essentially consisting a sequence selected from the group consisting of SEQ ID NO: 19, 18, 16, 17 and 20 is provided. At least herein and throughout means, in some embodiments, the recited percentage up to 100%. For example, at least 75% can mean, in some embodiments, 75% to 100%. In one embodiment, an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 16 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 16.
  • the amino acid sequence is SEQ ID NO: 16.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 17 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 17.
  • the amino acid sequence is SEQ ID NO: 17.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 18 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 18.
  • the amino acid sequence is SEQ ID NO: 18.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 19 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 19.
  • the amino acid sequence is SEQ ID NO: 19.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 20 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 20.
  • the amino acid sequence is SEQ ID NO: 20.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 209 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 209.
  • the amino acid sequence is SEQ ID NO: 209.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 211 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 211.
  • the amino acid sequence is SEQ ID NO: 211.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 213 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 213.
  • the amino acid sequence is SEQ ID NO: 213.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 215 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 215.
  • the amino acid sequence is SEQ ID NO: 215.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 217 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 217.
  • the amino acid sequence is SEQ ID NO: 217.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 219 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 219.
  • the amino acid sequence is SEQ ID NO: 219.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 220 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 220.
  • the amino acid sequence is SEQ ID NO: 220.
  • an anti-SARS-CoV-2 single domain antibody comprising an amino acid sequence having at least 70% identity to SEQ ID NOs: 239 is provided.
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 239.
  • the amino acid sequence is SEQ ID NO: 239.
  • a polynucleotide sequence is provided encoding a single domain antibody of the invention.
  • the polynucleotide is DNA or RNA.
  • an anti-SARS-CoV-2 single domain antibody comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 24, 212, 23, 21, 22, 25, 208, 210, 214, 216, 218 and 238 is provided. In one embodiment, an anti-SARS-CoV-2 single domain antibody comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 24, 23, 21, 22 and 25 is provided.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity to a sequence selected from the group consisting of: SEQ ID NO: 24, 23, 21, 22, 25, 208, 210, 212, 214, 216, 218 and 238.
  • an anti-SARS-CoV-2 single domain antibody comprises a sequence selected from the group consisting of SEQ ID NO: 24, 23, 21, 22 and 25 is provided.
  • an anti-SARS-CoV-2 single domain antibody comprises a sequence selected from the group consisting of SEQ ID NO: 24, 23, 21, 22, 25, 208, 210, 212, 214, 216, 218 and 238 is provided. In one embodiment, an anti-SARS- CoV-2 single domain antibody consisting or essentially consisting of SEQ ID NO: 24, 23, 21, 22 and 25 is provided. In one embodiment, an anti-SARS-CoV-2 single domain antibody consisting or essentially consisting of SEQ ID NO: 24, 23, 21, 22, 25, 208, 210, 212, 214, 216, 218 and 238 is provided.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 21.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 21.
  • the polynucleotide sequence is SEQ ID NO: 21.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 22 is provided.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 22.
  • the polynucleotide sequence is SEQ ID NO: 22.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 23.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 23.
  • the polynucleotide sequence is SEQ ID NO: 23.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 24 is provide.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 24.
  • the polynucleotide sequence is SEQ ID NO: 24.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 25 is provided.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 25.
  • the polynucleotide sequence is SEQ ID NO: 25.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 208.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 208.
  • the polynucleotide sequence is SEQ ID NO: 208.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 210.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 210.
  • the polynucleotide sequence is SEQ ID NO: 210.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 212.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 212.
  • the polynucleotide sequence is SEQ ID NO: 212.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 214.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 214.
  • the polynucleotide sequence is SEQ ID NO: 214.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 216.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 216.
  • the polynucleotide sequence is SEQ ID NO: 216.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 218.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 218.
  • the polynucleotide sequence is SEQ ID NO: 218.
  • an anti-SARS-CoV-2 single domain antibody comprising a polynucleotide sequence having at least 70% identity to SEQ ID NOs: 238.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity SEQ ID NO: 238.
  • the polynucleotide sequence is SEQ ID NO: 238.
  • the present invention provides coronavirus binding molecules that bind two different epitopes on the receptor binding domain of the spike protein of a coronavirus, preferably a SARS-CoV-2 spike protein.
  • the coronavirus binding molecules are based on joining two antigen binding molecules together via a linker.
  • the linker comprises a protein from the ubiquitin-like protein superfamily, either ubiquitin (Ub) itself or a ubiquitin-like protein (ULP).
  • the linker optionally further comprises a spacer comprising 4 to 50 amino acid residues at the n-terminal of the ubiquitin (Ub) or ubiquitin-like protein and optionally a spacer comprising 4 to 50 amino acid residues at the c-terminal of the ubiquitin (Ub) or a ubiquitin-like protein.
  • the antigen binding molecules target two different epitopes on the receptor binding domain of the spike protein of a coronavirus, preferably a SARS-CoV-2 spike protein.
  • the first antigen binding molecule binds to all or a part of a first epitope comprised within SEQ ID NO: 232.
  • the second antigen binding molecule binds to all or a part of a first epitope comprised within SEQ ID NO: 233.
  • the coronavirus binding molecules are made according to the following general design: N’- ABM(1) – SPACER 1 – LINKER – SPACER 2 - ABM(2) - C’ ABM(1) – Antigen binding molecule targeting epitope 1 ABM(2) - Antigen binding molecule targeting epitope 2 LINKER- ubiquitin or a ubiquitin-like protein SPACER 1 (optional) - 5-50 amino acids SPACER 2 (optional) - 5-50 amino acids
  • the coronavirus binding molecule can be ordered such that the first antigen binding molecule is positioned at, or nearest, the n-terminal end of the coronavirus binding molecule and the second antigen binding molecule is positioned at, or nearest, the c-terminal end of the coronavirus binding molecule.
  • the coronavirus binding molecule can be ordered such that the second antigen binding molecule is positioned at, or nearest, the n-terminal end of the coronavirus binding molecule and the first antigen binding molecule is positioned at, or nearest, the c-terminal end of the coronavirus binding molecule, for example: N’- ABM(1) – SPACER 1 – LINKER – SPACER 2 - ABM(2) - C’ N’- ABM(2) – SPACER 1 – LINKER – SPACER 2 - ABM(1) - C’
  • the coronavirus binding molecules of the invention comprise first and second antigen binding molecules.
  • an antigen binding molecule as used herein can be an antibody or fragment thereof, a single domain antibody or fragment thereof.
  • the first antigen binding molecule is an antibody, or fragment or variant thereof.
  • the first antigen binding molecule is a single-chain variable fragment (scFv).
  • the second antigen binding molecule is an antibody, or fragment or variant thereof.
  • the second antigen binding molecule is a single-chain variable fragment (scFv).
  • the first antigen binding molecule is a single domain antibody.
  • the second antigen binding molecule is a single domain antibody.
  • the first antigen binding molecule and the second antigen binding molecules are single domain antibodies.
  • the first and second antigen binding molecules bind to all or part of a first and second epitope, respectively, wherein the first and second epitopes are substantially non-overlapping.
  • the first and second epitopes are both located on the receptor binding domain (RBD) of the spike of a coronavirus, preferably SARS-CoV-2.
  • RBD receptor binding domain
  • the coronavirus binding molecules of the invention comprising two antigen binding molecules joined together via a linker are spatially configured such that they can advantageously target two non-overlapping epitopes on the spike protein of a range of coronaviruses, including SARS-CoV-1, SARS-CoV-2 and MERS.
  • the coronavirus binding molecules of the invention may target more than one type of coronavirus, thereby providing a pan-coronavirus binding molecule.
  • the coronavirus binding molecules of the invention may bind to both a first and second epitope on SARS-CoV- 1 and also bind to the corresponding first and second epitope on SARS-CoV-2.
  • the first antigen binding molecule binds to all or part of a first epitope located on the receptor binding domain (RBD) of the spike protein of a coronavirus.
  • the coronavirus can be a coronavirus selected from the group consisting of SARS-CoV-1, SARS- CoV-2 and MERS, preferably SARS-CoV-2, most preferably human SARS-CoV-2.
  • the first antigen binding molecule binds to all or part of a first epitope located on the receptor binding domain (RBD) of Spike of SARS-CoV-1.
  • the first antigen binding molecule binds to all or part of a first epitope located on the receptor binding domain (RBD) of Spike of SARS-CoV-2.
  • Epitope 1 comprises the surface of the RBD that binds to the ACE2 receptor.
  • Antigen binding molecules binding to this epitope therefore directly block the receptor binding domain of the coronavirus binding to human ACE2 protein.
  • This epitope is targeted by single domain antibodies C5, H11-H4, H11-D4, H3, H11-A10, H11- B5, H11-H6 and VHH_H6 as described herein.
  • Spike glycoprotein (UniProt, https://www.uniprot.org/uniprot/P59594) (SEQ ID NO: 231) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAI HVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC NDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIY SKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQP RTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTS
  • the coronavirus can be a coronavirus selected from the group consisting of SARS-CoV-1, SARS-CoV-2 and MERS, preferably SARS-CoV-2, most preferably human SARS-CoV-2.
  • the second antigen binding molecule binds to all or part of a first epitope located on the receptor binding domain (RBD) of Spike of SARS-CoV-1.
  • the second antigen binding molecule binds to all or part of a second epitope located on the receptor binding domain (RBD) of Spike of SARS-CoV-2.
  • Epitope 2 is located remotely to the ACE2 binding site (i.e.
  • Spike glycoprotein (UniProt, https://www.uniprot.org/uniprot/P59594)(SEQ ID NO: 231) MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAI HVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFC NDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIY SKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
  • the coronavirus protein is the Spike Protein, optionally the Receptor Binding Domain (RBD) of the Spike Protein.
  • the coronavirus can be a coronavirus selected from the group consisting of SARS-CoV-1, SARS-CoV-2 and MERS, preferably SARS-CoV-2.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that binds to all or part of a first epitope comprised within SEQ ID NO: 232; (b) a second antigen binding molecule that binds to all or part of a second epitope comprised within SEQ ID NO: 233; and (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non-overlapping.
  • the coronavirus protein is the Spike Protein, optionally the Receptor Binding Domain (RBD) of the Spike Protein.
  • the coronavirus can be a coronavirus selected from the group consisting of SARS-CoV-1, SARS-CoV-2 and MERS, preferably SARS-CoV- 2.
  • the antigen binding molecules bind to either all or part of their target epitopes.
  • the first antigen binding molecule is selected from the group consisting of C5, H4, H3, D4, A10, B5 and H6.
  • the second antigen binding molecule is selected from the group consisting of C1, B12, F2, Vhh72, CR3022, EY6A.
  • the second antigen binding molecule is located remotely that of epitope 1
  • the coronavirus binding molecule further comprises a third and optionally a fourth or fifth antigen binding molecule that binds to all or part of a third, fourth or fifth epitope comprised within the coronavirus protein, optionally a SARS-CoV-2 protein, optionally wherein the third, fourth or fifth antigen binding molecules are linked to the first and second antigen binding molecules via one of more linkers and the linkage is either directly to the first or the second antigen binding molecules or to the ubiquitin or a ubiquitin- like protein or one of the further optional spacers.
  • the first antigen binding molecule binds to at least 10 amino acids selected from the group consisting of residues 346, 403, 444, 446, 447, 449, 450, 452, 453, 455, 456, 470, 472, 482, 483, 484, 485, 486, 488, 489, 490, 492, 493, 494, 495, 496, 498, 500, 501 and 505 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the first antigen binding molecule binds to at least 20 amino acids selected from the group consisting of residues 346, 403, 444, 446, 447, 449, 450, 452, 453, 455, 456, 470, 472, 482, 483, 484, 485, 486, 488, 489, 490, 492, 493, 494, 495, 496, 498, 500, 501 and 505 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the first antigen binding molecule binds to at least 25 amino acids selected from the group consisting of residues 346, 403, 444, 446, 447, 449, 450, 452, 453, 455, 456, 470, 472, 482, 483, 484, 485, 486, 488, 489, 490, 492, 493, 494, 495, 496, 498, 500, 501 and 505 of the Spike glycoprotein of SARS-CoV- 2 (SEQ ID NO: 231).
  • the first antigen binding molecule binds to at least 26, 27, 28 or 29 amino acids selected from the group consisting of residues 346, 403, 444, 446, 447, 449, 450, 452, 453, 455, 456, 470, 472, 482, 483, 484, 485, 486, 488, 489, 490, 492, 493, 494, 495, 496, 498, 500, 501 and 505 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the first antigen binding molecule binds to residues 346, 403, 444, 446, 447, 449, 450, 452, 453, 455, 456, 470, 472, 482, 483, 484, 485, 486, 488, 489, 490, 492, 493, 494, 495, 496, 498, 500, 501 and 505 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the second antigen binding molecule binds to at least 10 amino acids selected from the group consisting of residues 368, 369, 370, 371, 372, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 388, 389, 390, 392, 408, 411, 412, 413, 414, 427, 428, 429, 430, 515, 516, 517, 518 and 519 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the second antigen binding molecule binds to at least 20 amino acids selected from the group consisting of residues 368, 369, 370, 371, 372, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 388, 389, 390, 392, 408, 411, 412, 413, 414, 427, 428, 429, 430, 515, 516, 517, 518 and 519 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the second antigen binding molecule binds to at least 30 amino acids selected from the group consisting of residues 368, 369, 370, 371, 372, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 388, 389, 390, 392, 408, 411, 412, 413, 414, 427, 428, 429, 430, 515, 516, 517, 518 and 519 of the Spike glycoprotein of SARS- CoV-2 (SEQ ID NO: 231).
  • the second antigen binding molecule binds to at least 31, 32, 33, 34 or 35 amino acids selected from the group consisting of residues 368, 369, 370, 371, 372, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 388, 389, 390, 392, 408, 411, 412, 413, 414, 427, 428, 429, 430, 515, 516, 517, 518 and 519 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the second antigen binding molecule binds to residues 368, 369, 370, 371, 372, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385, 386, 388, 389, 390, 392, 408, 411, 412, 413, 414, 427, 428, 429, 430, 515, 516, 517, 518 and 519 of the Spike glycoprotein of SARS-CoV-2 (SEQ ID NO: 231).
  • the first antigen binding molecule that binds to all or part of a first epitope comprised within a SARS-CoV-2 protein and the second antigen binding molecule binds to all or part of a second epitope CoV-2 comprised within a coronavirus protein, wherein the first and second epitopes are substantially non-overlapping.
  • the SARS-CoV-2 protein may be the Spike glycoprotein [SEQ ID NO: 231], optionally the Receptor Binding Domain (RBD) on the S1 subunit the Spike Protein.
  • RBD Receptor Binding Domain
  • the linker permits the first and second antigen binding molecules to be positioned in an angular arrangement such that they can bind the first and second epitope respectively.
  • the N’ terminal to C’ terminal distance of the linker is approximately 40 to 70 ⁇ ngströms, optionally 50 to 65 ⁇ ngströms. In one embodiment, the distance is approximately 50 to 55 ⁇ ngströms. In one embodiment, the distance is approximately 55 to 60 ⁇ ngströms. In one embodiment, the distance is approximately 60 to 65 ⁇ ngströms.
  • the specified distance is the span of the linker itself, including any additional spacer(s) if present.
  • the coronavirus binding molecule of the invention use Ubiquitin (Ub) or ubiquitin-like proteins in their natural folded state as a linker, therefore the distances specified herein refer to Ubiquitin (Ub) or ubiquitin-like protein in their natural 3D conformation, having a ubiquitin fold.
  • the coronavirus molecule comprises an optional spacer of 4 to 50 amino acids joined to the n-terminal or c-terminal of the ubiquitin or ubiquitin-like protein, wherein the spacer comprises: a. one or more GlySer repeats; and/or b. one or more polyA stretches.
  • the coronavirus binding molecule further comprises additional antigen binding molecules.
  • the coronavirus binding molecule comprises a third and optionally a fourth or fifth antigen binding molecule that binds to all or part of a third, fourth or fifth epitope comprised within the coronavirus protein, optionally a SARS-CoV-2 protein, optionally wherein the third, fourth or fifth antigen binding molecules are linked to the first and second antigen binding molecules via one of more linkers and the linkage is either directly to the first or the second antigen binding molecules or to the ubiquitin or a ubiquitin-like protein or one of the further optional spacers.
  • the coronavirus protein is the spike protein, optionally the Receptor Binding Domain (RBD) of the Spike Protein.
  • the coronavirus binding molecules of the invention can comprise specific single domain antibodies, as defined herein.
  • the antigen binding molecules forming the bidentate molecules of the present invention may comprise one or more than one of the specific amino acid sequences disclosed herein.
  • the bidentate molecule may be formed by providing a first antigen binding molecule comprising a first amino acid sequence, as specified herein, and a second antigen binding molecules, containing a second amino acid sequence, as specified herein.
  • Antigen binding molecules or single domain antibodies forming the bidentate molecules of the invention can comprise one or more modifications, as detailed herein, and will retain binding affinity for a coronavirus peptide, preferably the receptor binding domain of the S protein of SARS-CoV-2.
  • a coronavirus binding molecule comprising a first antigen binding molecule having an amino acid or polynucleotide sequence based on C5, H3, H11_D4, H11_H4, H11_A10, H11_B5 or VHH_H6 and/or a second antigen binding molecule having an amino acid or polynucleotide sequence based on A8, F2, VHH72, CR3022, EY6A, C1 or B12.
  • the tables below illustrate the various combinations of antigen binding molecules that may form a bidentate polypeptide of the invention.
  • a coronavirus binding molecule comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on C5 and a second single domain antibody having an amino acid or polynucleotide sequence based on A8, F2, VHH72, C1 or B12.
  • a coronavirus binding molecule is provided comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on C5, H3, H11_D4, H11_H4, H11_A10, H11_B5 or VHH_H6 and a second single domain antibody having an amino acid or polynucleotide sequence based on A8.
  • a coronavirus binding molecule comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on C5 and a second single domain antibody having an amino acid or polynucleotide sequence based on A8.
  • the amino acid or polynucleotide sequence can comprise the CDR3, CDR2 and/or CDR1 or a variant thereof of the specified single domain antibodies, comprise the amino acid sequence or a variant thereof of the specified single domain antibodies, or comprise the polynucleotide sequence of variant thereof of the specified single domain antibodies.
  • the first antigen binding molecule of the invention is a single domain antibody comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 or 237 wherein the amino acid sequences comprise between 0 and 7 amino acid modifications, optionally 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 and 0 and 1 amino acid modifications.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 12.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 15.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 72.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 73. In one embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 74. In one embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 75. In one embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 76. In a preferred embodiment, the complementary determining region 3 (CDR3) is SEQ ID NO: 237.
  • the first antigen binding molecule of the invention comprises a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 and 237, wherein the amino acid sequences of SEQ ID NO: comprise between 0 and 7 amino acid modifications, optionally between 0 and 5 or 0 and 2 modifications; and wherein the CDR3 regions of SEQ ID NO: 12 comprises between 0 and 5 amino acid modifications, optionally between 0 and 2 amino acid modifications.
  • CDR3 complementary determining region 3
  • the second antigen binding molecule of the invention is a single domain antibody comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 198, 3, 6 and 9, wherein the amino acid sequences comprise between 0 and 7 amino acid modifications, optionally 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 and 0 and 1 amino acid modifications.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 3.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 6.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 9.
  • the complementary determining region 3 (CDR3) is SEQ ID NO: 198.
  • the second antigen binding molecule of the invention comprises a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 3, 6 and 9, wherein the amino acid sequences of SEQ ID NOs: 6 and 9 comprise between 0 and 7 amino acid modifications, optionally between 0 and 2 modifications; and wherein the CDR3 regions of amino acid sequences of SEQ ID NO: 3 comprises between 0 and 5 amino acid modifications, optionally between 0 and 2 amino acid modifications.
  • the antigen binding molecules of the invention may further comprise a CDR2 region.
  • the CDR2 region may be defined according to a SEQ ID NO disclosed herein.
  • the antigen binding molecule may further comprise four framework regions (FR1, FR2, FR3 and FR4).
  • the first antigen binding molecule comprises (a) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (b) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:15; (c) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (d) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (e) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (f) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:75; (g) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:76; or (h) a CDR2 comprising SEQ ID NO:236 and a CDR3 comprising
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications. In one embodiment the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the second antigen binding molecule comprises (a) a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; (b) a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3; (c) a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6; or (d) a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9; wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the antigen binding molecule of the invention may further comprise a CDR1 region and CDR2 region.
  • the CDR1 region and the CDR2 region may be defined according to a SEQ ID NO disclosed herein.
  • the single domain antibody may further comprise four framework regions (FR1, FR2, FR3 and FR4).
  • the first antigen binding molecule comprises (a) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (b) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (c) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (d) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (e) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (f) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the CDR1 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the second antigen binding molecule comprises (a) CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; (b) CDR1 comprising SEQ ID NO:1, a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3; (b) a CDR1 comprising SEQ ID NO:4, a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6; or (c) a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9; wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the CDR1 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the second antigen binding molecule comprises the known antibody CR3022 or variant or fragment thereof.
  • the known antibody CR3022 may comprise a heavy chain having a sequence selected from SEQ ID NO: 26 or 27 and/or a light chain having a sequence selected from SEQ ID NO: 28 or 29.
  • the second antigen binding molecule comprises the known antibody EY6A or variant or fragment thereof.
  • the known antibody EY6A may comprise a heavy chain having the sequence SEQ ID NO: 30 and/or comprise a light chain having a sequence SEQ ID NO: 31.
  • the second antigen binding molecule comprises the known single domain antibody (nanobody) VHH 72 or variant or fragment thereof.
  • VHH 72 may comprise the sequence SEQ ID NO: 32.
  • the heavy and/or the light chain of the known antibody may comprise one or more additional modifications, for example between 0 and 10, 0 and 9, 0 and 8, 0 and 7, 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that competes with C5, H3, H11-D4, H11-H4, H11- A10, H11-B5, H11-H6 or VHH_H6 for binding to the SARS-CoV-2 receptor-binding domain; (b) a second antigen binding molecule that competes with A8, CR3022, VHH72 or EY6A, F2, C1 or B12 for binding to the SARS-CoV-2 receptor-binding domain; and (c) a linker, wherein the linker comprises: (a) a ubiquitin or a ubiquitin-like protein; (b) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (c) further optional spacer of between 4 and 50 amino acids joined to the
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that competes with C5 for binding to the SARS-CoV- 2 receptor-binding domain; (b) a second antigen binding molecule that competes with CR3022 for binding to the SARS-CoV-2 receptor-binding domain; and (c) a linker, wherein the linker comprises: (a) a ubiquitin or a ubiquitin-like protein; (b) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (c) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non-overlapping.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule that competes with CR3022 for binding to the SARS- CoV-2 receptor-binding domain; (b) a second antigen binding molecule that competes with H11-H4 (SEQ ID NO: 120) for binding to the SARS-CoV-2 receptor-binding domain; and (c) a linker, wherein the linker comprises: (a) a ubiquitin or a ubiquitin-like protein; (b) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (c) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non-overlapping.
  • coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising an amino acid sequence as disclosed herein; (b) a second antigen binding molecule that binds to epitope 2; (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non- overlapping.
  • coronavirus binding molecules comprising: (a) a first antigen binding molecule that binds to epitope 1; (b) a second antigen binding molecule comprising an amino acid sequence as disclosed herein; (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non- overlapping.
  • coronavirus binding molecules comprising: (a) a first antigen binding molecule comprising an amino acid sequence as disclosed herein; (b) a second antigen binding molecule comprising an amino acid sequence as disclosed herein; (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule, and optionally wherein the first and second epitopes are substantially non- overlapping.
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 and 237 wherein the CDR3 comprises between 0 and 7 amino acid modifications; (b) a second antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 198, 3, 6 and 9, wherein the CDR3 comprises between 0 and 7 amino acid modifications; and (c) a linker, wherein the linker comprises: (i) a ubiquitin or a ubiquitin-like protein; (ii) further optional spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (iii) further optional spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iv) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (v) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (vi) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:75; (vii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:76; or (vii)
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iv) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (v) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74;
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 and 237 wherein the CDR3 comprises between 0 and 7 amino acid modifications; (b) a second antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 198, 3, 6 and 9, wherein the CDR3 comprises between 0 and 7 amino acid modifications; and (c) a linker, wherein the linker comprises SUMO; and optionally further comprises a (i) spacer of between 4 and 50 amino acids joined to the n-terminal of the ubiquitin or ubiquitin-like protein; and (ii) spacer of between 4 and 50 amino acids joined to the c-terminal of the ubiquitin or ubiquitin-like protein; and wherein the linker joins the
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73 (iv) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (v) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:75; (vi) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:76; or
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iii) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (iv) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 and 237 wherein the CDR3 comprises between 0 and 7 amino acid modifications; (b) a second antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 198, 3, 6 and 9, wherein the CDR3 comprises between 0 and 7 amino acid modifications; and (c) a linker, wherein the linker comprises SUMO; between 4 and 8 amino acids joined to the n-terminal of SUMO and between 4 and 8 amino acids joined to the c-terminal of SUMO; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule is provided.
  • CDR3 complementary determining region 3
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iv) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (v) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (vi) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:75; (vii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:76; or (viii)
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; or (iv) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (v) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (vi) a
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 12, 15, 72, 73, 74, 75, 76 and 237; (b) a second antigen binding molecule comprising a complementary determining region 3 (CDR3) selected from the group consisting of SEQ ID NOs: 198, 3, 6 and 9; and (c) a linker, wherein the linker comprises SUMO; between 4 and 8 amino acids joined to the n-terminal of SUMO and between 4 and 8 amino acids joined to the c-terminal of SUMO; and wherein the linker joins the first antigen binding molecule to the second antigen binding molecule is provided.
  • CDR3 complementary determining region 3
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iv) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; (v) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (vi) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:75; or (vii) a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:76; (viii)
  • a coronavirus binding molecule comprising: (a) a first antigen binding molecule comprising (i) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12; (ii) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15; (iii) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:72; (iv) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; and (v) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74; (vi) a
  • an amino acid sequence comprising the first and second antigen binding molecules of the invention.
  • a first antigen binding molecule comprising an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 20, 119, 120, 121, 122, 123 and 239 is provided.
  • SEQ ID NO: 19 a sequence selected from the group consisting of: SEQ ID NO: 19, 20, 119, 120, 121, 122, 123 and 239.
  • Each of these sequences comprises three CDR regions (CDR1, CDR2 and CDR3) and four framework regions (FR1, FR2, FR3 and FR4).
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85- 100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98- 100% identity to a sequence selected from the group consisting of: SEQ ID NO: 19, 20, 119, 120, 121, 122 and 123.
  • a first antigen binding domain comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 19, 20, 119, 120, 121, 122, 123 and 239 is provided.
  • a first antigen binding domain consisting or essentially consisting of comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 19, 20, 119, 120, 121, 122 and 123 is provided.
  • a second antigen binding molecule comprising an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 213, 16, 17 and 18 is provided.
  • Each of these sequences comprises three CDR regions (CDR1, CDR2 and CDR3) and four framework regions (FR1, FR2, FR3 and FR4).
  • the amino acid sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90-100%, 91- 100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity to a sequence selected from the group consisting of: SEQ ID NO: 213, 16, 17 and 18.
  • a second antigen binding molecule comprising a sequence selected from the group consisting of SEQ ID NO: 213, 16, 17 and 18 is provided.
  • a second antigen binding molecule consisting or essentially consisting a sequence selected from the group consisting of SEQ ID NO: 213, 16, 17 and 18 is provided.
  • the first antigen binding molecule comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 24, 25, 140, 141, 142, 143, 144 and 238 is provided.
  • the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity to a sequence selected from the group consisting of: SEQ ID NO: 24, 25, 140, 141, 142, 143, 144 and 238.
  • the first antigen binding molecule comprises a sequence selected from the group consisting of SEQ ID NO: 24, 25, 140, 141, 142, 143, 144 and 238.
  • the first antigen binding molecule consists or essentially consists of a sequence selected from the group consisting of SEQ ID NO24, 25, 140, 141, 142, 143, 144 and 238.
  • the second antigen binding molecule comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 212, 21, 22 and 23. In one embodiment, the polynucleotide sequence has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity to a sequence selected from the group consisting of: SEQ ID NO: 212, 21, 22 and 23. In one embodiment, the second antigen binding molecule comprises a sequence selected from the group consisting of SEQ ID NO: 212, 21, 22 and 23.
  • the second antigen binding molecule consists or essentially consists of SEQ ID NO: 212, 21, 22 or 23.
  • a multivalent polypeptide comprising one or optionally two or more of the single domain antibodies of the invention is provided.
  • a multivalent polypeptide comprising one or more single domain antibodies of the invention and one or more additional known antibodies or single domain antibodies is provided.
  • the single domain antibodies of the invention are joined or linked together with additional known antibodies or single domain antibodies to form a multivalent polypeptide.
  • a first and/or a second antigen binding molecule comprises a known antibody.
  • the known antibody is CR3022 or EY6A or a variant thereof.
  • the known antibody CR3022 may comprise a heavy chain having a sequence selected from SEQ ID NO: 26 or 27.
  • the known antibody CR3022 may additionally comprise a light chain having a sequence selected from SEQ ID NO: 28 or 29.
  • the heavy and/or the light chain of the CR3022 may comprise one or more additional modifications, for example between 0 and 10, 0 and 9, 0 and 8, 0 and 7, 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions.
  • the known antibody EY6A may comprise a heavy chain having the sequence of SEQ ID NO: 30 or 31.
  • the heavy and/or the light chain of the EY6A may comprise one or more additional modifications, for example between 0 and 10, 0 and 9, 0 and 8, 0 and 7, 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions.
  • the known single domain antibody (nanobody) is VHH-72 has the sequence of SEQ ID NO: 32.
  • the sequence of EY6A may comprise one or more additional modifications, for example between 0 and 10, 0 and 9, 0 and 8, 0 and 7, 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions.
  • the known antibody is selected from the group consisting of H11, A7, F9, C10, B11, E11, D1, G7, F5, G11, B4, G9 and C7, H11-D4, H11-H4, H11-H6, H11-A10, H11- B5, H11-A7, H11-F7, H11-F6, H11-G8, H11-D1, H11-A9, H11-C6, H11-E3, H11-F4, H11-C5, H11-C2, H11-B11, H11-A3, H11-D12, H11-D6 and H11-F8 (amino acid sequences provided as SEQ ID NOs: 93-105, polynucleotide sequences provided as SEQ ID NOs: 106-118 respectively) or a fragment or variant thereof.
  • the known antibody is an affinity matured version of H11 selected from the group consisting of H11-D4, H11-H4, H11-H6, H11-A10, H11-B5, H11-A7, H11-F7, H11- F6, H11-G8, H11-D1, H11-A9, H11-C6, H11-E3, H11-F4, H11-C5, _H11-C2, H11-B11, H11- A3, H11-D12, H11-D6 and H11-F8 (amino acid sequences provided as SEQ ID NOs: 119-139, polynucleotide sequences provided as SEQ ID NOs: 140-160 respectively) or a fragment or variant thereof.
  • the known single domain antibody comprises or further comprises a complementary determining region, complementary determining region 3 (CDR3), selected from Table 7 or Table 8.
  • CDR3 complementary determining region 3
  • the known single domain antibody comprises a complementary determining region selected from CDR1, complementary determining region 2 (CDR2) or complementary determining region 3 (CDR3), wherein the CDR1, CDR2 or CDR3 is selected from Table 7 or 8.
  • the known single domain antibody comprises at least one or at least two complementary determining region(s) selected from CDR1, CDR2 or CDR3 is provided, wherein the CDR1, CDR2 or CDR3 is selected from Table 7 or 8.
  • the known single domain antibody comprises three complementary determining regions: CDR1, CDR2, and CDR3, wherein the CDR1, CDR2 and CDR3 is selected from Table 7 or 8.
  • the known single domain antibody comprises: (a) a CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:35; (b) a CDR1 comprising SEQ ID NO:36, a CDR2 comprising SEQ ID NO:37 and a CDR3 comprising SEQ ID NO:38; (c) a CDR1 comprising SEQ ID NO:39, a CDR2 comprising SEQ ID NO:40 and a CDR
  • the known single domain antibody comprises; (a) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:73; or (b) CDR1 comprising SEQ ID NO:33, a CDR2 comprising SEQ ID NO:34 and a CDR3 comprising SEQ ID NO:74.
  • the CDR3 regions comprise between 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the CDR1 regions comprise between 0 and 3, 0 and 2, 0 and 4, 0 and 1 amino acid modifications.
  • the known single domain antibody comprises an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 93 to 105.
  • known single domain antibody comprises an amino acid sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 119 to 139.
  • Each of these sequences comprises three CDR regions (CDR1, CDR2 and CDR3) and four framework regions (FR1, FR2, FR3 and FR4).
  • the known single domain antibody has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90- 100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity to a sequence selected from the group consisting of: SEQ ID NO: 93 to 105.
  • the known single domain antibody has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85- 100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98- 100% identity to a sequence selected from the group consisting of: SEQ ID NO: 119 to 139.
  • At least herein and throughout means, in some embodiments, the recited percentage up to 100%.
  • at least 75% can mean, in some embodiments, 75% to 100%.
  • the known single domain antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 93 to 105. In one embodiment, the known single domain antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 119 to 139. In one embodiment, the known single domain antibody consists or essentially consists of a sequence selected from the group SEQ ID NO: 93 to 105. In one embodiment, the known single domain antibody consists or essentially consists of a sequence selected from the group SEQ ID NO: 119 to 139. In one embodiment, the known single domain antibody comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 106 to 118.
  • known single domain antibody comprises a polynucleotide sequence having at least 70% identity to a sequence selected from the group consisting of: SEQ ID NO: 140 to 160.
  • Each of these sequences comprises three CDR regions (CDR1, CDR2 and CDR3) and four framework regions (FR1, FR2, FR3 and FR4).
  • the known single domain antibody has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85-100%, 90- 100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98-100% identity to a sequence selected from the group consisting of: SEQ ID NO: 106 to 118.
  • the known single domain antibody has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% identity, optionally 75-100%, 80-100%, 85- 100%, 90-100%, 91-100%, 92-100%, 93-100%, 94-100%, 95-100%, 96-100%, 97-100%, 98- 100% identity to a sequence selected from the group consisting of: SEQ ID NO: 140 to 160.
  • the known single domain antibody comprises a polynucleotide sequence selected from the group consisting of SEQ ID NO: 106 to 118.
  • the known single domain antibody comprises a polynucleotide sequence selected from the group consisting of SEQ ID NO: 140 to 160. In one embodiment, the known single domain antibody consists or essentially consists of a sequence selected from the group SEQ ID NO: 106 to 118. In one embodiment, the known single domain antibody consists or essentially consists of a sequence selected from the group SEQ ID NO: 140 to 160. At least herein and throughout means, in some embodiments, the recited percentage up to 100%. For example, at least 75% can mean, in some embodiments, 75% to 100%.
  • the multivalent polypeptide may be bivalent, optionally monospecific bivalent or bispecific bivalent.
  • the bivalent polypeptide may comprise one single domain antibody of the invention and one known antibody or nanobody.
  • the bispecific bivalent polypeptide may additionally be biparatopic, i.e. it recognizes two distinct non-overlapping epitopes on the same target antigen.
  • the multivalent polypeptide may be trivalent, optionally monospecific trivalent, bispecific trivalent or trispecific trivalent.
  • the trivalent polypeptide may comprise two single domain antibodies of the invention and one known antibody or nanobody or, alternatively, comprise one single domain antibody of the invention and two known antibodies or single domain antibodies.
  • the multivalent polypeptide may be tetravalent, optionally monospecific tetravalent, bispecific tetravalent, trispecific tetravalent or tetraspecific tetravalent.
  • the tetraspecific polypeptide may comprise three single domain antibodies of the invention and one known antibody or nanobody or, alternatively, comprising two single domain antibodies of the invention and two known antibodies or nanobodies or, alternatively, comprising one single domain antibody of the invention and three known antibodies or single domain antibodies. Additional multivalent polypeptides comprising both one or more single domain antibodies of the invention and one or more additional known antibodies or single domain antibodies having a higher valency, for example multivalent polypeptides binding 5, 6, 7, 8, 9 or 10 more antigen binding sites, are also provided.
  • Such multivalent polypeptides can be monospecific, bispecific, trispecific, tetraspecific or multispecific.
  • the multivalent polypeptide may be a dimer (homodimer or heterodimer), trimer (homotrimer or heterotrimer), tetramer (homotetramer or heterotetramer) or multimer (homomultimer or heteromultimer).
  • a multivalent polypeptide comprising two or more single domain antibodies as disclosed herein is provided.
  • single domain antibodies of the invention are joined or linked together to form a multivalent polypeptide.
  • the multivalent polypeptide may be bivalent, optionally monospecific bivalent or bispecific bivalent.
  • the bivalent polypeptide may comprise two of the same single domain antibodies of the invention or two different single domain antibodies of the invention.
  • the multivalent polypeptide may be trivalent, optionally monospecific trivalent, bispecific trivalent or trispecific trivalent.
  • the trivalent polypeptide may comprise three of the same single domain antibodies of the invention, two same single domain antibodies of the invention and one different single domain antibody of the invention, or three different single domain antibodies of the invention.
  • the multivalent polypeptide may be tetravalent, optionally monospecific tetravalent, bispecific tetravalent, trispecific tetravalent or tetraspecific tetravalent.
  • the tetravalent polypeptide may comprise four of the same single domain antibodies of the invention, three of the same single domain antibodies of the invention and one different single domain antibody of the invention, two of the same single domain antibodies of the invention and two further different single domain antibodies of the invention (the further single domain antibodies themselves being either the same or different), or four different single domain antibodies of the invention.
  • Additional multivalent polypeptides comprising one or more single domain antibodies of the invention having a higher valency, for example multivalent polypeptides binding 5, 6, 7, 8, 9 or 10 more antigen binding sites, are also provided.
  • Such multivalent polypeptides can be monospecific, bispecific, trispecific, tetraspecific or multispecific.
  • the multivalent polypeptide may be a dimer (homodimer or heterodimer), trimer (homotrimer or heterotrimer), tetramer (homotetramer or heterotetramer) or multimer (homomultimer or heteromultimer).
  • a bivalent polypeptide comprising a first single domain antibody having an amino acid or polynucleotide sequence based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first row of the table below) and a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below).
  • a bivalent polypeptide comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on C5 or A8 and a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the fourth and eight columns of the table below).
  • a bivalent polypeptide comprising a first single domain comprising an amino acid or polynucleotide sequence based on A8 and a second single domain antibody comprising an amino acid or polynucleotide sequence based on A8.
  • a bivalent polypeptide is provided comprising a first single domain comprising an amino acid or polynucleotide sequence based on C5 and a second single domain antibody comprising an amino acid or polynucleotide sequence based on C5.
  • amino acid or polynucleotide sequence can comprise the CDR3, CDR2 and/or CDR1 or a variant thereof of the specified single domain antibodies, comprise the amino acid sequence or a variant thereof of the specified single domain antibodies, or comprise the polynucleotide sequence of variant thereof of the specified single domain antibodies.
  • a trivalent polypeptide comprising a first single domain amino antibody having an amino acid or polynucleotide sequence based on C5, a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 and a third single domain antibody having an amino acid or polynucleotide based B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide comprising two single domain amino antibodies having an amino acid or polynucleotide sequence based on C5, and a third single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide is provided comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on C5.
  • a trivalent polypeptide comprising a first single domain amino antibody having an amino acid or polynucleotide sequence based on C1, a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 and a third single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide comprising two single domain amino antibodies having an amino acid or polynucleotide sequence based on C1, and a third single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide is provided comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on C1.
  • a trivalent polypeptide comprising a first single domain amino antibody having an amino acid or polynucleotide sequence based on A8, a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 and a third single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide comprising two single domain amino antibodies having an amino acid or polynucleotide sequence based on A8, and a third single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6.
  • a trivalent polypeptide is provided comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on 2_A8.
  • amino acid or polynucleotide sequence can comprise the CDR3, CDR2 and/or CDR1 or a variant thereof of the specified single domain antibodies, comprise the amino acid sequence or a variant thereof of the specified single domain antibodies, or comprise the polynucleotide sequence of variant thereof of the specified single domain antibodies.
  • a trimer comprising three single domain antibodies, each single domain antibody comprising: (a) a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); (b) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); (c) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); or (d) a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8); wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid
  • a trimer comprising three single domain antibodies comprising: (a) a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); (b) a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); (c) a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); or (d) a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8).
  • the coronavirus biding molecules or multivalent polypeptides of the invention may comprise a suitable linker, as further described herein.
  • the linker is used to join the one or more single domain antibodies of the invention to one or more known antibodies or single domain antibodies and/or further single domain antibodies of the invention to form a multivalent polypeptide.
  • the linker comprises 1 to 50 amino acids.
  • the linker comprises 5 to 35, optionally 5 to 25, or 5 to 15 amino acids.
  • the linker comprises 4 to 8 amino acids, optionally 4, 5, 6, 7 or 8 amino acids.
  • the linker comprises one or more amino acids, for example two or more amino acids, three or more amino acids, four or more amino acids, five or more amino acids, six or more amino acids, seven or more amino acids, eight or more amino acids, nine or more amino acids, or ten or more amino acids.
  • the linker can comprise any known amino acid residues, however may preferably comprise glycine and serine residues.
  • the linker comprises one or more glycine residues and/or one or more serine residues.
  • the linker comprises at least 1, at least 5, at least 10, or at least 20 glycine and/or serine residues.
  • the linker comprises 5 to 35, optionally 5 to 25, or 5 to 15 glycine and/or serine residues.
  • the linker comprises two glycine-serine repeats (GSGS).
  • the linker comprises three glycine-serine repeats (GSGSGS).
  • the linker comprises four glycine-serine repeats (GSGSGSGS).
  • the linker comprises multiple glycine-serine repeats, represented by the general formula (GS)n, wherein n is the number of GS repeats present, for example n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20.
  • the linker may be joined to either the n- terminal, the c-terminal, or in the case that the multivalent polypeptides comprise multiple linkers, the linker may be joined at both the n- and the c-terminal of the single domain antibodies of the invention
  • the linker comprises a protein from the ubiquitin-like protein superfamily, either ubiquitin (Ub) itself or a ubiquitin-like protein (ULP).
  • Ub ubiquitin
  • ULP ubiquitin-like protein
  • the linker of the invention can be varied in composition and length to tailor the design to the optimal arrangement for linking the first and second antigen binding molecules or single domain antibodies of the invention and positioning them in the optimal spatial arrangement for targeting the first and second epitope.
  • the linker can further be optimised in composition and length to optimise binding characteristics of the coronavirus binding molecule or single domain antibodies, for example Kd, as described herein.
  • the linker comprises a protein selected from the group consisting of ubiquitin, Small Ubiquitin-like Modifier 1 (SUMO-1, also known in humans as Smt3c, PIC1, GMP1, sentrin and Ubl1), Small Ubiquitin-like Modifier 2 (SUMO-2, also known in humans as Smt3a and Sentrin3), Small Ubiquitin-like Modifier 3 (SUMO-3, also known as Smt3b and Sentrin2), Small Ubiquitin-like Modifier 4 (SUMO-4), FAU, NEDD-8, UBL-1, and GDX, Rub1, APG8, ISG15, URM1, HUB1, elonginB, or PLIC2.
  • SUMO-1 Small Ubiquitin-like Modifier 1
  • SUMO-2 also known in humans as Smt3a and Sentrin3
  • Smt3b and Sentrin3 Small Ubiquitin-like Modifier 3
  • SUMO-4 Small Ubiquitin
  • the protein is ubiquitin.
  • the protein is Small Ubiquitin-like Modifier (SUMO).
  • the linker comprises two or more ubiquitins (Ub) or a ubiquitin-like proteins (ULP), optionally 2, 3, 4 or 5 ubiquitins (Ub) or a ubiquitin-like proteins (ULP).
  • the linker may be extended to additionally comprise amino acids at both the n-terminal and the c-terminal ends of the ubiquitin (Ub) or ubiquitin-like protein linker. In one embodiment, additional amino acids are joined to the n-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • additional amino acids are joined to the c-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker. In one embodiment, additional amino acids are joined to the c- terminal and the n-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • the amino acids joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker can comprise one or more additional amino acids.
  • 5 to 50 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • 4 to 8 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker, optionally 4, 5, 6, 7 or 8 amino acids.
  • 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30,31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 amino acids may be joined to either the n-terminal, the c- terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • 1 to 10, 1 to 8, 1 to 6, 1 to 4 or 1 to 2 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin- like protein linker.
  • 6 amino acid residues may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin- like protein linker.
  • the number of amino acids at each terminal may be the same or different, i.e. the extensions at either side may be of the same length, or the extensions at each terminal may be of differing lengths.
  • the amino acids joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of either the single domain antibody or the ubiquitin (Ub) or ubiquitin-like protein linker can comprise any amino acid.
  • the one or more amino acids are a glycine-serine (GS) linker.
  • the glycine serine linker can be repeated to increase the chain length, for example two glycine serine linkers (GSGS), three glycine-serine linkers (GSGSGS), four glycine-serine linkers (GSGSGSGS) or five three glycine-serine linkers (GSGSGSGS) may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • GSGS glycine serine linkers
  • Ub ubiquitin
  • Ub ubiquitin-like protein linker
  • the amino acids joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker are GSGSGS.
  • the linker comprises GSGSGS at both the c-terminal and the n-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • the linker comprises a poly-A tail.
  • the linker comprises SUMO and an extension of three glycine- serine linkers (GSGSGS) at the n-terminal end of the SUMO and an extension of three glycine- serine linkers (GSGSGS) at the c-terminal end.
  • SUMO-1 comprises SEQ ID NO: 240 or 241 or a variant thereof (https://www.uniprot.org/uniprot/P63165).
  • SUMO-2 comprises SEQ ID NO: 242 or 243 or a variant thereof (https://www.uniprot.org/uniprot/P61956; https://www.uniprot.org/uniprot/P61956).
  • SUMO-3 comprises SEQ ID NO: 244 or 245 or a variant thereof (https://www.uniprot.org/uniprot/P55854; https://www.uniprot.org/uniprot/P55854).
  • SUMO-4 comprises SEQ ID NO: 246 or a variant thereof (https://www.uniprot.org/uniprot/Q6EEV6).
  • the linker optionally further comprises a spacer joined to the n-terminal and/or c-terminal ends of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • a spacer is joined to the n-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker. In one embodiment, a spacer is joined to the c-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker. In one embodiment, a spacer is joined to the c-terminal and the n-terminal end of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • the linker including any optional spacers attached the n and/or c terminal of the ubiquitin (Ub) or ubiquitin-like protein, may be used to link the c-terminal of the first antigen binding molecule to the n-terminal of the second antigen binding molecule, or alternatively may be used to link the c-terminal of the second antigen binding molecule to the n-terminal of the first antigen binding molecule.
  • the spacer may comprise one or more amino acids, preferably between 4 and 50 amino acids.
  • 4 to 50 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • 4 to 8 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker, optionally 4, 5, 6, 7 or 8 amino acids.
  • 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30,31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49 or 50 amino acids may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • 1 to 10, 1 to 8, 1 to 6, 1 to 4 or 1 to 2 amino acids may be joined to either the n- terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin-like protein linker.
  • 6 amino acid residues may be joined to either the n-terminal, the c-terminal, or both the n- and the c-terminal of the ubiquitin (Ub) or ubiquitin- like protein linker.
  • a multivalent polypeptide is provided comprising two single domain antibodies selected from the group consisting of: i. two single domain antibodies each comprising SEQ ID NO: 12 (C5 CDR3); ii.
  • two single domain antibodies each comprising SEQ ID NO: 198 A8 CDR3; iii. two single domain antibodies each comprising SEQ ID NO: 9 (C1 CDR3); iv. two single domain antibodies each comprising SEQ ID NO: 3 (B12 CDR3); v. two single domain antibodies each comprising SEQ ID NO: 6 (F2 CDR3); vi. two single domain antibodies each comprising SEQ ID NO: 15 (H3 CDR3); vii. two single domain antibodies each comprising SEQ ID NO: 192 (NbSA_A10 CDR3); viii. two single domain antibodies each comprising SEQ ID NO: 195 (NbSA_D10 CDR3); ix.
  • the multivalent polypeptide is a monospecific bivalent polypeptide.
  • the multivalent polypeptide comprises two single domain antibodies each comprising SEQ ID NO: 198 (2_A8 CDR3), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications.
  • the multivalent polypeptide comprises two single domain antibodies each comprising SEQ ID NO: 12 (C5 CDR3), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications.
  • a multivalent polypeptide is provided comprising two single domain antibodies selected from the group consisting of: i. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); ii.
  • two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8) iii. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); iv. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3 (B12); v. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6 (F2); and vi.
  • two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); vii. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:191 and a CDR3 comprising SEQ ID NO:192 viii. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:194 and a CDR3 comprising SEQ ID NO:195 ix. two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:200 and a CDR3 comprising SEQ ID NO:201; x.
  • the multivalent polypeptide is a monospecific bivalent polypeptide.
  • the multivalent polypeptide comprises two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (2_A8), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • the multivalent polypeptide comprises two single domain antibodies each comprising a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • a multivalent polypeptide comprising two single domain antibodies selected from the group consisting of: i. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); ii. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8); iii.
  • two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); iv. two single domain antibodies each comprising CDR1 comprising SEQ ID NO:1, a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3 (B12); v. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:4, a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6 (F2); and vi.
  • two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); vii. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:190, a CDR2 comprising SEQ ID NO:191 and a CDR3 comprising SEQ ID NO:192; viii. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:193, a CDR2 comprising SEQ ID NO:194 and a CDR3 comprising SEQ ID NO:195; ix.
  • two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:199, a CDR2 comprising SEQ ID NO:200 and a CDR3 comprising SEQ ID NO:201;
  • two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:194, a CDR2 comprising SEQ ID NO:203 and a CDR3 comprising SEQ ID NO:204;
  • xi. two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:205, a CDR2 comprising SEQ ID NO:206 and a CDR3 comprising SEQ ID NO:207; and xii.
  • the multivalent polypeptide is a monospecific bivalent polypeptide.
  • the multivalent polypeptide comprises two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (A8), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the multivalent polypeptide comprises two single domain antibodies each comprising two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • a trivalent polypeptide is provided comprising three single domain antibodies selected from the group consisting of: i. three single domain antibodies each comprising SEQ ID NO: 12 (C5 CDR3); ii.
  • the trivalent polypeptide is a monospecific trivalent polypeptide.
  • the trivalent polypeptide comprises three single domain antibodies each comprising SEQ ID NO: 9 (C1 CDR3), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications.
  • the trivalent polypeptide comprises three single domain antibodies each comprising SEQ ID NO: 198 (A8), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications.
  • the trivalent polypeptide comprises three single domain antibodies each comprising SEQ ID NO: 12 (C5 CDR3), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications.
  • a trivalent polypeptide is provided comprising three single domain antibodies selected from the group consisting of: i. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); ii. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198; iii.
  • three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); iv. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3 (B12); v. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6 (F2); and vi. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); vii.
  • three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:191 and a CDR3 comprising SEQ ID NO:192; viii. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:194 and a CDR3 comprising SEQ ID NO:195; ix. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:200 and a CDR3 comprising SEQ ID NO:201; x. three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:203 and a CDR3 comprising SEQ ID NO:204; xi.
  • the trivalent polypeptide is a monospecific trivalent polypeptide.
  • the trivalent polypeptide comprises three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • the trivalent polypeptide comprises three single domain antibodies each comprising a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications.
  • a trivalent polypeptide comprising three single domain antibodies selected from the group consisting of: i. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5); ii. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8); iii.
  • three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:7, a CDR2 comprising SEQ ID NO:8 and a CDR3 comprising SEQ ID NO:9 (C1); iv. three single domain antibodies each comprising CDR1 comprising SEQ ID NO:1, a CDR2 comprising SEQ ID NO:2 and a CDR3 comprising SEQ ID NO:3 (B12); v. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:4, a CDR2 comprising SEQ ID NO:5 and a CDR3 comprising SEQ ID NO:6 (F2); and vi.
  • three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:13, a CDR2 comprising SEQ ID NO:14 and a CDR3 comprising SEQ ID NO:15 (H3); vii. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:190, a CDR2 comprising SEQ ID NO:191 and a CDR3 comprising SEQ ID NO:192; viii. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:193, a CDR2 comprising SEQ ID NO:194 and a CDR3 comprising SEQ ID NO:195; ix.
  • three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:199, a CDR2 comprising SEQ ID NO:200 and a CDR3 comprising SEQ ID NO:201; x. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:202, a CDR2 comprising SEQ ID NO:203 and a CDR3 comprising SEQ ID NO:204; xi. three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:205, a CDR2 comprising SEQ ID NO:206 and a CDR3 comprising SEQ ID NO:207; and xii.
  • three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:235, a CDR2 comprising SEQ ID NO:236 and a CDR3 comprising SEQ ID NO:237; wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the trivalent polypeptide comprises three single domain antibodies each comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (A8), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • the trivalent polypeptide comprises three single domain antibodies each comprising two single domain antibodies each comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications.
  • a multivalent polypeptide comprising three or more single domain antibodies (sdAB) of the invention, represented by Formula I or II: Formula I : (sdAB) N – (Linker) N-1 Formula II : (sdAB) N – (Linker) N wherein the number N is the number of single domain antibodies (sdAb) and wherein the linker(s) can be the same or different and may include one of more of: polyA linkers; GS linkers and/or ubiquitin or ubiquitin-like linkers, optionally SUMO or SUMO-like linkers.
  • n is selected from the group consisting of 3, 4, 5, 6, 7, 8, 9 and 10.
  • n is 3.
  • n is 4.
  • a multivalent polypeptide comprising three or more single domain antibodies (sdAB), represented by Formula I or II: Formula I : (sdAB)N – (Linker) N-1 Formula II : (sdAB)N – (Linker) N and wherein each single domain antibody comprises SEQ ID NO: 12 (C5 CDR3) and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, and wherein the number N is the number of single domain antibodies (sdAb) and wherein the linker(s) can be the same or different and may include one of more of: polyA linkers; GS linkers and/or ubiquitin or ubiquitin-like linkers, optionally SUMO or SUMO-like linkers.
  • sdAB single domain antibodies
  • n is selected from the group consisting of 3, 4, 5, 6, 7, 8, 9 and 10. In one embodiment n is 3. In one embodiment n is 4. In one embodiment n is 5.
  • a multivalent polypeptide comprising three or more single domain antibodies (sdAB), represented by Formula I or II: Formula I : (sdAB) N – (Linker) N-1 Formula II : (sdAB)N – (Linker) N and wherein each single domain antibody comprises a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications and wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications, wherein the number N is the number of single domain antibodies (sdAb) and wherein the linker(s) can be the same or different and may include one of more of: polyA linkers; GS linkers and/or ubiquitin or ubiquitin-like link
  • n is selected from the group consisting of 3, 4, 5, 6, 7, 8, 9 and 10. In one embodiment n is 3. In one embodiment n is 4. In one embodiment n is 5.
  • a multivalent polypeptide comprising three or more single domain antibodies (sdAB), represented by Formula I or II: Formula I : (sdAB) N – (Linker) N-1 Formula II : (sdAB) N – (Linker) N and wherein each single domain antibody comprises a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12 (C5), and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications, and wherein the number N is the number of single domain antibodies (sdAb) and wherein the linker(s) can be the
  • n is selected from the group consisting of 3, 4, 5, 6, 7, 8, 9 and 10. In one embodiment n is 3. In one embodiment n is 4. In one embodiment n is 5.
  • a multivalent polypeptide comprising three or more single domain antibodies (sdAB), represented by Formula I or II: Formula I : (sdAB)N – (Linker) N-1 Formula II : (sdAB)N – (Linker) N and wherein each single domain antibody comprises a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 (2_A8), and wherein the amino acid sequence of CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of CDR1 comprises between 0 and 4 amino acid modifications, and wherein the number N is the number of single domain antibodies (sdAb) and wherein the linker(s) can be
  • n is selected from the group consisting of 3, 4, 5, 6, 7, 8, 9 and 10. In one embodiment n is 3. In one embodiment n is 4. In one embodiment n is 5. In one embodiment, a bivalent polypeptide (C5-AAA-C5) is provided having the nucleotide sequence SEQ ID NO: 162 or 181, or variant thereof. In one embodiment, a bivalent polypeptide (C5-AAA-C5) is provided having the amino acid sequence SEQ ID NO: 171 or 182, or a variant thereof. In one embodiment, a bivalent polypeptide (C5-9GS-C5) is provided having the nucleotide sequence SEQ ID NO: 163 or SEQ ID NO: 183, or a variant thereof.
  • a bivalent polypeptide (C5-9GS-C5) is provided having the amino acid sequence SEQ ID NO: 172 or SEQ ID NO: 184, or a variant thereof.
  • a bivalent polypeptide (C5-GSGSGS-SUMO-GSGSGS-C5) is provided having the nucleotide sequence SEQ ID NO: 164 or SEQ ID NO: 185, or a variant thereof.
  • a bivalent polypeptide (C5-GSGSGS-SUMO-GSGSGS-C5) is provided having the amino acid sequence SEQ ID NO: 173 or SEQ ID NO: 186, or a variant thereof.
  • a bidentate polypeptide (C5-GSGSGS-SUMO-GSGSGS-C5) is provided having the nucleotide sequence SEQ ID NO: 165, or a variant thereof.
  • a bidentate polypeptide ( C5-GSGSGS-SUMO-GSGSGS-F2 ) is provided having the amino acid sequence SEQ ID NO: 174, or a variant thereof.
  • a bidentate polypeptide (F2-GSGSGS-SUMO-GSGSGS-C5) is provided having the nucleotide sequence SEQ ID NO: 166, or a variant thereof.
  • a bidentate polypeptide (F2-GSGSGS-SUMO-GSGSGS-C5) is provided having the amino acid sequence SEQ ID NO: 175, or a variant thereof.
  • a bidentate polypeptide (C1-GSGSGS-SUMO-GSGSGS-C5) is provided having the nucleotide sequence SEQ ID NO: 167, or a variant thereof.
  • a bidentate polypeptide (C1-GSGSGS-SUMO-GSGSGS-C5) is provided having the amino acid sequence SEQ ID NO: 176, or a variant thereof.
  • a bidentate polypeptide ( C1-GSGSGS-SUMO-GSGSGS-H3 ) is provided having the nucleotide sequence SEQ ID NO: 168, or a variant thereof.
  • a bidentate polypeptide (C1-GSGSGS-SUMO-GSGSGS-H3) is provided having the amino acid sequence SEQ ID NO: 177, or a variant thereof.
  • a bidentate polypeptide (C1-GSGSGS-SUMO-GSGSGS- H11-H4 ) is provided having the nucleotide sequence SEQ ID NO: 178, or a variant thereof.
  • a bidentate polypeptide (C1-GSGSGS-SUMO-GSGSGS-H11-H4) is provided having the nucleotide sequence SEQ ID NO:179, or a variant thereof:
  • a bidentate polypeptide (F2-GSGSGS-SUMO-GSGSGS-VHH_H6) is provided having the amino acid sequence SEQ ID NO: 247, or a variant thereof.
  • a bidentate polypeptide (F2-GSGSGS-SUMO-GSGSGS-VHH_H6) is provided having the amino acid sequence SEQ ID NO: 248, or a variant thereof.
  • a trivalent polypeptide (C5-6GS-C5-6GS-C5) is provided having the nucleotide sequence SEQ ID NO: 187, or a variant thereof.
  • a trivalent polypeptide (C5-6GS-C5-6GS-C5) is provided having the amino acid sequence SEQ ID NO: 188 or SEQ ID NO: 189, or a variant thereof.
  • a trivalent polypeptide (A8) is provided having the nucleotide sequence SEQ ID NO: 230, or a variant thereof.
  • a trivalent polypeptide (A8) is provided having the amino acid sequence SEQ ID NO: 221 or SEQ ID NO: 222, or a variant thereof.
  • a trivalent polypeptide (C1) is provided having the nucleotide sequence SEQ ID NO: 223, or a variant thereof. In one embodiment, a trivalent polypeptide (C1) is provided having the amino acid sequence SEQ ID NO: 224 or SEQ ID NO: 225, or a variant thereof. In one embodiment, a trivalent polypeptide (F2) is provided having the nucleotide sequence SEQ ID NO: 226, or a variant thereof.In one embodiment, a trivalent polypeptide (F2) is provided having the amino acid sequence SEQ ID NO: 227, or a variant thereof. In one embodiment, a trivalent polypeptide (H3) is provided having the nucleotide sequence SEQ ID NO: 228, or a variant thereof.
  • a trivalent polypeptide (H3) is provided having the amino acid sequence SEQ ID NO: 229, or a variant thereof.
  • a bidentate polypeptide ( VHH_72-SUMO-C5) is provided having the amino acid sequence SEQ ID NO: 234, or a variant thereof.
  • Variants of the specified sequences may comprise one or more modifications (amino acid or nucleotide substitutions, deletions or insertions), two or more, three or more modifications, four or more, five or more, six or more, seven or more, eight or more, nine or more of 10 or more modifications.
  • a variant comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 modifications.
  • Variants comprising one or more modifications, as detailed herein, will retain binding affinity for a coronavirus peptide, preferably the receptor binding domain of the S protein of SARS-CoV-2.
  • a single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to an Fc domain, such as a human Fc, to create a fusion protein.
  • a bidentate polypeptide of the invention is fused to a Fc domain.
  • a first antigen binding molecule of the invention is fused to or conjugated to an Fc domain, such as a human Fc, to create a fusion protein.
  • a second antigen binding molecule of the invention is fused to or conjugated to an Fc domain, such as a human Fc, to create a fusion protein.
  • the IgG Fc region is comprised of two halves, each half comprising a CH2 and CH3, and wherein each half is joined by a hinge region.
  • the single domain antibodies, multivalent polypeptides or antigen binding molecules of the invention may be fused to an Fc fragment comprising CH2 and CH3 (i.e. one half of the Fc region), optionally wherein the Fc fragment comprises the hinge region.
  • the single domain antibodies, multivalent polypeptides or antigen binding molecules of the invention may be fused to an Fc domain comprising two halves, each half comprising a CH2 and CH3, and wherein each half is joined by a hinge region.
  • the Fc domain is an IgG Fc domain, optionally selected from the group consisting of the Fc domain if IgG1, IgG2, IgG3 and IgG4.
  • single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to the Fc domain of a human IgG1.
  • single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to the Fc domain of a human IgG4.
  • the IgG1 Fc domain comprises SEQ ID NO: 169 or a variant thereof.
  • the IgG1 Fc domain SEQ ID NO: 180 or a variant thereof.
  • a variant of the IgG1 Fc domain may comprise one or more modifications (amino acid or nucleotide substitutions, deletions or insertions), two or more modifications, three or more modifications.
  • the IgG1 Fc domain comprises 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 modifications.
  • the Fc domain may be joined to the c-terminal or the n-terminal of the single domain antibodies, multivalent polypeptides or antigen binding molecules bind of the invention.
  • the Fc domain is joined to the c-terminal of the single domain antibodies or multivalent polypeptides of the invention.
  • Fc regions for example amino acid modifications (substitutions, deletions, insertions), are well known to the skilled person and single domain antibodies, multivalent polypeptides or antigen binding molecules of the invention may be fused or conjugated to an FC domain comprising one or more modifications, for example an Fc domain comprising modifications to reduce or enhance effector mediated functions such as antibody-dependent cellular cytotoxicity (ADCC) or cell-mediated cytotoxicity (CDC), to reduce or enhance binding to a receptor such as the Fc receptor or the C1q receptor.
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC cell-mediated cytotoxicity
  • a single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to an IgG1 Fc mutant, wherein the Fc mutant is selected from the group consisting of S267E/H268F/S324T/ S239D/I332E, H268F/S324T/ S239D/I332E, S267E/H268F/S324T/G236A/I332E, S267E/H268F/S324T, H268F/S324T, G236A/I332E, F243L/R292P/Y300L/V305I/P396L, S239D/I332E, S239D/I332E/A330L, S298A/E333A/K334A, G236A/S239D/I332E, K326W/E333S, S267E/H268F/S3
  • a single domain antibody multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to an IgG2 Fc mutant, wherein the Fc mutant is selected from the group consisting of H268Q/V309L/A330S/P331S and V234A/G237A/P238S/H268A/V309L/A330S/P331S.
  • a single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to an IgG4 Fc mutant, wherein the Fc mutant is F234A/L235A.
  • a single domain antibody, multivalent polypeptide or antigen binding molecule of the invention is fused to or conjugated to an IgG4 Fc domain wherein the domain is S228P. In one embodiment a single domain antibody, multivalent polypeptide or antigen binding molecules of the invention is fused to or conjugated to an IgG1 Fc domain wherein the domain is L235A. Multimers, for examples dimers, trimers and tetramers, can be formed when a single domain antibody of the invention is covalently linked to one or more additional single domain antibodies.
  • a single polypeptide chain is provided comprising two or more single domain antibodies of the invention, as defined herein.
  • a single polypeptide chain comprising three or more single domain antibodies of the invention, as defined herein.
  • a single polynucleotide chain is provided encoding two or more single domain antibodies of the invention, as defined herein.
  • a single polynucleotide chain is provided encoding three or more single domain antibodies of the invention, as defined herein.
  • a single polypeptide chain is provided comprising one or more single domain antibodies of the invention and one or more known single domain antibodies, as defined herein.
  • a single polypeptide chain is provided comprising two or more single domain antibodies of the invention and one or more known single domain antibodies, as defined herein.
  • a single polynucleotide chain is provided encoding one or more single domain antibodies of the invention and one or more known single domain antibodies, as defined herein. In one embodiment, a single polynucleotide chain is provided encoding two or more single domain antibodies of the invention and one or more known single domain antibodies, as defined herein.
  • the multimers may or may not comprise a linker sequence, for example a linker as defined herein. Dimers can be formed when a single domain antibody of the invention fused to an Fc domain dimerizes with a second single domain antibody or of the invention fused to an Fc domain. Dimerization occurs between the Fc portions via a combination of covalent and non-covalent interactions.
  • each half of the dimer comprises a single domain antibody of the invention.
  • the dimer comprises two identical single domain antibodies covalently bound together via the Fc domain (a homodimer).
  • the dimer comprises two different single domain antibodies covalently bound together via the Fc domain (a heterodimer).
  • a dimer is provided comprising a first bivalent, optionally bidentate, polypeptide fused to an Fc domain and a second bivalent, optionally bidentate, polypeptide fused to an Fc domain. In this instance, the resulting dimer is tetravalent.
  • Dimers can also be formed when a coronavirus binding molecule comprising an antigen binding molecule fused to an Fc domain dimerizes with a second coronavirus binding molecule comprising an antigen binding molecule fused to an Fc domain. Dimerization occurs between the Fc portions via a combination of covalent and non-covalent interactions. Each half of the dimer comprises a bidentate coronavirus binding molecule of the invention. The resulting dimer is tetravalent. Multimers, for examples dimers, trimers and tetramers, can also be formed when a single domain antibody of the invention non-covalently links other single domain antibodies, for example known single domain antibodies or additional single domain antibodies of the invention.
  • a dimer wherein the dimer comprises two single domain antibodies of the invention, wherein the single domain antibodies are non-covalently linked via a dimerization domain.
  • a dimer is provided wherein the dimer comprises a single domain antibody of the invention and a known single domain antibody, wherein the single domain antibodies are non-covalently linked via a dimerization domain.
  • a trimer is provided wherein the trimer comprises three single domain antibodies of the invention, wherein the single domain antibodies are non-covalently linked via a trimerization domain.
  • a trimer comprising two single domain antibodies of the invention and one known single domain antibody, wherein the single domain antibodies are non-covalently linked via a trimerization domain.
  • a trimer is provided wherein the trimer comprises one single domain antibody of the invention and two known single domain antibodies, wherein the single domain antibodies are non-covalently linked via a trimerization domain.
  • a dimer is provided, wherein a single domain antibody of the invention fused to a Fc domain is dimerized with a further single domain antibody of the invention fused to a Fc. The Fc domain itself causes dimerization.
  • a dimer comprising: a) a first single domain antibody having an amino acid or polynucleotide sequence based on C5, B12, F2, C1 or H3, wherein the first single domain antibody is fused to a Fc domain; and b) a second single domain antibody having an amino acid or polynucleotide based on C5, B12, F2, C1 or H3, wherein the second single domain antibody is fused to a Fc domain; or a) a first single domain antibody having an amino acid or polynucleotide sequence based on C5, A8, B12, F2, C1, H3, NbSA_A10, NbSA_D10, 3_C5, 8_G11, 12_F11 and VHH_H6 wherein the first single domain antibody is fused to a Fc domain; and b) a second single domain antibody having an amino acid or polynucleotide based on C5, A8, B12, F2, C1, H3, NbSA_A10,
  • amino acid or polynucleotide sequence can comprise the CDR3, CDR2 and/or CDR1 or a variant thereof of the specified single domain antibodies, comprise the amino acid sequence or a variant thereof of the specified single domain antibodies, or comprise the polynucleotide sequence of variant thereof of the specified single domain antibodies.
  • an anti-SARS-CoV-2 dimer ((C5-Fc)2) comprising: a) a first single domain antibody comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12, and wherein a Fc domain is fused to the c-terminal of the single domain antibody; b) a second single domain antibody comprising a CDR1 comprising SEQ ID NO:10, a CDR2 comprising SEQ ID NO:11 and a CDR3 comprising SEQ ID NO:12, and wherein a Fc domain is fused to the c-terminal of the single domain antibody, wherein the amino acid sequence of each CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of each CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of each CDR1 comprises between 0 and 4 amino acid modifications.
  • an anti-SARS-CoV-2 dimer ((A8-Fc)2) comprising: a) a first single domain antibody comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198 and wherein a Fc domain is fused to the c-terminal of the single domain antibody; b) a second single domain antibody comprising a CDR1 comprising SEQ ID NO:196, a CDR2 comprising SEQ ID NO:197 and a CDR3 comprising SEQ ID NO:198, and wherein a Fc domain is fused to the c-terminal of the single domain antibody, wherein the amino acid sequence of each CDR3 comprises between 0 and 7 amino acid modifications, wherein the amino acid sequence of each CDR2 comprises between 0 and 4 amino acid modifications and wherein the amino acid sequence of each CDR1
  • the Fc domain is human IgG1 or variant thereof.
  • a dimer comprising a first single domain antibody having an amino acid or polynucleotide sequence based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first row of the table below) fused to a Fc domain, and a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below) fused to a Fc domain.
  • a dimer comprising a first single domain antibody having an amino acid or polynucleotide sequence based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first row of the table below) covalently linked to a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below).
  • a dimer comprising a first single domain antibody having an amino acid or polynucleotide sequence based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first row of the table below) non- covalently linked, optionally via a dimerization domain, to a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below).
  • a dimer comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on 2_A8 or C5 fused to a Fc domain, and a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below) fused to a Fc domain.
  • a dimer comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on 2_A8 or C5 covalently linked to a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below).
  • a dimer comprising a first single domain antibody comprising an amino acid or polynucleotide sequence based on 2_A8 or C5 non- covalently linked, optionally via a dimerization domain, to a second single domain antibody having an amino acid or polynucleotide based on B12, C1, C5, F2, H3, NbSA_A10, NbSA_D10, A8, 3_C5, 8_G11, 12_F11 or VHH_H6 (the first column of the table below).
  • a dimer comprising a first single domain comprising an amino acid or polynucleotide sequence based on A8 or C5 fused to a Fc domain and a second single domain antibody comprising an amino acid or polynucleotide sequence based on A8 or C5 fused to a Fc domain.
  • a dimer is provided comprising a first single domain comprising an amino acid or polynucleotide sequence based on A8 or C5 covalently linked to a second single domain antibody comprising an amino acid or polynucleotide sequence based on A8 or C5.
  • a dimer comprising a first single domain comprising an amino acid or polynucleotide sequence based on 2_A8 or C5 non-covalently linked, optionally via a dimerization domain, to a second single domain antibody comprising an amino acid or polynucleotide sequence based on A8 or C5.
  • the amino acid or polynucleotide sequence can comprise the CDR3, CDR2 and/or CDR1 or a variant thereof of the specified single domain antibodies, comprise the amino acid sequence or a variant thereof of the specified single domain antibodies, or comprise the polynucleotide sequence of variant thereof of the specified single domain antibodies.
  • a fusion protein comprising a single domain antibody (C5) fused to the Fc region of hIgG1 having the following sequence, or a variant thereof: CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTCGGTGCAGGCTGGGGGGTCTCTGACACTCTCCTGTGTCGCCTCTGGAGTCACTTTGGGACGTCATGCCATAGGCTGGTTCCGCCAGGCCCCCGGGAAGGAGCGTGAGAGTCTCGTGT ATTAGAACATTTGATGGCATCACAAGTTATGTAGAGTCCACGAAGGGCCGATTCACCATCTCCAGTAACAATGCC ATGAACACGGTGTATCTGCAAATGAATAGCCTCAAACCTGAAGACACGGCCGTTTATTTCTGTGCACTGGGAGTG ACTGCAGCCTGTTCAGATAATCCCTACTTCTGGGGCCAGGGGACCCAGGTCACCGTCTCCTCAGCGTCGACCGAG CCCAAATCTTGTGACAAAACTCACACATGCCCACCGT
  • the one or more amino acid modifications are in the framework regions, i.e. not in the CDR region or regions. In some embodiments, the one or more polynucleotide modifications are in the CDR region or regions. In some embodiments, the one or more polynucleotide modifications are in the framework regions, i.e. not in the CDR region or regions. In some embodiments, the one or more amino acid modifications are in the CDR region or regions and the framework regions. In some embodiments, the one or more polynucleotide modifications are in the CDR region or regions and the framework regions.
  • the CDR3 regions comprise between 0 and 7, 0 and 6, 0 and 5, 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR2 regions comprise 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the CDR1 regions comprise 0 and 4, 0 and 3, 0 and 2 or 0 and 1 amino acid modifications.
  • the modifications can be substitutions, deletions or insertions. In one embodiment, the modifications are substitutions.
  • a single domain antibody or antigen binding molecule of the invention comprising one or more modifications has a binding affinity for the receptor binding domain of the SARS-CoV-2 S-protein that is substantially equal to, or better than (for example, a lower Kd value) than the specified sequence without any modifications.
  • the single domain antibodies or coronavirus binding molecules of the invention bind to the receptor binding domain of the SARS-CoV-2 S-protein.
  • the single domain antibodies or coronavirus binding molecules of the invention block or modulate the binding between the receptor binding domain of a coronavirus, in particular the SARS-CoV-2 spike (S) protein, and the angiotensin converting enzyme 2 receptor (ACE2 receptor).
  • the single domain antibodies or coronavirus binding molecules of the invention inhibit binding of the receptor binding domain of the SARS-CoV-2 spike (S) protein to the ACE2 receptor, wherein binding of the receptor binding domain of the SARS-CoV-2 spike (S) protein to the ACE2 receptor is inhibited by at least 10%, optionally at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or 100%. Percentage inhibition of binding to the ACE2 receptor can be measured in numerous ways, as well understood by the skilled person, including but not limited to surface plasmon resonance.
  • a coronavirus binding molecule wherein the first antigen binding molecule, when bound to the first epitope blocks the RBD of the coronavirus from binding to the human ACE2 protein.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention can neutralize coronavirus infection.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention can neutralize SARS-CoV-2 infection.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules have an ND50 value of less than 0.1nM less than 10pM, less than 5pM, less than 1pM, less than 0.5pM or less than 0.1pM.
  • the ND50 value can be determined using any standard neutralization assay, including that disclosed herein.
  • administration of the single domain antibodies, multivalent polypeptides , fusion proteins or coronavirus binding molecules of the present invention prevents or substantially reduces non-neutralised virus from replicating and/or spreading.
  • single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the present invention are capable of forming plaques that are 5% smaller than in the presence of a positive control, for example CR3022.
  • the plaques are 10% smaller than in the presence of a positive control (for example CR3022); in some embodiments, plaques are 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% smaller than in the presence of a positive control (for example CR3022).
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention have a Kd value for SARS-CoV-2 spike protein of less than 500pM, less than 400pM, less than 200pM, less than 100pM, less than 75pM, less than 50pm, less than 25pM, less than 10pM, less than 5pM, less than 1pM or less than 0.1pM. Binding affinity can be measured according to several standard well-known techniques, including for example surface plasma resonance.
  • a single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule of the invention having one or more modifications as specified herein has a binding affinity value that is within 20% (i.e.
  • the binding affinity value of a single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule of the invention having one or more modifications as specified herein is within 10%, optionally 5%, 4%, 3%, 2% or 1% of the binding affinity value of the corresponding single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule without one or more modifications.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention can modulate, reduce or prevent coronavirus infectivity.
  • the single domain antibodies, multivalent polypeptides or fusion proteins of the invention can modulate, block or inhibit the fusion of a coronavirus to a target host cell.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention can modulate, block or inhibit entry of coronavirus into a target host cell.
  • an affinity matured mutant of a single domain antibody of the invention is provided.
  • the CDR1 of the single domain antibody of the invention is affinity matured.
  • the CDR2 of the single domain antibody of the invention is affinity matured.
  • the CDR3 of the single domain antibody of the invention is affinity matured.
  • CDR3 is affinity matured and either CDR1 or CDR2 are also affinity matured.
  • CDR3 is affinity matured and CDR2 is also affinity matured.
  • CDR3 is affinity matured and CDR1 is also affinity matured.
  • each of CDR1, CDR2 and CDR3 are affinity matured.
  • at least one, at least two, at least three or all four of the framework regions (FR1, FR2, FR3 and FR4) are affinity matured.
  • each of CDR1, CDR2, CDR3, FR1, FR2, FR3 and FR4 are affinity matured.
  • the affinity of the affinity matured mutant of a single domain antibody of the invention has a higher affinity for SARS- CoV-2 receptor binding domain (RBD) than the parental antibody from which it was derived.
  • a humanized single domain antibody of the invention is provided. Humanization requires the modification of the amino acid sequence of the antibody. Methods to reduce the immunogenicity of the single domain antibodies of the invention include CDR grafting on to a suitable antibody framework scaffold or remodelling variable surface residues, e.g. by site- directed mutagenesis. Methods of humanization of Nanobodies® are known to the skilled person, see for example Vincke et al., 2009. In one embodiment, the CDR1 of the single domain antibody of the invention is humanized.
  • the CDR2 of the single domain antibody of the invention is humanized.
  • the CDR3 of the single domain antibody of the invention is humanized.
  • at least one or at least two of the CDR1, CDR2 and CDR3 are humanized.
  • each of CDR1, CDR2 and CDR3 are humanized.
  • at least one, at least two, at least three or all four of the framework regions (FR1, FR2, FR3 and FR4) are humanized.
  • each of CDR1, CDR2, CDR3, FR1, FR2, FR3 and FR4 are humanized.
  • the single domain antibodies are conservatively humanised, for example to retain better antigen binding.
  • a vector suitable for expressing a single domain antibody, multivalent polypeptide or fusion protein sequence of the invention is provided.
  • the vector may be a plasmid, viral vector, cosmid, phage or artificial chromosome.
  • a host cell comprising an expression vector or plasmid, wherein the expression vector or plasmid comprises a polynucleotide of the invention is provided.
  • the host cell comprises a polynucleotide of the invention integrated within the genome of the host cell.
  • the host cell is a prokaryotic cell, for example a bacterial cell, or a eukaryotic cell, for example a yeast cell or mammalian cell.
  • the host cell is Escherichia coli or CHO cells.
  • a method for producing a single domain antibody, multivalent polypeptide or fusion protein of the invention comprising the steps of (a) culturing a host cell as provided herein under conditions suitable for producing a single domain antibody, multivalent polypeptide or fusion protein to obtain a culture containing single domain antibodies, multivalent polypeptides or fusion proteins and (b) isolating said single domain antibodies from the culture.
  • One aspect of the invention provides single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules as defined above in a composition or pharmaceutical composition.
  • compositions may comprise, consist essentially of or consist of the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention.
  • a pharmaceutical composition comprising single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention is provided.
  • the pharmaceutical compositions may be for human or animal usage in human and veterinary medicine.
  • the pharmaceutical composition may be formulated according to route of administration.
  • the pharmaceutical composition is formulated for oral, nasal, ocular, buccal, vaginal, rectal, transdermal, intravenous, intramuscular or subcutaneous administration.
  • the pharmaceutical composition is formulated for administration by inhalation, optionally nasal and or oral inhalation.
  • compositions in this form may include aerosols, fine particles or dust.
  • the composition or pharmaceutical composition optionally comprises one or more pharmaceutically acceptable excipients.
  • the composition or pharmaceutical composition optionally comprises one or more pharmaceutically acceptable adjuvants.
  • the composition or pharmaceutical composition is optionally admixed with one or more pharmaceutically acceptable diluents, excipients or carriers. Examples of such suitable excipients for the different forms of pharmaceutical compositions described herein may be found in the "Handbook of Pharmaceutical Excipients, 2 nd Edition, (1994), Edited by A Wade and PJ Weller.
  • the composition or pharmaceutical composition may comprise one or more additional components.
  • the composition or pharmaceutical composition additionally comprises a pharmaceutically acceptable carrier.
  • the carrier is suitable for pulmonary delivery.
  • the composition or pharmaceutical composition additionally comprises a therapeutically active agent.
  • the composition or pharmaceutical composition may be joined or conjugated to a protein or biologically active molecule.
  • the composition or pharmaceutical composition is part of a fusion protein and fused to one or more proteins or biologically active molecules.
  • the protein or biologically active molecule may be a fluorescent protein, a bioluminescent protein, a split fluorescent protein (i.e. split into two or more parts that will join together in the presence of drug), a split bioluminescent protein, a biosensor, a fluorescent biosensor or a split or hinged biosensor.
  • a vaccine comprising single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention.
  • the vaccine comprises a polynucleotide encoding a single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule of the invention is provided.
  • the compositions, pharmaceutical compositions and vaccines of the invention can elicit an immune response in a subject, preferably an immune response to SARS-CoV-2.
  • the immune response is a protective immune response.
  • the immune response that reduces the symptoms or severity of SARS-CoV-2 in a subject.
  • a pharmaceutical device for example an inhaler or nebulizer, suitable to administer the pharmaceutical compositions of the invention is also provided.
  • the pharmaceutical device for example an inhaler or nebulizer, comprises a single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule of the invention.
  • a kit providing single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention is also provided. Such kits may include instructions for use and/or additional pharmaceutically active components.
  • the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules and the additional pharmaceutically active components may be formulated together, or alternatively in some embodiments, the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules and the additional pharmaceutically active components may be present separately in the kit.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can be used to treat a coronavirus, optionally Middle Eastern respiratory syndrome (MERS- CoV) or severe acute respiratory syndrome coronavirus 1 (SARS-CoV-1), preferably COVID- 19.
  • MERS- CoV Middle Eastern respiratory syndrome
  • SARS-CoV-1 severe acute respiratory syndrome coronavirus 1
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can be used to treat specific strains of COVID-19, including the prototypical Wuhan/Victoria strain, the B.1.1.7 variant (UK or Kent variant / Alpha), the B.1.351 variant (South African variant / Beta), the P.1 variant (Brazilian / Gamma), the B.1.617.2 variant (Indian variant/ Delta), the B.1.427 / B.1.429 variant (Epsilon), the P.2 variant (Zeta), The B.1.525 variant (Eta), the P.3 variant (Theta), the B.1.526 variant (Iota) and the B.1.617.1 variant (Kappa).
  • the prototypical Wuhan/Victoria strain the B.1.1.7 variant (UK or Kent variant / Alpha)
  • the B.1.351 variant South African variant / Beta
  • the P.1 variant Brazilian / Gamma
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can be used to block or modify the interaction of the spike protein of a coronavirus, in particular SARS-CoV-2, with its target, angiotensin converting enzyme 2 receptor.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention block, reduce or inhibit binding of the spike protein of a coronavirus, in particular SARS-CoV-2, with its target, angiotensin converting enzyme 2 (ACE2) receptor.
  • ACE2 angiotensin converting enzyme 2
  • the single domain antibodies, multivalent polypeptides, fusion proteins or pharmaceutical compositions of the invention can neutralize coronavirus and/or can modulate, reduce or prevent coronavirus infectivity.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can modulate, block or inhibit the fusion of coronavirus to a target host cell.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can modulate, block or inhibit entry of coronavirus into a target host cell.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention can be used for the treatment or prophylaxis of coronavirus infection, in particular COVID-19.
  • a single domain antibody, multivalent polypeptide, fusion protein, coronavirus binding molecule or pharmaceutical composition of the invention for use in the treatment or prophylaxis of a coronavirus infection optionally Middle Eastern respiratory syndrome (MERS-CoV) or severe acute respiratory syndrome coronavirus 1 (SARS-CoV-1), preferably COVID-19.
  • MERS-CoV Middle Eastern respiratory syndrome
  • SARS-CoV-1 severe acute respiratory syndrome coronavirus 1
  • a single domain antibody, multivalent polypeptide, fusion protein, coronavirus binding molecule or pharmaceutical composition of the invention for use in the treatment or prophylaxis of COVID-19.
  • a method for the treatment of a coronavirus in a subject comprising administering to a subject a therapeutically active amount of a single domain antibody, multivalent polypeptide, fusion protein, coronavirus binding molecule or pharmaceutical composition of the invention.
  • the subject is a mammal, preferably a human.
  • the use of a single domain antibody, multivalent polypeptide, fusion protein, coronavirus binding molecule or pharmaceutical composition of the invention in the manufacture of a medicament for use in the treatment and/or prevention of a coronavirus is provided.
  • the use of a single domain antibody, multivalent polypeptide, fusion protein, coronavirus binding molecule or pharmaceutical composition of the invention in the manufacture of a medicament for use in the treatment of a coronavirus is provided.
  • the coronavirus is selected from the group consisting of MERS-CoV, SARS-CoV-1 and COVID-19. In one embodiment, the coronavirus is COVID-19.
  • the coronavirus is a COVID-19 strain selected from the prototypical Wuhan/Victoria strain, the B.1.1.7 variant (UK or Kent variant / Alpha), the B.1.351 variant (South African variant / Beta), the P.1 variant (Brazilian / Gamma), the B.1.617.2 variant (Indian variant/ Delta), the B.1.427 / B.1.429 variant (Epsilon), the P.2 variant (Zeta), The B.1.525 variant (Eta), the P.3 variant (Theta), the B.1.526 variant (Iota) and the B.1.617.1 variant (Kappa).
  • the invention may relate to treating a subject displaying severe symptoms of COVID- 19 or alternatively to treating a subject showing milder symptoms of COVID-19 or alternatively to treating a subject who has tested positive for COVID-19 but is asymptomatic for the disease.
  • the single domain antibodies, multivalent polypeptides, fusion proteins, coronavirus binding molecules or pharmaceutical compositions of the invention are useful for treating a cytokine storm associated with a coronavirus infection.
  • a trivalent polypeptide of the invention comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on C1 is provided for use in treating COVID-19 ( Wuhan/Victoria strain), the B.1.1.7 COVID_19 variant (UK or Kent variant / Alpha) and/or the B.1.351 COVID-19 variant (South African variant / Beta),
  • a trivalent polypeptide of the invention comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on A8 is provided for use in treating COVID-19 ( Wuhan/Victoria strain), the B.1.1.7 COVID_19 variant (UK or Kent variant / Alpha) and/or the B.1.351 COVID-19 variant (South African variant / Beta)
  • a trivalent polypeptide of the invention comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on H3 is provided for use in treating COVID-19 ( Wuhan/Victoria strain), the B.
  • a trivalent polypeptide of the invention comprising three single domain amino antibodies having an amino acid or polynucleotide sequence based on C5 is provided for use in treating COVID-19 (Wuhan/Victoria strain) and/or the B.1.1.7 COVID_19 variant (UK or Kent variant / Alpha).
  • methods for the detection of a coronavirus protein such as MERS-CoV, SARS-CoV-1 and SARS-CoV-2 are provided.
  • a method for the detection of a SARS-CoV-2 protein is provided.
  • a method for detecting the presence of a coronavirus S-protein is provided.
  • a method for a method for detecting the presence of a SARS-CoV-2 S-protein comprises the steps of (a) contacting a sample with the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules of the invention and (b) detecting the antibody-antigen complex, wherein the presence of the complex indicates the presence of coronavirus protein.
  • step (a) of the method the sample is contacted with the single domain antibodies, multivalent polypeptides, fusion proteins or coronavirus binding molecules under suitable conditions for an antibody-antigen complex to form.
  • the antigen is the coronavirus protein.
  • a method for detecting the presence of a coronavirus S-protein is provided. In one embodiment, a method for a method for detecting the presence of a SARS-CoV-2 S-protein, optionally the receptor binding domain of the S- protein, is provided.
  • the sample can be a biological sample, optionally a bodily fluid such as blood, serum, nasal secretions, sputum, plasma, urine or spinal fluid. In one embodiment the biological sample is bodily fluid obtained using a throat or nasal swab. In one embodiment, the biological sample is a tissue sample. The sample can be obtained from or isolated from a mammal, preferably a human. In one embodiment, the sample is obtained from or isolated from a subject who is suspected to have coronavirus.
  • Detecting the presence of coronavirus protein in a sample from a subject provides a positive indication that the subject is infected with coronavirus.
  • the results of the method of detection are used to diagnose a subject in relation to coronavirus.
  • the presence of coronavirus protein in the method of detection would provide a positive diagnosis for coronavirus.
  • the method of detection may also be used to provide a prediction of outcome in relation to infection of coronavirus infection.
  • a method for detecting coronavirus protein in a subject comprises the steps of (a) administering to a subject a single domain antibody, multivalent polypeptide, fusion protein or coronavirus binding molecule of the invention and (b) detecting the presence of an antibody-antigen complex, wherein the presence of the complex indicates the presence of coronavirus protein in the subject.
  • a method for detecting coronavirus protein in a subject comprises the steps of (a) administering to a subject a single domain antibody of the invention, (b) obtaining a sample from a subject and contacting the sample with a single domain antibody of the invention and (c) detecting the antibody-antigen complex, wherein the presence of the complex indicates the presence of coronavirus protein in the subject.
  • the antigen is the coronavirus protein.
  • a method for detecting coronavirus protein in a subject comprises the steps of (a) obtaining a sample from a subject, (b) contacting a sample from the subject with a single domain antibody of the invention and (c) detecting the antibody-antigen complex, wherein the presence of the complex indicates the presence of coronavirus protein in the subject.
  • the sample may be an isolated sample (i.e. previously obtained from a subject).
  • a method for diagnosing coronavirus infection in a subject comprises the steps of (a) administering to a subject a single domain antibody of the invention and (b) detecting the presence of an antibody-antigen complex, wherein the presence of the complex provides a positive diagnosis of coronavirus in the subject.
  • a method for diagnosing coronavirus infection in a subject comprises the steps of (a) administering to a subject a single domain antibody of the invention, (b) obtaining a sample from a subject and contacting the sample with a single domain antibody of the invention and (c) detecting the antibody-antigen complex, wherein the presence of the complex provides a positive diagnosis of coronavirus in the subject.
  • a method for diagnosing coronavirus infection in a subject comprises the steps of (a) obtaining a sample from a subject, (b) contacting a sample from the subject with a single domain antibody of the invention and (c) detecting the antibody-antigen complex, wherein the presence of the complex provides a positive diagnosis of coronavirus in the subject.
  • a method for diagnosing coronavirus infection in a subject comprising (a) contacting a sample with a single domain antibody of the invention, (b) detecting the number of antibody-polypeptide complexes and (c) detecting the presence of coronavirus in the sample, wherein the presence of the complex provides a positive diagnosis of coronavirus in the subject.
  • the sample may be an isolated sample (i.e. previously obtained from a subject).
  • the method comprises the step of comparing the sample with reference sample values for levels of the antibody-antigen complex. An antigen-antibody complex value above that of the reference sample value can provide a positive indication of coronavirus infection.
  • the sample may be an isolated sample (i.e. previously obtained from a subject).
  • the single domain antibody of the invention may further comprise a marker such as a radiolabelled marker, imaging marker, MRI-marker, fluorescent marker or other detectable marker.
  • a marker such as a radiolabelled marker, imaging marker, MRI-marker, fluorescent marker or other detectable marker.
  • Such antibodies can be used in each of the detection or diagnosis methods described herein to enable the detection of the antibody in the subject in real time.
  • Such antibodies can also be used in each of the detection or diagnosis methods described herein to enable the detection of the antibody in a sample, such as a tissue or blood sample, isolated or obtained from a subject.
  • an assay to detect a coronavirus comprises (a) contacting a sample obtained from a patient with a single domain antibody of the invention, wherein the single domain antibody comprises a detectable label or reporter molecule to selectively isolate the coronavirus in the patient sample.
  • an assay to detect coronavirus comprises (a) contacting a sample obtained from a patient with a fusion protein comprising a single domain antibody of the invention and a biosensor, optionally a fluorescent or hinged biosensor,
  • the assay may for example be an enzyme-linked immunosorbent assay (ELISA), an immunofluorescence assay, a radioimmunoassay (RIA) or a fluorescence-activated cell sorting (FACS).
  • the detectable label or reporter molecule can be a fluorescent or chemical molecule (e.g. fluorescein isothiocyanate, or rhodamine), a biosensor, a radioisotope or enzyme (e.g.
  • kits comprising (a) a detectable marker (b) a single domain antibody of the invention.
  • the detectable label or reporter molecule can be a fluorescent or chemical molecule (e.g. fluorescein isothiocyanate, or rhodamine), a biosensor, optionally a fluorescent or hinged biosensor or a radioisotope or enzyme (e.g. alkaline phosphatase, ⁇ -galactosidase, horseradish peroxidase or luciferase).
  • the methods described herein can be in vitro or ex vivo.
  • the methods described herein can also be performed in vivo.
  • the invention is described by reference to the following non-limiting Examples. Apart from where specified otherwise, the SARS-CoV-2 strain used in the below examples is prototypical Wuhan/Victoria variant (‘WT’).
  • WT prototypical Wuhan/Victoria variant
  • EXAMPLE 1 The amino sequences of single-domain antibodies (or nanobodies) that specifically bind protein to the Spike (S) protein of SARS-CoV-2 are described.
  • the expressed proteins bind to the receptor-binding domain (RBD) of the virus with high, picomolar affinity.
  • Antibodies to the receptor-binding domain of SARS-CoV-2 were raised in a llama by primary immunisation with a combination of purified RBD alone and fused to human IgG1, followed by a single boost with purified S protein mixed with RBD.
  • a phage display VHH library was constructed from the cDNA of peripheral blood mononuclear cells, and two rounds of bio- panning selected RBD binders. The phage clones with the highest affinity for RBD were identified by an inhibition ELISA and classified by sequencing into unique complementary determining region 3 (CDR3).
  • H11- H4 with a KD of 5 nM (Huo, Le Bas et al.2020).
  • H11-H4-Fc for binding to RBD in an ELISA format was used to identify not only new binders from the immunised library that bound to the same epitope as H11-H4 but with higher affinity but also ones that recognised different epitopes.
  • VHHs were selected for production and further characterization: (1) B12 – SEQ ID NO: 16 (2) F2 – SEQ ID NO: 17 (3) C1 – SEQ ID NO: 18 (4) C5 – SEQ ID NO: 19 (5) H3 – SEQ ID NO: 20 Immunisation and construction of VHH library Prototypical (Wuhan/Victoria) SARS-CoV-2 receptor-binding domain (amino acids 330-532), SARS-CoV-2 receptor-binding domain fused to hIgG1 Fc (RBD-Fc) and trimeric Spike protein (amino acids 1-1208) were produced as described by Huo et al 2020.
  • Antibodies were raised in a llama by intramuscular immunization with 200 ⁇ g of recombinant RBD and 200 ⁇ g of RBD- Fc on day 0, and then 200 ⁇ g RBD and 200 ⁇ g S protein on day 28.
  • the adjuvant used was Gerbu LQ#3000.
  • Blood 150 ml was collected on day 38. Immunizations and handling of the llama were performed under the authority of the project license PA1FB163A.
  • Peripheral blood mononuclear cells were prepared using Ficoll-Paque PLUS according to the manufacturers protocol; total RNA extracted using TRIzolTM; reverse transcription and PCR was carried using SuperScript IV Reverse Transcriptase using reverse transcription primer: CALL_GSP (5’- CCTGCGGCTCCCGGGTCTGCCCTTTGGCC -3’)
  • CALL_GSP 5’- CCTGCGGCTCCCGGGTCTGCCCTTTGGCC -3’
  • the pool of VHH encoding sequences were amplified by PCR using primers as given in Table 1.
  • Table 1 Primers used for PCR amplification of VHH encoding sequences. Following purification by agarose gel electrophoresis, the VHH cDNAs were cloned into the SfiI sites of the phagemid vector pADL-23c.
  • the VHH encoding sequence is preceded by a pelB leader sequence followed by a linker, His6 and cMyc tag (GPGGQHHHHHHGAEQKLISEEDLS).
  • Electro-competent E.coli TG1 cells were transformed with the recombinant pAD-23c vector resulting in a VHH library of about 4 x 10 9 independent transformants.
  • the resulting TG1 library stock was then infected with M13K07 helper phage to obtain a library of VHH-presenting phages.
  • VHHs displaying VHHs specific for the RBD of SARS-CoV-2 were enriched after two rounds of bio-panning on 50 nM and 2 nM of biotinylated RBD respectively, through capturing with DynabeadsTM M-280 (Thermo Fisher Scientific). Enrichment after each round of panning was determined by plating the cell culture with 10-fold serial dilutions. After the second round of panning, 93 individual phagemid clones were picked, VHH displaying phages were recovered by infection with M13K07 helper phage and tested for binding to RBD by a combination of competition and inhibition ELISAs.
  • RBD was immobilized on a 96-well plate and binding of phage clones was measured in the presence of excess soluble RBD (inhibition ELISA) or the RBD-binding H11-H4-Fc (Huo, Le Bas et al.2020) (competition ELISA). Phage binders were ranked according to the inhibition assay and then classified as either competitive with H11-H4 (i.e. sharing the same epitope) or non-competitive (i.e. binding to a different epitope on RBD). Clones were sequenced and grouped according to CDR3 sequence identity.
  • VHH monovalent VHH were cloned into the vector pOPINO (Bird, Rada et al.2014) containing an OmpA leader sequence and C-terminal His6 tag through Infusion reaction, the pOPINO vector having been digested with KpnI and PmeI. The resulting vectors were transformed into the WK6 E. coli strain and protein expression induced by 1mM IPTG grown overnight at 20 °C.
  • pOPINO Bord, Rada et al.2014
  • Periplasmic extracts were prepared by osmotic shock and VHH proteins purified by immobilised metal affinity using an automated protocol implemented on an ⁇ KTAxpress followed by a Hiload 16/60 Superdex 75 or a Superdex 7510/300GL column, using phosphate- buffered saline (PBS) pH 7.4 buffer.
  • Bivalent polypeptides were also produced by fusion of VHHs to IgG Fc, for instance C5-Fc (SEQ ID NO: 170) which dimerises to bivalent (C5-Fc)2.
  • C5-Fc SEQ ID NO: 170
  • VHHs were cloned into the vector AbVec-hIgG1 and digested with AgeI and SalI.
  • AbVec-hIgG1 contains a murine heavy chain leader sequence and a human IgG1 Fc.
  • Other Fcs are likewise suitable, including, for example, IgG4 with or without stabilising and/or humanising modifications, such as S288P and those modifications taught in, for example, Atyeo et al.2020, Suzuki et al.2018, and Dumet et al 2019.
  • the Fc fusion proteins were purified by affinity chromatography on Protein A-sepharose (Huo, Le Bas et al.2020).
  • Binding activity The RBD binding kinetics of the five selected single-domain antibodies were measured by surface plasmon resonance (SPR) and the calculated KD values showed that affinities were in the picomolar range (Table 2).
  • Table 2 SPR RBD binding kinetics of isolated VHHs produced in E.coli (data from repeat assays with multiple injections of analyte of C1, H3, F2, and C5) Competition binding experiments were carried out by SPR to investigate whether the VHHs blocked the binding of RBD to ACE2 and the overlap with the epitope recognized by the human monoclonal antibody CR3022 (Jan ter Meulen Edward N. van den Brink Leo L. M. Poon 2006) and or H11-H4 (Huo, Le Bas et al.
  • C1 and F2 belong to the group of antibodies (cluster 1 antibodies (Kuan-Ying et al 2021) including CR302221 and EY-6A24 that bind to a region distinct from the ACE2 receptor binding interface. These two antibodies have been reported to destabilize the trimeric spike protein and by this mechanism prevent receptor engagement (Huo, J et al 2020; Zhou, D et al 2020) thereby neutralizing the virus.
  • the surface plasmon resonance experiments were performed using a Biacore T200 (GE Healthcare). All assays were performed using a Sensor Chip Protein A (GE Healthcare), with a running buffer of PBS pH 7.4 supplemented with 0.005% v/v Surfactant P20 (GE Healthcare) at 25 °C.
  • RBD-Fc was immobilized onto the sensor chip.
  • Fc-fusion of the antibodies were immobilised and RBD was injected over the sensor chip. All data were fitted to a 1:1 binding model using the Biacore T200 Evaluation Software 3.1.
  • competition assays ⁇ 1,000 RU CR3022-Fc, ACE2-Fc, or H11-H4-Fc were immobilized as the ligand, isolated VHHs incubated with RBD were used as analyte. Competition assays were performed with a Sensor Chip Protein A (Cytiva).
  • VHH-Fc fusions were serially diluted into Dulbecco’s Modified Eagles Medium (DMEM) containing 1 % (w/v) foetal bovine serum (FBS) in a 96-well plate.
  • DMEM Modified Eagles Medium
  • FBS foetal bovine serum
  • the neutralization titre was defined as the titre of VHH-Fc that reduced the Foci forming unit (FFU) by 50% compared to the control wells.
  • Monovalent VHH C5 neutralises SARS-CoV2 with an IC50 of 32nM ( Figure 8B).
  • X-ray crystallography and structural analysis The crystal structures of the C5-RBD complex ( Figure 1A) and the F2-RBD complex ( Figure 1B) were solved by X-ray crystallography.
  • VHH_C5 or VHH_C1 was mixed with de- glycosylated RBD at molar ratio of 1:1, and the complex purified by size exclusion chromatography as described by Huo et al.2020. Crystals were grown at 20 °C by sitting drop vapour diffusion, and diffraction data collected and processed at the Diamond Light Source. The structure was solved by molecular replacement using standard methods and PDB id 6YZ5 as the search model and has been refined to high resolution.
  • the C5 – RBD structure ( Figure 1A) showed that the epitope recognized by C5 overlaps very substantially overlapping the RBD binding site for ACE2 ( Figure 3A). Thus it is clear why C5 prevents ACE2 binding and is potently neutralising.
  • the C5 epitope partly overlaps with the H11 class of nanobody epitope (e.g. H11-H4) that explains why C5 also competes with H11- H4 for binding to RBD.
  • the literature has identified another epitope (the CR3022 epitope), which is located in a different region of the RBD ( Figure 3B).
  • the structure of F2 and, separately, C1 bound to the RBD show that both F2 and C1 overlap with this CR3022 epitope.
  • Cryo-EM protein purification and data collection The structure of Spike-C5 trimer was determined through single particle electron microscopy (‘EM’) ( Figure 2).
  • the RBD-WT was used a as template to generate the Alpha RBD variant, by amplifying two fragments with pairs of primers (1) TTGneo_RBD_F and N501Y_R and (2) TTGneo_RBD_R and N501Y_F which were then joined together by PCR using primer TTGneo_RBD_F and TTGneo_RBD_R (see Table 4).
  • the Alpha RBD gene product was then cloned into the pOPINTTGneo vector by Infusion® cloning.
  • the Alpha RBD was used as a template to generate the Beta RBD by amplifying two fragments with primers of (1) TTGneo_RBD_F and E484K_R and (2) TTGneo_RBD_R and E484K_F; the two fragments were then joined together by PCR primers TTGneo_RBD_F and TTGneo_RBD_R.
  • the gene product was then cloned into the pOPINTTGneo vector by Infusion® cloning to create an intermediate vector which was then used as template to amplify two fragments with pairs of primers of (1) TTGneo_RBD_F and K417V_R and (2) TTGneo_RBD_R and K417V_F; the two fragments were then joined together with a PCR reaction using primer TTGneo_RBD_F and TTGneo_RBD_R.
  • the final Beta RBD gene product was then cloned into the pOPINTTGneo vector by Infusion® cloning.
  • the RBD genes from the pOPINTTGneo vector were amplified by a pair of primers TTGneo_RBD_F and RBD_Fc_R, followed by being cloned into the pOPINTTGneo-Fc vector by Infusion® cloning.
  • the pOPINTTGneo-Fc contains a mu-phosphatase leader sequence, a huIgG1 Fc and C- terminal His6 tag44.
  • Delta RBD was amplified by PCR from a plasmid containing the full length Delta spike DNA and cloned into pOPINTTGneo by Infusion cloning.
  • Binding to SARS-CoV-2 RBD variants The binding of the VHHs (C1,C5, H3 and F2) to RBDs of SARS-CoV-2 variants was measured by SPR. As expected from structural analyses neither C5 or H3 bound to the Beta variant (lineage B.1.351) originally identified in South Africa due to the charge change mutation of residue 484 from Glu to Lys that forms a critical salt bridge interaction with C5 and H3 in the WT RBD complex. Binding of C5 to the Alpha variant was significantly reduced compared to the RBD-WT probably due to the mutation of N501Y in the Alpha RBD that is involved in the interaction with C5. Binding of H3 which does to interact with N501 was only marginally reduced. By contrast, binding of C1 and F2 that recognise a different region of the RBD was not affected by the either the N501Y or E484K mutations.
  • Table 5 Binding affinities to the RBDS of SARS-CoV-2 variants determined by SPR EXAMPLE 2 Two strategies were used to obtain new VHH binders to the SARS-CoV-2 variants and in particular the Beta strain (lineage B.1.351) that was originally detected in South Africa.
  • Example 1 generated from a llama immunised with the prototypical (Wuhan/Victoria) spike protein (200 ⁇ g of recombinant RBD and 200 ⁇ g of RBD-Fc on day 0, 200 ⁇ g RBD and 200 ⁇ g S protein on day 28, 200 ⁇ g RBD and 200 ⁇ g S protein on day 56, blood (150 ml) was collected on day 65) was re-screened with the RBD of the Beta strain containing the mutations E484K and N501Y.
  • the prototypical (Wuhan/Victoria) spike protein 200 ⁇ g of recombinant RBD and 200 ⁇ g of RBD-Fc on day 0
  • 200 ⁇ g RBD and 200 ⁇ g S protein on day 28 200 ⁇ g RBD and 200 ⁇ g S protein on day 56
  • blood 150 ml
  • was collected on day 65 was re-screened with the RBD of the Beta strain containing the mutations E484K and N501Y.
  • the library was pre-incubated with NbSA_A10 to remove VHH binders that bind to the same or similar epitope and then re-screened with SA RBD. From this iterative screen, a number of new nanobodies were isolated and their binding kinetics measured by SPR (Table 6). Of these, A8 had the highest binding affinity for RBD (KD of 35 pM) ( Figure 13a) and was shown to compete with ACE-2 and CR3022 for binding to SA RBD ( Figure 13b). Table 6: SPR RBD binding kinetics of nanobody analytes.
  • VHH_H6 competed with ACE-2 binding but not CR3022 ( Figure 19) placing its binding site at or close to the ACE-2 interaction surface and therefore likely to block virus infection of cells in a neutralisation assay.
  • the epitope recognized by H6 was mapped by determining the structure of the VHH_H6-RBD complex by X-ray crystallography identifying a novel antibody epitope on the surface of the RBD distinct from that of C5 and H3 ( Figure 20).
  • residue 484 in the RBD that is mutated in the Beta (E484K), Gamma(E484K) and Kappa (E484Q) variants disrupting the binding by some human monoclonal antibodies (Zhou et al 2021), is not involved in the binding site.
  • Table 17 Binding kinetics determined by SPR EXAMPLE 3 Joining two or more of the same VHHs together creates a monospecific bivalent polypeptide that is predicted to bind with higher affinity than the monovalent VHH due to the effect of avidity. To test this, three bivalent versions of VHH C5 were designed as single polypeptides and constructed by PCR.
  • Periplasmic extracts were prepared by osmotic shock and VHH proteins purified by immobilised metal affinity using an automated protocol implemented on an ⁇ KTAxpress followed by a Hiload 16/60 superdex 75 or a Superdex 7510/300GL column, using phosphate- buffered saline (PBS) pH 7.4 buffer. Binding activity Binding activity was measured by SPR according to the methodology provided in Example 1. All curves were plotted using GraphPad Prism 8. SPR kinetic analysis of binding of C5 polypeptides to the trimeric spike protein revealed astonishingly tight binding of mono-specific bivalent C5 polypeptides (Table 4; Figure 7).
  • the single-figure dissociation constants achieved with the C5 VHHs joined by the linkers AAA and 6GS-SUMO-6GS are very low and comparable to the results for the bivalent C5-Fc described in Example 1.
  • All monospecific bivalent C5 structures tested perform equivalently in an SPR biophysical assay of binding to trimeric spike protein (Table 4; Figure 7).
  • the on rates (denoted by the initial steep, positive gradient in Figure 7) are comparable for all ligands.
  • the downward slope is the off rate.
  • the monospecific bivalent molecules all have slow off rates (almost no wash off) and areakily tight binders (as shown by the single figure pM dissociation constants).
  • Table 18 SPR Trimeric spike binding kinetics of C5 and C5 bivalent polypeptides; C5-Fc was produced in mammalian cells and C5, C5-AAA-C5, C5-9GS-C5, and C5-6GS-SUMO-6GS-C5 E. coli.
  • EXAMPLE 4 Joining two or more different VHHs together creates a bispecific bivalent polypeptide, also known as bidentate. These bidentate polypeptides are predicted to bind with higher affinity than the monovalent VHHs due to the effect of avidity. Further, having two or more joined different VHHs is predicted to confer further functional benefit and utility.
  • SUMOs are a family of small ( ⁇ 11.6 KDa) proteins involved in the post-translational modification of proteins and play a role in variety of cellular processes including cell cycle regulation and subcellular transport (Hay 2005).
  • the design of the bidentate molecule followed this logic (N’- VHH to epitope 1 – (GS)6 – SUMO – (GS)6 VHH to epitope 2 - C’) or vice versa.
  • SUMO is a rigid molecule and will thus promote rigidity, minimising entropic penalty.
  • the distance end to end of SUMO is 32 ⁇ . Thus at least a further 20 ⁇ separation are needed (around 6 to 8 residues as an elongated strand).
  • the GS residues were introduced to allow both nanobodies to bind their respective epitopes thus gaining enthalpy. They introduce an entropic penalty. This is explicitly part of the design, adding or removing residues (including Pro and the other 17 natural residues) within the GS region to optimise the balance between maximising enthalpic gain and minimising entropic penalty.
  • Protein production Bidentate antibody polypeptides described here consists of three parts: the N-terminal VHH, the SUMO in the middle and the C-terminal VHH.
  • the genes encoding each of these components were amplified by PCR and joined together by strand overlap PCR with primers AbVec_NSN_F1 and AbVec_NSN_R3 (Table 5).
  • the resulting PCR fragment was then cloned into an engineered AbVec-hIgG1 vector digested with AgeI and SalI
  • the AbVec-hIgG1 vector contains a murine heavy chain leader sequence and a human IgG1 fusion.
  • Fcs are likewise suitable, including, for example, IgG4 with or without stabilising and/or humanising modifications, such as S288P and those modifications taught in, for example, Atyeo et al.2020, Suzuki et al.2018, and Dumet et al 2019.
  • S288P stabilising and/or humanising modifications
  • the proteins were purified by affinity chromatography on Protein A-sepharose (Huo, Le Bas et al. 2020).
  • Binding activity was measured by SPR according to the methodology provided in Example 1. It was found that combining VHH_C1 with either VHH_H3 or VHH_H11-H4 results in an approximately 40-fold increase in affinity (Table 10). Combining C1 with C5 results in an approximately 240-fold increase in affinity. Combining F2 with C5 results in an approximately 85-fold increase in affinity.
  • the F2-SUMO-VHH_H6-Fc F2-SUMO-C5-Fc, and C1-SUMO-C5-Fc biparatopic bivalent polypeptides display remarkably high binding affinities, with dissociation constants of 0.6, 0.75 and 1.63 pM respectively.
  • Neutralisation activity was measured by micro-titre neutralisation (‘MN’) assay according to the methodology provided in Example 1. Fc fusions were serially diluted into Dulbecco’s Modified Eagles Medium (DMEM) containing 1 % (w/v) foetal bovine serum (FBS) in a 96-well plate.
  • DMEM Modified Eagles Medium
  • FBS foetal bovine serum
  • SARS-CoV-2 Victoria strain passage 4 (vero 76) [9x10 4 pfu/ml] diluted 1:5 in DMEM-FBS was added to each well, with media only as negative controls. After incubation for 30 min at 37 °C Vero cells (100 ⁇ l) were added to each well and the plates incubated for 2 h at 37 °C. Carboxymethyl cellulose (100 ⁇ l of 1.5 % v/v) was then added to each well and the plates incubated for a further 18-20 h at 37 °C.
  • EXAMPLE 5 Trivalent versions of the four nanobodies, C5 (SEQ ID NO: 189), C1 (SEQ ID NO: 225) H3 (SEQ ID NO: 229) and A8 (SEQ ID NO: 221) were constructed by joining the VHH domains with a glycine-serine flexible linker, (GS)6.
  • the C1, C5, H3 and A8 gene fragments were used as templates to amplify three fragments by PCR with the following pairs of primers: TriNb_Neo_F1 and TriNb_R1; TriNb_F2 and TriNb_R2; TriNb_F3 and TriNb_Neo_R1 (Table C); the three fragments were then joined together with a PCR reaction using primers TriNb_Neo_F2 and TriNb_Neo_R2 (Table C). The trimeric gene product was then inserted into the pOPINTTGneo vector by Infusion® cloning.
  • pOPINTTG contains a mu-phosphatase leader sequence and C-terminal His6 tag44.
  • the nanobody homo-trimers (C5, C1, A8 and H3) were produced by transient expression in expi293 cells and purified by metal chelate affinity chromatography and size exclusion.
  • Table 11 Primers for trivalent VHH construction Potent neutralisation of SARS-CoV2 variants in vitro by trimeric nanobodies
  • the nanobody trimers C5 (SEQ ID NO: 189), C1 (SEQ ID NO: 225), H3 (SEQ ID NO: 229) A8 (SEQ ID NO: 221) were produced by transient expression in expi293 cells and purified by metal chelate affinity chromatography and size exclusion.
  • Binding of the trimeric nanobodies binding to the RBD was measured by SPR as per Example 1, and an approximate 10 to 100- fold enhancement in KD was observed compared to the monomers (Table 12).
  • the H3 trimer was shown to have a sub-picomolar KD for the RBD-WT (where WT is the Wuhan/Victoria strain), with an off rate of approximately 6 hours.
  • Binding of C5 trimer to the RBDs from both the SARS-CoV-2 Alpha (lineage B.1.1.7) and Delta variants (lineage B.1.167.2) was similar to RBD-WT whilst binding of C5 monomer was ⁇ 25-fold and ⁇ 100 fold weaker respectively (Table 5). Only C1 and A8 showed binding to the RBD (South Africa) from the SARS-CoV-2 Beta variant (Lineage B.1.351 (Table 12).
  • Micro-neutralisation assays were carried out (as per Example 1) to test the effectiveness of the three nanobody trimers to block infection of Vero E6 cells by either Victoria (WT), Alpha, Beta and Delta strains of the virus. All nanobodies potently neutralized some if not all the strains. As anticipated from the in vitro binding data, only A8 and C1 were active against the Beta strain. Although H3 bound more tightly than C5 to the RBDs in vitro, it was less potent than C5 against both WT and Alpha strains.
  • C5 was equipotent in neutralising the Victoria (WT), Alpha and Delta viruses whereas A8 and C1 neutralised all four strains (Table 13)
  • Table 13 Neutralisation of live viruses in the MN assay The neutralization potency of the C5 trimer was confirmed in the Gold Standard Plaque Reduction Neutralisation Test (PRNT) against the BVIC01 strain which gave an ND50 of 3 pM (data Fig.9).
  • PRNT Gold Standard Plaque Reduction Neutralisation Test
  • Plaque reduction neutralization tests were carried out at Public Health England using SARS-CoV-2 (hCoV-19/Australia/VIC01/2020) (GISAID accession number EPI_ISL_406844) generously provided by The Doherty Institute, Melbourne, Australia at P1 and passaged twice in Vero/hSLAM cells [ECACC 04091501]. Virus was diluted to a concentration of 933 p.f.u.
  • the virus-antibody mixture was transferred into the wells of a twice Dulbecco’s PBS-washed 24-well plate containing confluent monolayers of Vero E6 cells (ECACC 85020206, PHE) that had been cultured in MEM containing 10 % (v/v) FBS. Virus was allowed to adsorb onto cells at 37 °C for a further hour in a humidified box, then the cells were overlaid with MEM containing 1.5 % carboxymethyl cellulose (Sigma), 4 % (v/v) FBS and 25 mM HEPES buffer.
  • Antibody dilutions were run in duplicate and an internal positive control for the PRNT assay was also run in duplicate using a sample of heat-inactivated (56 °C for 30 min) human MERS convalescent serum pH 7.4, 137 mM NaCl, 1 mM CaCl ) and 1 mg ml ⁇ 1 trypsin (Sigma- Aldrich) to neutralize SARS-CoV-2 (National Institute for Biological Standards and Control, UK).
  • C5-Fc fusion shows therapeutic efficacy in vivo
  • To probe neutralization in vivo, we tested the C5-Fc fusion in the Syrian Hamster model of COVID-19 Choan, J.F. et al 2020; Imai, M. et al.
  • Histopathology and RNAScope ISH technique were used to compare the pathology and the presence of viral RNA in tissues from nanobody-treated and untreated control hamsters, combining a semiquantitative scoring system and digital image analysis to calculate the area of lung with pneumonia and the quantity of virus. Lesions consistent with infection with SARS- CoV-2 were observed only in the lungs and nasal cavity. No lesions were observed in any other organ studied. Virus RNA was only observed in the lung and nasal cavity.
  • the lung lesions consisted of a bronchointerstitial pneumonia showing areas of lung consolidation and were characterized by infiltration of macrophages and neutrophils, but also some lymphocytes and plasma cells.
  • the area with pneumonia was significantly reduced in the nanobody-treated hamsters, together with a marked reduction of histopathology scores in the nasal cavity (Statistically significant differences were also found for the presence of virus RNA in the lung or the nasal cavity (Fig.10)).
  • Fig.10 Statistically significant differences were also found for the presence of virus RNA in the lung or the nasal cavity (Fig.10)).
  • these results showed that a single therapeutic dose of C5-Fc administered IP reached the site of action in the lungs and nasal cavity and reduced viral load and associated pathology. Therefore, based on these positive results we undertook a larger study to evaluate the C5 trimer in the Syrian hamster model.
  • Trimeric C5 nanobody shows topical therapeutic efficacy
  • the smaller molecular size of the C5-trimer (40 kDa) compared to the C5-Fc (80 kDa plus 2N- linked glycans) makes this suitable for topical administration directly to the airways. Therefore, in the second animal study, the efficacy of the trimeric version of C5 was evaluated in the COVID-19 hamster model by administration using both IP and intranasal routes.
  • the study consisted of five groups of six animals that were challenged with SARS-CoV-2 Victoria (1 x104 pfu) on day 1 and weight changes followed over 7 days.
  • the trimer was administered IP at 4 mg/kg and the same dose delivered directly to the airways via the nasal installation.
  • a tenfold lower intranasal dose of 0.4 mg/kg of C5- timer was also tested.
  • animals in the untreated group showed a significant and progressive weight loss (20 % by day 7), whereas all animals treated therapeutically, 24 h after viral challenge, showed only an initial weight loss and from day 2 recovered to pre- challenged weights (Fig.11).
  • the animals pre-treated prophylactically 2h prior to virus through the nasal route showed no change in weight indicating that the infection had been effectively blocked at day 1.
  • a further dose ranging study will establish the minimum amount of the nanobody required to be therapeutically effective in the hamster disease model.
  • EXAMPLE 6 A quantitative ELISA has been developed for measuring the amount of SARS-CoV2 spike protein, with application for in-process monitoring of spike production in the manufacture of antibody testing kits. Knowledge of the epitopes recognised by the SARS-Cov2 specific VHH enables the selection of the appropriate pairs of VHHs/antibodies in the design of a sandwich ELISA. The quantitative ELISA uses a combination of VHHs and/or antibodies that bind to spatially distinct, spatially separated epitopes on the RBD.
  • results of an ELISA assay in which biotinylated VHH_C1-Fc is coated onto 96-well ELISA plates and captured spike protein is detected by HRP (Horse Radish Peroxide)-conjugated VHH H11-H4 are representative of input levels of spike protein and sensitive to 100 ng/ml.
  • Chemicals PNGase F was purchased from NEB and mTGase was sourced form Zedira (T001).
  • Amino- PEG3-biotin was purchased form ThermoFisher.
  • MES buffer and SDS PAGE gels were purchased from Invitrogen. Vivaspin filter membranes were purchased from Sartorius and the membranes were washed with milliQ water and PBS before use.
  • dgC5-Fc Site specific labelling N-linked glycans on 500 ug C5-Fc (1 mg/mL in PBS) were removed by incubation at 37 oC for 18 h with 5 uL of 5 x PBS buffer and 10 uL of PNGaseF enzyme. The completion of the reaction was determined by gel electrophoresis.
  • Deglycosylated C5-Fc (dgC5-Fc) was purified on a protein A affinity column (GE lifesciences) and eluted with citrate buffer (pH 3) and neutralized using 1 M Tris (pH 9). The purified dgC5-Fc was buffer exchanged into PBS using a 10 kDa Vivaspin filter membrane.
  • CMC carboxymethylcellulose
  • Pseudovirus was produced by co-transfection of HEK-293T cells with a pNL4-3 ( ⁇ Env, luciferase) lentiviral plasmid and a plasmid encoding the SARS-CoV-2 spike gene. Transfection was with polyethylenimine (PEI) for 4 hours. After which, cells were washed, fresh media (DMEM, 10% FBS, 1% P/S) applied, and virus production left to proceed for 48 hours. Virus was harvested by pooling supernatant and concentration by polyethylene glycol (PEG) precipitation. Titration of pseudovirus was performed by infecting cells overexpressing ACE2 (MDCK-ACE2) for 48 hours with a limiting dilution of virus stock.
  • PEI polyethylenimine
  • the recombinant SARS-CoV-2 spike protein was added in serial dilutions ranging from 100 ⁇ g/mL to 0.01 ⁇ g/mL and incubated for 90 minutes at 37 °C with PBS as a negative control.
  • the wells were washed again with PBS and 100 ⁇ L/well of HRP- conjugated probe molecules diluted (from 0.5 mg/mL) in PBS (1:3000) and added to each well and incubated at room temperature for 2 hours.
  • the wells were washed again with PBS, before a freshly prepared solution of developer was added.
  • biotinylated nanobodies streptavidin coated high capacity 96-well microplates from Sigma were washed with Tris-HCl 50 mM, NaCl 150 mM, 0.1% BSA and 0.05% Tween-20 (EWB). A 100 ⁇ L solution of biotinylated nanobodies previously diluted to 0.5 ⁇ g/ mL in EWB was added to each well and incubated at room temperature for 2 hours. The plate was washed with EWB and 100 ⁇ L of a serial dilution of spike protein (typically 10 - 0.0001 ⁇ g/mL) were arrayed in the wells followed by 30 minute incubation at room temperature.
  • spike protein typically 10 - 0.0001 ⁇ g/mL
  • TMB 3,3',5,5'-tetramethylbenzidine
  • H2SO4 2M, 100 ⁇ L/well
  • ELISA with virus C5-Fc was specifically biotinylated as above and the probe nanobody chosen was F2-Fc conjugated to HRP as described above. Streptavidin coated plates and the TMB development protocols described above were used.
  • SARS-CoV-2 Three different means of inactivation of SARS-CoV-2 were employed addition of detergent (Empigen) followed heating (60 C, 30 minutes); addition of 4% formaldehyde (FA) and exposure to 12.2 kGy of X-ray irradiation.
  • a pseudotyped lentivirus NL4.3 expressing SARS-CoV-2 spike protein was also evaluated and was supplied as live virus in PBS.
  • SARS-CoV-2 virus samples were tested in serial dilutions ranging from 4000 ffu/mL to 16.384 ffu/mL.
  • Pseudovirus dilution series ranged from 2500 TCID50/mL to 10.24 TCID50/mL.
  • LOD limit of detection
  • Table 14 The estimated limit of detection in ng/ml *In parenthesis is the slop (x 1000) of the line. In bold is the combination selected. Testing against virus We were unable to test live virus due to safety restrictions, instead we instead tested intact pseudotyped NL4.3 HIV-1 backbone virus displaying surface SARS-CoV-2 S glycoproteins. Our lower limit of detection was 21 TCID50/mL of infectious pseudotyped virus ( Figure 17a). We were able to test inactivated WT SARS-CoV-2 virus.
  • a streptavidin coated 96-well plate was treated with biotinx-C5-Fc-biotin and site specific biotinylated C5-Fc (biotin-SS-C5-Fc-biotin) at the same concentration.
  • biotin-SS-C5-Fc-biotin site specific biotinylated C5-Fc
  • the plates were probed with F2-Fc-HRP.
  • biotin-SS-C5-Fc-biotin as the capture showed an increased sensitivity compared to the multi-biotinylated form for purified Spike protein (147 pg/mL vs 514 pg/mL) and for purified RBD (33 pg/mL vs 85 pg/mL) consistent with the lower molecular weight of the isolated domain.
  • nanobody pairs thus give an ELISA that is simple to use as a laboratory tool to monitor the heterologous production of Spike protein.
  • the probe nanobody, C5 will need to be changed.
  • the advantage of nanobodies is that they are relatively straightforward to raise against new antigens in comparison to their human counterparts. This technology thus offers a robust assay platform for process monitoring.
  • the ELISA was also compatible with the Spike protein when presented as an intact viral particle by using pseudotype virus confirming that the nanobody can recognise natively folded protein as part of an infectious virus.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Oncology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • Microbiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Peptides Or Proteins (AREA)
  • Pulmonology (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/GB2021/052383 2020-09-14 2021-09-14 Single domain antibodies that target sars-cov-2 Ceased WO2022053839A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
JP2023516720A JP2023542107A (ja) 2020-09-14 2021-09-14 SARS-CoV-2を標的とするシングルドメイン抗体
AU2021339978A AU2021339978A1 (en) 2020-09-14 2021-09-14 Single domain antibodies that target sars-cov-2
US18/044,897 US20230374116A1 (en) 2020-09-14 2021-09-14 Single domain antibodies that target sars-cov-2
KR1020237012502A KR20240102916A (ko) 2020-09-14 2021-09-14 Sars-cov-2를 표적으로 하는 단일 도메인 항체
CA3192456A CA3192456A1 (en) 2020-09-14 2021-09-14 Single domain antibodies
EP21778541.9A EP4211157A1 (en) 2020-09-14 2021-09-14 Single domain antibodies that target sars-cov-2
CN202180076660.6A CN117042799A (zh) 2020-09-14 2021-09-14 靶向sars-cov-2的单结构域抗体

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
GB2014453.1 2020-09-14
GBGB2014451.5A GB202014451D0 (en) 2020-09-14 2020-09-14 Single domain antibodies
GB2014451.5 2020-09-14
GBGB2014453.1A GB202014453D0 (en) 2020-09-14 2020-09-14 Linker
GBGB2108319.1A GB202108319D0 (en) 2021-06-10 2021-06-10 Single domain antibodies
GB2108319.1 2021-06-10

Publications (1)

Publication Number Publication Date
WO2022053839A1 true WO2022053839A1 (en) 2022-03-17

Family

ID=77951755

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2021/052383 Ceased WO2022053839A1 (en) 2020-09-14 2021-09-14 Single domain antibodies that target sars-cov-2

Country Status (7)

Country Link
US (1) US20230374116A1 (cg-RX-API-DMAC7.html)
EP (1) EP4211157A1 (cg-RX-API-DMAC7.html)
JP (1) JP2023542107A (cg-RX-API-DMAC7.html)
KR (1) KR20240102916A (cg-RX-API-DMAC7.html)
AU (1) AU2021339978A1 (cg-RX-API-DMAC7.html)
CA (1) CA3192456A1 (cg-RX-API-DMAC7.html)
WO (1) WO2022053839A1 (cg-RX-API-DMAC7.html)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114736293A (zh) * 2022-06-14 2022-07-12 中国农业科学院生物技术研究所 SARS-CoV-2中和性纳米抗体、自组装铁蛋白融合纳米抗体及制备方法和应用
CN114805560A (zh) * 2022-03-21 2022-07-29 中国科学院微生物研究所 纳米抗体r14的构建体及其应用
CN117603358A (zh) * 2023-02-24 2024-02-27 中国科学院微生物研究所 一种广谱新型冠状病毒的双特异性抗体
WO2025218020A1 (zh) * 2024-04-15 2025-10-23 深圳北京中医药大学研究院 SARS-CoV-2驼源纳米抗体或其抗原结合片段、及其组合物和应用
WO2026062389A1 (en) 2024-09-20 2026-03-26 The Rosalind Franklin Institute Single domain antibodies against beta coronavirus spike protein s2 domain

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2727940A1 (en) * 2012-10-31 2014-05-07 Samsung Electronics Co., Ltd Bispecific antigen binding protein complex and preparation methods of bispecific antibodies

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2727940A1 (en) * 2012-10-31 2014-05-07 Samsung Electronics Co., Ltd Bispecific antigen binding protein complex and preparation methods of bispecific antibodies

Non-Patent Citations (50)

* Cited by examiner, † Cited by third party
Title
"Handbook of Pharmaceutical Excipients", 1994
AFROUGH, B.EAKINS, J.DURLEY-WHITE, S ET AL.: "X-ray inactivation of RNA viruses without loss of biological characteristics", SCI REP, vol. 10, 2020, pages 21431
AMANAT, F.K. M. WHITEL. MIORINS. STROHMEIERM. MCMAHONP. MEADEW. C. LIUR. A. ALBRECHTV. SIMONL. MARTINEZ-SOBRIDO: "An In Vitro Microneutralization Assay for SARS-CoV-2 Serology and Drug Screening", CURR PROTOC MICROBIOL, vol. 58, no. 1, 2020, pages e108
ANONYMOUS: "VIB - ExeVir's COVID-19 antibody candidate neutralizes coronavirus Variants of Concern", 13 July 2021 (2021-07-13), XP055871900, Retrieved from the Internet <URL:https://vib.be/news/exevirs-covid-19-antibody-candidate-neutralizes-coronavirus-variants-concern> [retrieved on 20211211] *
ASARNOW, D.PALOVCAK, ECHENG, Y: "UCSF pyem v0.5", ZENODO, 2019, Retrieved from the Internet <URL:https://doi.org/10.5281/zenodo.3576630>
ATYEO, C. SLEINM.D. FISCHINGERS. BURKEJ. SCHAFERA. LEISTS.R. HONKOA. JOHNSONR. STORMN. BERNETTM. LINDE: "Therapeutic potential of SARS-CoV-2-specific monoclonal antibody CR3022", CELL HOST AND MICROBE, 2020
BIRD, L. E.H. RADAJ. FLANAGANJ. M. DIPROSER. J. GILBERTR. J. OWENS: "Application of In-Fusion cloning for the parallel construction of E. coli expression vectors", METHODS MOL BIOL, vol. 1116, 2014, pages 209 - 234
BRACKEN COLTON J ET AL: "Bi-paratopic and multivalent human VH domains neutralize SARS-CoV-2 by targeting distinct epitopes within the ACE2 binding interface of Spike", BIORXIV, 10 August 2020 (2020-08-10), XP055852805, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.08.08.242511v1.full.pdf> [retrieved on 20211019], DOI: 10.1101/2020.08.08.242511 *
BRACKEN COLTON J ET AL: "Supplemental Information: Bi-paratopic and multivalent human VH domains neutralize SARS-CoV-2 by targeting distinct epitopes within the ACE2 binding interface of Spike", BIORXIV, 10 August 2020 (2020-08-10), XP055869139, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.08.08.242511v1.supplementary-material> [retrieved on 20211203], DOI: 10.1101/2020.08.08.242511 *
BURNLEY, T.PALMER, C. M.WINN, M: "Recent developments in the CCP-EM software suite", ACTA CRYSTALLOGR D STRUCT BIOL, vol. 73, 2017, pages 469 - 477
CHAN, J. F. ET AL.: "Simulation of the Clinical and Pathological Manifestations of Coronavirus Disease 2019 (COVID-19) in a Golden Syrian Hamster Model: Implications for Disease Pathogenesis and Transmissibility", CLIN INFECT DIS, vol. 71, 2020, pages 2428 - 2446
COMPTE, M.HARWOOD, S.L.MUNOZ, I.G.NAVARRO, R.ZONCA, M.PEREZ-CHACON, G.ERCE-LLAMAZARES, A.MERINO, N.TAPIA-GALISTEO, A.CUESTA, A.M. : "A tumor-targeted trimeric 4-1 BB-agonistic antibody induces potent anti-tumor immunity without systemic toxicity", NAT. COMMUN., vol. 9, 2018, pages 4809, XP055611095, DOI: 10.1038/s41467-018-07195-w
DANIEL WRAPP ET AL: "Structural Basis for Potent Neutralization of Betacoronaviruses by Single-Domain Camelid Antibodies", CELL, vol. 181, no. 5, 28 May 2020 (2020-05-28), Amsterdam NL, pages 1004 - 1015.e15, XP055764639, ISSN: 0092-8674, DOI: 10.1016/j.cell.2020.04.031 *
DETALLE, L.T. STOHRC. PALOMOP. A. PIEDRAB. E. GILBERTV. MASA. MILLARU. F. POWERC. STORTELERSK. ALLOSERY: "Generation and Characterization of ALX-0171, a Potent Novel Therapeutic Nanobody for the Treatment of Respiratory Syncytial Virus Infection", ANTIMICROB AGENTS CHEMOTHER, vol. 60, no. 1, 2016, pages 6 - 13, XP055492645, DOI: 10.1128/AAC.01802-15
DUMETC. POTTIERJ. GOUILLEUX-GRUARTV. WATIER, H: "Insights into the IgG heavy chain engineering patent landscape as applied to IgG4 antibody development", MABS, vol. 11, no. 8, 2019, pages 1341 - 1350, XP055732501, DOI: 10.1080/19420862.2019.1664365
ELS CONRATH, K.M. LAUWEREYSL. WYNSS. MUYLDERMANS: "Camel single-domain antibodies as modular building units in bispecific and bivalent antibody constructs", J BIOL CHEM, vol. 276, no. 10, 2001, pages 7346 - 7350, XP055331073, DOI: 10.1074/jbc.M007734200
EMSLEY, P.COWTAN, K: "Coot: model-building tools for molecular graphics", ACTA CRYSTALLOGRD STRUCT BIOL, vol. 60, 2004, pages 2126 - 2132
GIRT GEORGINA C ET AL: "The use of nanobodies in a sensitive ELISA test for SARS-CoV-2 Spike 1 protein", ROYAL SOCIETY OPEN SCIENCE, 30 September 2021 (2021-09-30), pages 211016 - 211016, XP055872145, Retrieved from the Internet <URL:https://royalsocietypublishing.org/doi/pdf/10.1098/rsos.211016> [retrieved on 20211213], DOI: 10.1098/rsos.211016 *
GIRT GEORGINA C. ET AL: "Supporting information for The use of nanobodies in a sensitive ELISA test for SARS-CoV-2 Spike 1 protein", ROYAL SOCIETY OPEN SCIENCE, vol. 8, no. 9, 30 September 2021 (2021-09-30), XP055872156, Retrieved from the Internet <URL:https://rs.figshare.com/articles/journal_contribution/Additional_Figures_from_The_use_of_nanobodies_in_a_sensitive_ELISA_test_for_SARS-CoV-2_Spike_1_protein/16704916?backTo=/collections/Supplementary_material_from_The_use_of_nanobodies_in_a_sensitive_ELISA_test_for_SARS-CoV-2_Spike_1_protein_/564172> DOI: 10.1098/rsos.211016 *
GÜTTLER THOMAS ET AL: "Neutralization of SARS-CoV-2 by highly potent, hyperthermostable, and mutation-tolerant nanobodies", THE EMBO JOURNAL / EUROPEAN MOLECULAR BIOLOGY ORGANIZATION, vol. 40, no. 19, 9 August 2021 (2021-08-09), Oxford, pages 107985, XP055858032, ISSN: 0261-4189, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8420576/pdf/EMBJ-40-e107985.pdf> DOI: 10.15252/embj.2021107985 *
HAY, R. T.: "SUMO: a history of modification", MOL CELL, vol. 18, no. 1, 2005, pages 1 - 12
HUO JIANDONG ET AL: "A potent SARS-CoV-2 neutralising nanobody shows therapeutic efficacy in the Syrian golden hamster model of COVID-19", NATURE COMMUNICATIONS, vol. 12, no. 1, 22 September 2021 (2021-09-22), XP055871897, Retrieved from the Internet <URL:https://www.nature.com/articles/s41467-021-25480-z.pdf> DOI: 10.1038/s41467-021-25480-z *
HUO JIANDONG ET AL: "Neutralizing nanobodies bind SARS-CoV-2 spike RBD and block interaction with ACE2", NAT. STRUCT. MOL. BIOL, vol. 27, no. 9, 13 July 2020 (2020-07-13), pages 846 - 854, XP037398758, ISSN: 1545-9993, DOI: 10.1038/S41594-020-0469-6 *
HUO, J.A. LE BASR. R. RUZAH. M. E. DUYVESTEYNH. MIKOLAJEKT. MALINAUSKAST. K. TANP. RIJALM. DUMOUXP. N. WARD: "Neutralizing nanobodies bind SARS-CoV-2 spike RBD and block interaction with ACE2", NAT STRUCT MOL BIOL, 2020, Retrieved from the Internet <URL:https://doi.org/10.1038>
IMAI, M ET AL.: "Syrian hamsters as a small animal model for SARS-CoV-2 infection and countermeasure development", PROC NATL ACAD SCI U S A, vol. 117, 2020, pages 16587 - 16595
JAN TER MEULEN EDWARD N.VAN DEN BRINK LEO L. M.POON, W. E. M.CYNTHIA S. W.LEUNG FREEK COXCHUNG Y. CHEUNGARJEN Q. BAKKERJOHANNES A.: "Human Monoclonal Antibody Combinationagainst SARS Coronavirus: Synergy and Coverage of Escape Mutants", PLOS MEDICINE, vol. 3, no. 7, 2006, pages e237, XP055736906, DOI: 10.1371/journal.pmed.0030237
KUAN-YING A. HUANGL, T. K. T., TING-HUA CHENL, CHUNG-GUEI HUANGL, RUTH HARVEY,SAIRA HUSSAIN, CHENG-PIN CHENL, ADAM HARDINGL, JAVIE: "Breadth and function of antibody response to acute SARSCoV-2 infection in humans", PLOS PATHOGENS, vol. 17, 2021, pages e1009352
LEUNG, B.TRAN, K.AUDET, J ET AL.: "In Vitro inactivation of SARS-CoV-2 using gamma radiation", APPLIED BIOSAFETY, vol. 25, no. 3, 2020
LI WEI ET AL: "High Potency of a Bivalent Human VH Domain in SARS-CoV-2 Animal Models", CELL, ELSEVIER, AMSTERDAM NL, vol. 183, no. 2, 4 September 2020 (2020-09-04), pages 429, XP086297482, ISSN: 0092-8674, [retrieved on 20200904], DOI: 10.1016/J.CELL.2020.09.007 *
LIEBSCHNER, D. ET AL.: "Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix", ACTA CRYSTALLOGR D STRUCT BIOL, vol. 75, 2019, pages 861 - 877
M. SHAH, T. K. TAN, P. RIJAL, N. COOMBES, K. R. BEWLEY, J. A. TREE, J. RADECKE, N. G. PATERSON, P. SUPASA, J.MONGKOLSAPAYA, G. R. : "Neutralization of SARS-CoV-2 by Destruction of the Prefusion Spike", CELL HOST MICROBE, 2020
MURSHUDOV, G. N. ET AL.: "REFMAC5 for the refinement of macromolecular crystal structures", ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 67, 2011, pages 355 - 367
NETTLESHIP, J. E., RAHMAN-HUQ, N. & OWENS, R. J.: "The production of glycoproteins by transient expression in Mammalian cells", METHODS MOL BIOL, vol. 498, 2009, pages 245 - 263, XP009144724
PETTERSEN, E. F. ET AL.: "UCSF chimera - A visualization system for exploratory research and analysis", J. COMP.I CHEM, vol. 25, 2004, pages 1605 - 1612
PUNJANI, A.RUBINSTEIN, J. L.FLEET, D. J.BRUBAKER, M. A.: "cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination", NAT METHODS, vol. 14, 2017, pages 290 - 296, XP055631965, DOI: 10.1038/nmeth.4169
ROGERS, T. F.F. ZHAOD. HUANGN. BEUTLERA. BURNSW. T. HEO. LIMBOC. SMITHG. SONGJ. WOEHL: "Isolation of potent SARS-CoV-2 neutralizing antibodies and protection from disease in a small animal model", SCIENCE, 15 June 2020 (2020-06-15)
SCHEPENS, X. SAELENSJ. S. MCLELLAN: "Structural Basis for Potent Neutralization of Betacoronaviruses by Single-Domain Camelid Antibodies", CELL, vol. 181, no. 6, 2020, pages 1436 - 1441
SCHOOF MICHAEL ET AL: "An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by locking Spike into an inactive conformation", BIORXIV, 17 August 2020 (2020-08-17), XP055865529, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.08.08.238469v2.full.pdf> [retrieved on 20211124], DOI: 10.1101/2020.08.08.238469 *
SIA, S. F. ET AL.: "Pathogenesis and transmission of SARS-CoV-2 in golden hamsters", NATURE, vol. 583, 2020, pages 834 - 838, XP037206161, DOI: 10.1038/s41586-020-2342-5
SUZUKI, SANNAKA, HKONNO, SKUMAGAI, IASANO, R: "Engineering the hinge region of human IfF1 Fc-fused bispecific antibodies to improve fragmentation resistance", NATURE SCIENTIFIC REPORTS, vol. 8, 2018, pages 17253
TESFAYE GELANEW ET AL: "Development and characterization of serotype-specific monoclonal antibodies against the dengue virus-4 (DENV-4) non-structural protein (NS1)", VIROLOGY JOURNAL, vol. 15, no. 1, 1 December 2018 (2018-12-01), XP055606816, DOI: 10.1186/s12985-018-0925-7 *
VON KRBEK, L. K.A. J. ACHAZIS. SCHODERM. GAEDKET. BIBERGERB. PAULUSC. A. SCHALLEY: "The Delicate Balance of Preorganisation and Adaptability in Multiply Bonded Host-Guest Complexes", CHEMISTRY, vol. 23, no. 12, 2017, pages 2877 - 2883
WAGNER, T. ET AL.: "SPHIRE-crYOLO is a fast and accurate fully automated particle picker for cryo-EM", COMMUN BIOL, vol. 2, 2019, pages 218
WALLS, A. C. ET AL.: "Structure, Function, and Antigenicity of the SARS-CoV-2 Spike Glycoprotein", CELL, vol. 181, 2020, pages 281 - 292
WU XILIN ET AL: "Increased neutralization of SARS-CoV-2 Delta variant by nanobody (Nb22) and the structural basis", BIORXIV, 7 September 2021 (2021-09-07), XP055871899, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2021.09.06.459055v1.full.pdf> [retrieved on 20211211], DOI: 10.1101/2021.09.06.459055 *
XIANG YUFEI ET AL: "Versatile, Multivalent Nanobody Cocktails Efficiently Neutralize SARS-CoV-2", BIORXIV, 25 August 2020 (2020-08-25), United States, XP055852802, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.08.24.264333v3.full.pdf> [retrieved on 20211019], DOI: 10.1101/2020.08.24.264333 *
XU JIANLIANG ET AL: "Nanobodies from camelid mice and llamas neutralize SARS-CoV-2 variants", NATURE, NATURE PUBLISHING GROUP UK, LONDON, vol. 595, no. 7866, 7 June 2021 (2021-06-07), pages 278 - 282, XP037500110, ISSN: 0028-0836, [retrieved on 20210607], DOI: 10.1038/S41586-021-03676-Z *
ZHOU D ET AL.: "Evidence of escape of SARS-CoV-2 variant B.1.351 from natural and vaccine-induced sera", CELL, vol. 184, no. 9, 29 April 2021 (2021-04-29), pages 2348 - 2361
ZHOU, D ET AL.: "Structural basis for the neutralization of SARS-CoV-2 by an antibody from a convalescent patient", NAT STRUCT MOL BIOL, vol. 27, 2020, pages 950 - 958, XP037263526, DOI: 10.1038/s41594-020-0480-y
ZIVANOV, J ET AL.: "New tools for automated high-resolution cryo-EM structure determination in RELION-3", ELIFE, 2018, pages 7

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN114805560A (zh) * 2022-03-21 2022-07-29 中国科学院微生物研究所 纳米抗体r14的构建体及其应用
CN114805560B (zh) * 2022-03-21 2022-11-15 中国科学院微生物研究所 纳米抗体r14的构建体及其应用
CN114736293A (zh) * 2022-06-14 2022-07-12 中国农业科学院生物技术研究所 SARS-CoV-2中和性纳米抗体、自组装铁蛋白融合纳米抗体及制备方法和应用
CN117603358A (zh) * 2023-02-24 2024-02-27 中国科学院微生物研究所 一种广谱新型冠状病毒的双特异性抗体
WO2025218020A1 (zh) * 2024-04-15 2025-10-23 深圳北京中医药大学研究院 SARS-CoV-2驼源纳米抗体或其抗原结合片段、及其组合物和应用
WO2026062389A1 (en) 2024-09-20 2026-03-26 The Rosalind Franklin Institute Single domain antibodies against beta coronavirus spike protein s2 domain

Also Published As

Publication number Publication date
EP4211157A1 (en) 2023-07-19
US20230374116A1 (en) 2023-11-23
KR20240102916A (ko) 2024-07-03
JP2023542107A (ja) 2023-10-05
AU2021339978A9 (en) 2024-10-10
AU2021339978A1 (en) 2023-05-04
CA3192456A1 (en) 2022-03-17

Similar Documents

Publication Publication Date Title
US20230374116A1 (en) Single domain antibodies that target sars-cov-2
AU2020286284B2 (en) Novel anti-CD39 antibodies
WO2021244089A1 (zh) 新型冠状病毒(sars-cov-2)刺突蛋白结合分子及其应用
JP2020171288A (ja) インフルエンザヘマグルチニンに対する結合分子及びその使用
US20240207401A1 (en) Coronavirus antibody
US20240270826A1 (en) Antibodies that bind sars-cov-2 spike protein
US20230357364A1 (en) Covid-19 antibodies and uses thereof
KR20240142594A (ko) 코로나바이러스 sars-cov-2의 스파이크 단백질에 결합할 수 있는 항체
Song et al. Structure and function analysis of a potent human neutralizing antibody CA521FALA against SARS-CoV-2
Fu et al. A humanized nanobody phage display library yields potent binders of SARS CoV-2 spike
US20240228595A1 (en) Methods for Monoclonal Antibody Generation
US20230382979A1 (en) Anti-sars-cov-2 antigen antibodies and related compositions and methods
US20230399385A1 (en) Neutralizing antibodies against sars-cov-2
WO2022068844A1 (en) Neutralizing antibody against sars-cov-2
WO2021203397A1 (en) Anti-sars-cov-2 antibodies and uses thereof
CN117042799A (zh) 靶向sars-cov-2的单结构域抗体
US20240401239A1 (en) Synthetic humanized llama nanobody library and use thereof to identify sars-cov-2 neutralizing antibodies
EP4594348A1 (en) Antivirals against human parainfluenza virus
CA3267635A1 (en) Antivirals against human parainfluenza virus
Fu et al. The humanized nanobody RBD-1-2G tolerates the spike N501Y mutation to neutralize SARS-CoV-2
US20240262892A1 (en) Neutralizing antibodies against sars-cov-2
WO2022006562A1 (en) Multispecific coronavirus antibodies

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21778541

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3192456

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2023516720

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023004644

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202347023054

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2021778541

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021778541

Country of ref document: EP

Effective date: 20230414

ENP Entry into the national phase

Ref document number: 2021339978

Country of ref document: AU

Date of ref document: 20210914

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180076660.6

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023004644

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230313

WWW Wipo information: withdrawn in national office

Ref document number: 2021778541

Country of ref document: EP

WWW Wipo information: withdrawn in national office

Ref document number: 1020237012502

Country of ref document: KR